Hit NameLength (aa)HSP LengthHSP ScoreHSP Significance
YJL076W (NET1)1189111345690.0
Scas_711.389986959771e-114
CAGL0H02783g17855489831e-111
Scas_675.2413194029531e-109
Kwal_14.242112056747486e-82
KLLA0C09394g11845397033e-76
AAL181C12215016963e-75
CAGL0B03179g9273403969e-39
YKR010C (TOF2)7711692582e-22
Scas_699.53394114840.079
Scas_496.321464703.1
Kwal_14.176576078687.5
BLASTP 2.2.26 [Sep-21-2011]

Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, 
Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), 
"Gapped BLAST and PSI-BLAST: a new generation of protein database search
programs",  Nucleic Acids Res. 25:3389-3402.

Reference for compositional score matrix adjustment: Altschul, Stephen F., 
John C. Wootton, E. Michael Gertz, Richa Agarwala, Aleksandr Morgulis,
Alejandro A. Schaffer, and Yi-Kuo Yu (2005) "Protein database searches
using compositionally adjusted substitution matrices", FEBS J. 272:5101-5109.

Query= YJL076W
         (1168 letters)

Database: blastdb 
           34,618 sequences; 16,596,109 total letters

Searching..................................................done

                                                                 Score    E
Sequences producing significant alignments:                      (bits) Value

YJL076W (NET1) [2837] chr10 (295161..298730) Nucleolar protein r...  1764   0.0  
Scas_711.38                                                           380   e-114
CAGL0H02783g 251169..256526 some similarities with sp|P47035 Sac...   383   e-111
Scas_675.24                                                           371   e-109
Kwal_14.2421                                                          292   6e-82
KLLA0C09394g 817925..821479 weakly similar to sp|P47035 Saccharo...   275   3e-76
AAL181C [6] [Homologous to ScYJL076W (NET1) - SH; ScYKR010C (TOF...   272   3e-75
CAGL0B03179g complement(309816..312599) weakly similar to sp|P47...   157   9e-39
YKR010C (TOF2) [3266] chr11 complement(458567..460882) Protein t...   103   2e-22
Scas_699.53                                                            37   0.079
Scas_496.3                                                             32   3.1  
Kwal_14.1765                                                           31   7.5  

>YJL076W (NET1) [2837] chr10 (295161..298730) Nucleolar protein
            required for rDNA chromatin silencing and nucleolar
            integrity, has similarity to Tof2p, component of RENT
            complex [3570 bp, 1189 aa]
          Length = 1189

 Score = 1764 bits (4569), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 919/1113 (82%), Positives = 919/1113 (82%)

Query: 1    MYKLQVVLVPPSLQATMPIQFGYGPTIAESSQLLPNRTNMAQSAGDASLQYANLRSANVS 60
            MYKLQVVLVPPSLQATMPIQFGYGPTIAESSQLLPNRTNMAQSAGDASLQYANLRSANVS
Sbjct: 1    MYKLQVVLVPPSLQATMPIQFGYGPTIAESSQLLPNRTNMAQSAGDASLQYANLRSANVS 60

Query: 61   FTPSYFNQSRFRKFLLFTKPTNTLLNLSDEIIDKCEKMYPSLQEDIEILSLQDNSGCDLD 120
            FTPSYFNQSRFRKFLLFTKPTNTLLNLSDEIIDKCEKMYPSLQEDIEILSLQDNSGCDLD
Sbjct: 61   FTPSYFNQSRFRKFLLFTKPTNTLLNLSDEIIDKCEKMYPSLQEDIEILSLQDNSGCDLD 120

Query: 121  PDFLVKDVFNVNNIVRVILKNEIDLDDSAPVSLYKSVKRSKLNNGXXXXXXXXXXXXXXX 180
            PDFLVKDVFNVNNIVRVILKNEIDLDDSAPVSLYKSVKRSKLNNG               
Sbjct: 121  PDFLVKDVFNVNNIVRVILKNEIDLDDSAPVSLYKSVKRSKLNNGSPQSVQPQQQIPSSS 180

Query: 181  GVLRIAKKRPPXXXXXXXXIRSATNGSMRVSTPLARQIYPPPSSKIVSNNSDDEDEDIGE 240
            GVLRIAKKRPP        IRSATNGSMRVSTPLARQIYPPPSSKIVSNNSDDEDEDIGE
Sbjct: 181  GVLRIAKKRPPTGTTTTTTIRSATNGSMRVSTPLARQIYPPPSSKIVSNNSDDEDEDIGE 240

Query: 241  RSFLXXXXXXXXXXIRISSGIDAGKKIKSSIVEEDIVSRSATVDPDKTKQQRLLSGTPIM 300
            RSFL          IRISSGIDAGKKIKSSIVEEDIVSRSATVDPDKTKQQRLLSGTPIM
Sbjct: 241  RSFLPPPTQPQSPPIRISSGIDAGKKIKSSIVEEDIVSRSATVDPDKTKQQRLLSGTPIM 300

Query: 301  STMTPNRVTLTGQRVVSEHAHKNELVXXXXXXXXXXXNGGTAAVTAQDINRKPPVTTPRI 360
            STMTPNRVTLTGQRVVSEHAHKNELV           NGGTAAVTAQDINRKPPVTTPRI
Sbjct: 301  STMTPNRVTLTGQRVVSEHAHKNELVFSASASSSSFANGGTAAVTAQDINRKPPVTTPRI 360

Query: 361  TSGMLKIPEPRISEIEKELKEGPSSPASILXXXXXXXXXXXXYLXXXXXXXXXXXXXXXX 420
            TSGMLKIPEPRISEIEKELKEGPSSPASIL            YL                
Sbjct: 361  TSGMLKIPEPRISEIEKELKEGPSSPASILPAKAAKIPMKKPYLENGENYESDDSSSSEN 420

Query: 421  XXTPETEPHSKASLQRSQSSIADNNGSPVKNSPLGDAMPHNVHLAELPKASNTSITKSSN 480
              TPETEPHSKASLQRSQSSIADNNGSPVKNSPLGDAMPHNVHLAELPKASNTSITKSSN
Sbjct: 421  QETPETEPHSKASLQRSQSSIADNNGSPVKNSPLGDAMPHNVHLAELPKASNTSITKSSN 480

Query: 481  GESWGKQQEHQPPRKSSLETIVEKKSQAEPSGIVEPKRMTNFLDDNQVREKEDTNDKLLE 540
            GESWGKQQEHQPPRKSSLETIVEKKSQAEPSGIVEPKRMTNFLDDNQVREKEDTNDKLLE
Sbjct: 481  GESWGKQQEHQPPRKSSLETIVEKKSQAEPSGIVEPKRMTNFLDDNQVREKEDTNDKLLE 540

Query: 541  KEILPTIPHNDQPILASSDKSNGTLKSLAGKVSSNNNASKEDGTIINGTIEDDGNDNDEV 600
            KEILPTIPHNDQPILASSDKSNGTLKSLAGKVSSNNNASKEDGTIINGTIEDDGNDNDEV
Sbjct: 541  KEILPTIPHNDQPILASSDKSNGTLKSLAGKVSSNNNASKEDGTIINGTIEDDGNDNDEV 600

Query: 601  DTTVRIVPQDSDSSSFPKSDLFKMIEGDDTDLPQWFKGKNSRTSGNSKNSKPYTTVLNKD 660
            DTTVRIVPQDSDSSSFPKSDLFKMIEGDDTDLPQWFKGKNSRTSGNSKNSKPYTTVLNKD
Sbjct: 601  DTTVRIVPQDSDSSSFPKSDLFKMIEGDDTDLPQWFKGKNSRTSGNSKNSKPYTTVLNKD 660

Query: 661  IDNSKPDPRNILPQRTPRSXXXXXXXXXXXXXXNEVPQKXXXXXXXXXXXXXXXXXGIET 720
            IDNSKPDPRNILPQRTPRS              NEVPQK                 GIET
Sbjct: 661  IDNSKPDPRNILPQRTPRSAAKRAAQLLAGAKKNEVPQKSTEDSSSAASTDDESESGIET 720

Query: 721  DFSSDDDFKRKNMSVPNNGPKDISLHSLKGSVVPVKDSKIINKEVDEERNDKRDSQKKSA 780
            DFSSDDDFKRKNMSVPNNGPKDISLHSLKGSVVPVKDSKIINKEVDEERNDKRDSQKKSA
Sbjct: 721  DFSSDDDFKRKNMSVPNNGPKDISLHSLKGSVVPVKDSKIINKEVDEERNDKRDSQKKSA 780

Query: 781  VSESSVTNSKISEQMAKSFYPNSNKKQNEATKVETKPATQAXXXXXXXXXXXXATKGTTS 840
            VSESSVTNSKISEQMAKSFYPNSNKKQNEATKVETKPATQA            ATKGTTS
Sbjct: 781  VSESSVTNSKISEQMAKSFYPNSNKKQNEATKVETKPATQASSFPVVGGSPSVATKGTTS 840

Query: 841  FNEEGNRKNVKTKAKNESAQIDRQQKETTSRVADLKSANIGGEDLNKKAEGSKEPEKASA 900
            FNEEGNRKNVKTKAKNESAQIDRQQKETTSRVADLKSANIGGEDLNKKAEGSKEPEKASA
Sbjct: 841  FNEEGNRKNVKTKAKNESAQIDRQQKETTSRVADLKSANIGGEDLNKKAEGSKEPEKASA 900

Query: 901  NIQDANXXXXXXXXXXXXXXXXXXXXXXMTDHLKEGNVQLPKPSANDKLKDLKAKFTNSK 960
            NIQDAN                      MTDHLKEGNVQLPKPSANDKLKDLKAKFTNSK
Sbjct: 901  NIQDANDKNNSKEKEDSKSKQVSQKKLKMTDHLKEGNVQLPKPSANDKLKDLKAKFTNSK 960

Query: 961  TLVPPGIIXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXRKARRVVVNTPRE 1020
            TLVPPGII                                       RKARRVVVNTPRE
Sbjct: 961  TLVPPGIISNEKNNSSANDDDSSSSGSSTEDESSSSSSSSDEETSTSRKARRVVVNTPRE 1020

Query: 1021 PVRSSSKIEAPSPSVNKKINATPDKIPVTQLMDMXXXXXXXXXXXXXXXXILHDLPRKVR 1080
            PVRSSSKIEAPSPSVNKKINATPDKIPVTQLMDM                ILHDLPRKVR
Sbjct: 1021 PVRSSSKIEAPSPSVNKKINATPDKIPVTQLMDMSSPPSVKSKTTSNPSSILHDLPRKVR 1080

Query: 1081 PSLSSLSDLVSRGIPDVKEKTSKSNEKSQTKAP 1113
            PSLSSLSDLVSRGIPDVKEKTSKSNEKSQTKAP
Sbjct: 1081 PSLSSLSDLVSRGIPDVKEKTSKSNEKSQTKAP 1113

>Scas_711.38
          Length = 998

 Score =  380 bits (977), Expect = e-114,   Method: Compositional matrix adjust.
 Identities = 274/695 (39%), Positives = 372/695 (53%), Gaps = 85/695 (12%)

Query: 1   MYKLQVVLVPPSLQATMPIQFGYGPTIAESSQLLPNRTNMAQSAGDASLQYANLRSANVS 60
           M++LQV LVP + Q           T  E+SQL  N T     + + S QY   R  +  
Sbjct: 3   MFRLQVELVPQNGQLAQQ-------TSIENSQL--NHTRSFIPSTENSFQYPYNRFLSFG 53

Query: 61  FTPSYFNQSRFRKFLLFTKPTNTLLNLSDEIIDKCEKMYPSLQEDIEILSLQDNSGCDLD 120
              ++   ++ +KFLLFTKPTN L  LS EI++KCE MYP L E++EI +L+D++ CDLD
Sbjct: 54  LPLNFSIPTKNKKFLLFTKPTNDLFTLSGEIVEKCESMYPDLSEELEIETLRDSTDCDLD 113

Query: 121 PDFLVKDVFNVNNIVRVILKNEIDLDDSAPVSLYKSVKRSKLNNGXXXXXXXXXXXXXXX 180
           PDF+V++VF+ +N+V+VILKN+ID      VS YKS+KR K N G               
Sbjct: 114 PDFIVEEVFSSSNLVKVILKNDIDFQSLEQVSNYKSIKRRKSNTGSYQPLSNKVSQQQAN 173

Query: 181 GVLRIAKKRPPXXXXXXXXIRSATNGSMRVSTPLARQIYPPPSSKIVSNNSDDEDEDIGE 240
           GV  I +K+           ++ +N   R+STPLA+QIYP    ++     ++ED +  +
Sbjct: 174 GVYGIPRKQ----YLAISSTKTPSNVGRRISTPLAQQIYPDIDEQL----ENEEDRNAAD 225

Query: 241 RSFLXXXXXXXXXXIRISSGIDAGKKIKSSIVEEDIVSRSATVDPDKTKQQRLLSGTPIM 300
           RSFL          IR+SSGID  KKI   I ++D VSRS  VDPDK+KQQRLL GTPIM
Sbjct: 226 RSFLPPPAQPQSPQIRVSSGIDRSKKI-DGIAKDDSVSRSEVVDPDKSKQQRLLLGTPIM 284

Query: 301 STMTPNRVTLTGQRVVSEHAHKNELVXXXXXXXXXXXNGGTAAVTAQDINRKPPVTTPRI 360
           +TMTPNRVTLTGQRVVSE    N L               +    + + NR       R+
Sbjct: 285 TTMTPNRVTLTGQRVVSESHTSNSL------QFIPNNKENSTQRLSSNSNR-------RV 331

Query: 361 TSGMLK-IPEPRISEIEKELKEGPSSPASILXXXXXXXXXXXXYLXXXXXXXXXXXXXXX 419
            S +LK IPEP+I+E+EK LK GPSSPAS+L            +L               
Sbjct: 332 NSAVLKNIPEPKITEVEKVLKAGPSSPASLLPEKSERLPMKRPFL------TGVSSSYSD 385

Query: 420 XXXTPETEPHSKASLQRSQSSIADNNGSPVKNSPLGDAMPHNVHLAELPKASNTSITKSS 479
              + ++  HS+ +LQR QSSIADNNGSPVKNSP  +  P ++ LAELP   N +  ++ 
Sbjct: 386 ENISSDSSTHSRPTLQR-QSSIADNNGSPVKNSPNEENNPDSMQLAELPLDKNVARVQN- 443

Query: 480 NGESWGKQQEHQPPRKSSLETIVEKKSQAEP---SGIVEPKRMTNFLDDNQVREKEDTND 536
                             L  I  ++S+ E    S + +P    N  DDN   E  D N 
Sbjct: 444 ----------------DLLSEIDNRRSRVEDNNLSHLFKPITQEN-RDDNDKTEDTDNNI 486

Query: 537 K-----LLEKE--ILPTIPHNDQPILASSDKSNGTLKSLAGKVSSNNNASKEDGTIINGT 589
           K      +EK+  I P+   +++  L +++   G+      K  + N      G I   T
Sbjct: 487 KHTSKNAVEKQSNITPSFIGDEERELLTNESEVGSTLPPTDKHQNRN------GQI---T 537

Query: 590 IEDDGNDNDEVDTTVRIVP-----QDSDSSSFPKSDLFKMIEGDDTDLPQWFKGKNSRTS 644
             ++ +D DE +TTVRI P     ++S + S  K D+ K+ EG+   +P W KG  S+  
Sbjct: 538 PSEETDDEDEANTTVRINPPGRGDKNSTNVSLQKVDVLKIFEGESLKIPSWLKGSKSK-- 595

Query: 645 GNSKNSKPYTTVLNKDIDNSKPDPRNILPQRTPRS 679
             S+  KPYTTVL KDIDNSKPDPRNILP+RTPRS
Sbjct: 596 --SQRRKPYTTVLYKDIDNSKPDPRNILPERTPRS 628

 Score = 54.7 bits (130), Expect = 4e-07,   Method: Compositional matrix adjust.
 Identities = 34/78 (43%), Positives = 46/78 (58%), Gaps = 4/78 (5%)

Query: 1024 SSSKIEAPSPSVNKKINATPDKIPVTQLMDMXXXXXXXXXXXXXXXXILHD-LPRKVRPS 1082
            SS KI +    + +  N TP K+P+T+L+                  +LH+ LP KVRPS
Sbjct: 843  SSGKIVSDGGRMQQSDNVTPGKVPLTELL---SSPISNKPTPTKVNTMLHNGLPPKVRPS 899

Query: 1083 LSSLSDLVSRGIPDVKEK 1100
            L+SLSDL+ +GIPDVKEK
Sbjct: 900  LNSLSDLIYKGIPDVKEK 917

>CAGL0H02783g 251169..256526 some similarities with sp|P47035
           Saccharomyces cerevisiae YJL076w NET1 required for rDNA
           silencing and nucleolar integrity, start by similarity
          Length = 1785

 Score =  383 bits (983), Expect = e-111,   Method: Compositional matrix adjust.
 Identities = 238/548 (43%), Positives = 315/548 (57%), Gaps = 64/548 (11%)

Query: 1   MYKLQVVLVPPSLQAT-MPIQFGYGP---TIAESSQLLPNRTNM-------AQSAGDASL 49
           MYKLQV+LVPPS+Q     + + YG    +IA+ SQ LPN+ N         QS  D+S+
Sbjct: 1   MYKLQVLLVPPSIQNNNFSLNYNYGQANNSIADQSQQLPNKVNGTFNNTFNGQSQPDSSI 60

Query: 50  QYANLRSANVSFTPSYFNQSRFRKFLLFTKPTNTLLNLSDEIIDKCEKMYPSLQEDIEIL 109
                RS +   TP+Y+ Q   +KFL FTK  NTLL+LSDEI DKC+ MYPSL+ D++IL
Sbjct: 61  FPVLTRSNSSLLTPNYYAQRSMKKFLHFTKANNTLLDLSDEINDKCKAMYPSLEADLDIL 120

Query: 110 SLQDNSGCDLDPDFLVKDVFNVNNIVRVILKNEIDLDDSAPVSLYKSVKRSKLNNGXXXX 169
           SLQD++GCDLDPDF+VKDVFNV+NIVRVIL +E+D+ +  PVS Y+S+KR +LN      
Sbjct: 121 SLQDSNGCDLDPDFVVKDVFNVDNIVRVILNDELDISEITPVSSYRSIKRRRLNPESLAD 180

Query: 170 XXXXXXXXXXXGVLRIAKKRPPXXXXXXXXIRSATNGSMRVSTPLARQIYPPPSSKIVSN 229
                        +++ KKR          I+  +N + R+STPLARQ+Y PPS+     
Sbjct: 181 SKDQSDFGVESQSIKVVKKR----GSTSNVIKGQSNINGRISTPLARQLY-PPSAIFEPQ 235

Query: 230 NSDDEDEDIGERSFLXXXXXXXXXXIRISSGIDAG-KKIKSSIVEEDIVSRSATVDPDKT 288
           NSD  DE++ +RSFL          IRISSGID   +KI S I E+D VSRSATVDPDK+
Sbjct: 236 NSD--DEEVADRSFLPPPIQPGSPPIRISSGIDTNVRKITSRIGEQDTVSRSATVDPDKS 293

Query: 289 KQQRLLSGTPIMSTMTPNRVTLTGQRVVSEHAHKNELVXXXXXXXXXXXNGGTAAVTAQD 348
           +QQRLLSGTP+MSTMTPNRVTLTGQRV+SE                   N      T + 
Sbjct: 294 RQQRLLSGTPVMSTMTPNRVTLTGQRVISEQ----------------RPNDSVLTFTNRH 337

Query: 349 INRKPPVTTPRITSGMLKIPEPRISEIEKELKEGPSSPASILXXXXXXXXXXXXYLXXXX 408
           IN   P  + RITSGML+IPEP+I+E+EKEL EGPSSP++IL            ++    
Sbjct: 338 INE--PSHSRRITSGMLQIPEPKIAEMEKELLEGPSSPSTILPPIPDKIPMKKPFIETER 395

Query: 409 XXXXXXXXXXXXXXTPETEPHSKASLQRSQSSIADNNGSPVKNSPLGDAMPHNVHLAELP 468
                             E ++K+SL R Q+SIADNNGSP++ + L +A    VHLA+LP
Sbjct: 396 YYSEDSSETESNSG----EINAKSSLHR-QTSIADNNGSPLRTNFLNEA----VHLADLP 446

Query: 469 KASNTSITKSSNGESWGKQQEHQPPRKSSLETIVEKKSQAEPSGIVEPKRMTNFLDDNQV 528
           +                K ++   PRK    +I    S  +P     P  + N+++ N  
Sbjct: 447 E--------------LQKSEKASKPRKQVYGSITVNSSNLQPI----PNNINNYVETNAT 488

Query: 529 REKEDTND 536
           + +   ND
Sbjct: 489 KVRSTVND 496

 Score = 34.7 bits (78), Expect = 0.58,   Method: Compositional matrix adjust.
 Identities = 39/100 (39%), Positives = 52/100 (52%), Gaps = 8/100 (8%)

Query: 1008 RKARRVVVNTPREPVR----SSSKIEAPSPSVNKKINATPDKIPVTQLMDMXXXXXXXXX 1063
            RK RR++V+ P+ PV     +SS I+      N  +    +KI   ++            
Sbjct: 1548 RKTRRLIVDVPKGPVIDKKITSSSIDQEHQ--NNSVQQNDNKIEGKKIE--ATTSGSNST 1603

Query: 1064 XXXXXXXILHDLPRKVRPSLSSLSDLVSRGIPDVKEKTSK 1103
                   +L  LP K+RPSLSSLSDLVSRGIPDV+E T K
Sbjct: 1604 KKEPFVGVLQALPEKIRPSLSSLSDLVSRGIPDVRESTIK 1643

>Scas_675.24
          Length = 1319

 Score =  371 bits (953), Expect = e-109,   Method: Compositional matrix adjust.
 Identities = 203/402 (50%), Positives = 263/402 (65%), Gaps = 25/402 (6%)

Query: 1   MYKLQVVLVPPSLQATMPIQFGYGPTIAESSQLL--PNRTN-----MAQSAGDASLQYAN 53
           MYKLQVVLVPPS + ++ +   Y     +SSQ +   N +N     M    GD S+Q++N
Sbjct: 1   MYKLQVVLVPPSARDSL-VPLSYPANQPDSSQFMNDGNGSNILPKSMINGTGDMSMQFSN 59

Query: 54  LRSANVS--FTPSYFNQSRFRKFLLFTKPTNTLLNLSDEIIDKCEKMYPSLQEDIEILSL 111
             +  +     P+Y NQ++ +KFL FTKPTN+LL LSDE++ KCEKMYP+L ED+EIL+L
Sbjct: 60  NNTMTIGSIIRPNYTNQAKTKKFLHFTKPTNSLLALSDEVLAKCEKMYPNLNEDLEILTL 119

Query: 112 QDNSGCDLDPDFLVKDVFNVNNIVRVILKNEIDLDDSAPVSLYKSVKRSKLNNGXXXXXX 171
           QD +GCDLDPDF VKD+FN++N+V V++KNE+D+  +   S+Y++ KR KLNNG      
Sbjct: 120 QDINGCDLDPDFTVKDIFNIDNVVMVLIKNELDVSSAGSTSIYRNFKRQKLNNG-GAQQL 178

Query: 172 XXXXXXXXXGVLRIAKKRPPXXXXXXXXIRSAT---NGSMRVSTPLARQIYPPPSSKIVS 228
                    G L+I KKRP         IR+ T   N ++R+STPLA QIYP P  K+ +
Sbjct: 179 KTSPRTQSTGALKIEKKRP----STSSGIRNPTTNGNSTLRISTPLANQIYPSPIMKM-T 233

Query: 229 NNSDDEDEDIGERSFLXXXXXXXXXXIRISSGIDAGKKIKSSIVEEDIVSRSATVDPDKT 288
           NNSDDE +D+ ERSFL          IRISSGI+  K+I+S+IVEED VSRS TVDPDK+
Sbjct: 234 NNSDDERDDVRERSFLPPPSQPQSPPIRISSGINQSKRIRSTIVEEDTVSRSGTVDPDKS 293

Query: 289 KQQRLLSGTPIMSTMTPNRVTLTGQRVVSEHAHKNELVXXXXXXXXXXXNGGTAAVTAQD 348
           KQQ +L GTP   TMTPNRVTLTGQRV+SE+ + N                 T       
Sbjct: 294 KQQVMLPGTPANYTMTPNRVTLTGQRVLSENYNTNGNNNGLIFV------SSTQGPNKSQ 347

Query: 349 INRKPPVTTPRITSGMLKIPEPRISEIEKELKEGPSSPASIL 390
             ++P ++TPRITSGML+IPEPRI+EIE+EL EGPSSPAS L
Sbjct: 348 QGQQPTLSTPRITSGMLRIPEPRIAEIERELHEGPSSPASAL 389

>Kwal_14.2421
          Length = 1205

 Score =  292 bits (748), Expect = 6e-82,   Method: Compositional matrix adjust.
 Identities = 239/674 (35%), Positives = 332/674 (49%), Gaps = 165/674 (24%)

Query: 1   MYKLQVVLVPPSLQATMPIQFGYGPTIAESSQLLP-------------NRTNMAQSAGDA 47
           MYKLQVVLVPP     +       P  A++SQ+LP             NR  + Q  G +
Sbjct: 1   MYKLQVVLVPPGFSG-VTFALPTNPPTADNSQVLPPNIVSNGSTILGANRPELGQQTGSS 59

Query: 48  SLQYANLRSANVSFTPSYFNQSRFRKFLLFTKPTNTLLNLSDEIIDKCEKMYPSLQEDIE 107
           +  + +      SF  ++ +  + RK L FTKPTNTL +L++EI+++C+K+YP+L   +E
Sbjct: 60  NNLFMS------SFASTHGSTPKLRKLLHFTKPTNTLFSLAEEIVERCDKIYPNLTRPVE 113

Query: 108 ILSLQDNSGCDLDPDFLVKDVFNVNNIVRVILKNEIDLDDSAPVSLYKSVKRSKLNNGXX 167
           +L+LQD++ CDLDPD+LVKDVFNV+N+VR +L+N+I+L D    +LY S KR +LN+   
Sbjct: 114 VLTLQDSNECDLDPDYLVKDVFNVDNVVRAVLRNDIELSDDQSQTLY-SAKRRRLNS--- 169

Query: 168 XXXXXXXXXXXXXGVLRIAKKRPPXXXXXXXXIRSATNGSMRVSTPLARQIYPPPSSKIV 227
                         VL IAKKRP         +R+++  +MRVSTPLA QIYPP + + V
Sbjct: 170 ----SLPNPSGQPNVLHIAKKRP-------HMLRNSS--AMRVSTPLANQIYPPATGRQV 216

Query: 228 SNNSDDEDEDIGERSFLXXXXXXXXXXIRISSGIDAGKKIKSSIVEEDIVSRSATVDPDK 287
             NSD ED+D+G+RS L          IRISSG+ + KKI      ED VSRS  VDPDK
Sbjct: 217 --NSDYEDDDVGDRSVL-PPPQPQSQPIRISSGVGSAKKIN---FNEDTVSRSEAVDPDK 270

Query: 288 TKQQRLLSGTPIM-----STMTPNRV-TLTGQRVVSEHAHKNELVXXXXXXXXXXXNGGT 341
           ++QQRL SGTP+      +  TPNR+  L G     E  +K+                  
Sbjct: 271 SRQQRLPSGTPMRHINNGTATTPNRLNVLDGTLQADEVTNKSSAT--------------- 315

Query: 342 AAVTAQDINRKPPVTTPRITSGMLKIPEPRISEIEKELKEGPSSPASILXXXXXXXXXXX 401
                      P  T  RITSGML+IPEP+ISEIE EL++GP+SP++ L           
Sbjct: 316 -----------PVATNKRITSGMLRIPEPKISEIENELRQGPASPSAELPPRPDRIPMKK 364

Query: 402 XYLXXXXXXXXXXXXXXXXXXTPET------EPHSKASLQRSQSSIADNNGSPVKNSPLG 455
                                  E       E  SK S  R Q+SIADNNGSP+K+   G
Sbjct: 365 QQFPQSDDEEQSQSSGNENPTLMEKANNLILEHGSKPSASR-QTSIADNNGSPIKD---G 420

Query: 456 DAMPHNVHLAELPKASNTSITKSSNGESWGKQQEHQPPRKSSLETIVEKKSQAEPSGIVE 515
           + +  NV+LAELP+     IT                 RKSSLE+ VE         ++ 
Sbjct: 421 NKI-GNVNLAELPQVGRR-IT-----------------RKSSLESKVE--------SLI- 452

Query: 516 PKRMTNFLDDNQVREKEDTNDKLLEKEILPTIPHNDQPILASSDKSNGTLKSLAGKVSSN 575
            K  TN                                    S+++ G L+ L  K +SN
Sbjct: 453 -KSATNL-----------------------------------SEEARGDLQRL--KDNSN 474

Query: 576 N-----NASKEDGTIINGTIEDDGNDNDEVDTTVRIVPQD-SDSSSFPKSDLFKMIEGDD 629
           N       S+ED   + G + +D ND      TVR+   D S +SSF KS+L  M++G+ 
Sbjct: 475 NAIRKDTFSEEDD--MEGQLPEDPND------TVRVNHLDNSGNSSFQKSELLSMLKGNK 526

Query: 630 TDLPQWFKGKNSRT 643
            ++P  F  ++ R+
Sbjct: 527 FNIPSDFNKRSLRS 540

>KLLA0C09394g 817925..821479 weakly similar to sp|P47035
           Saccharomyces cerevisiae YJL076w NET1 required for rDNA
           silencing and nucleolar integrity, start by similarity
          Length = 1184

 Score =  275 bits (703), Expect = 3e-76,   Method: Compositional matrix adjust.
 Identities = 211/539 (39%), Positives = 270/539 (50%), Gaps = 102/539 (18%)

Query: 1   MYKLQVVLVPPSLQATMPIQFGYGPTIAESSQLLPNRTNMAQSAGDASLQYANLRSA--- 57
           M+KLQVVLVP    A     FG     +ESSQ +          G  + Q AN   A   
Sbjct: 1   MFKLQVVLVPAG--ANRSFNFGLPSVSSESSQFILPVQQQVLQQGGNAPQLANNIPAQNG 58

Query: 58  ------NVS--------FTPSYFNQSRFRKFLLFTKPTNTLLNLSDEIIDKCEKMYPSLQ 103
                 NVS        F  S+  + + +KFL+FTKPTNTL  LS EI+DKC K+YP+L 
Sbjct: 59  IGALDPNVSTNTAYLSSFMTSHITRPKLKKFLIFTKPTNTLYQLSQEILDKCNKIYPNLS 118

Query: 104 EDIEILSLQDNSGCDLDPDFLVKDVFNVNNIVRVILKNEIDLDDSAP---VSLYKSVKRS 160
            ++EI +LQD   CDLDPDF+VKDVFNV N VRVIL+N++DL +S P    SLY S KR 
Sbjct: 119 TELEIDTLQDVDECDLDPDFVVKDVFNVYNTVRVILRNDVDL-ESNPDRQESLYSS-KRR 176

Query: 161 KLNNGXXXXXXXXXXXXXXXGVLRIAKKRPPXXXXXXXXIRSATNGSMRVSTPLARQIYP 220
           KLNNG                 + +AK+RP          ++  N ++R+STPLA QIYP
Sbjct: 177 KLNNGNSQQNTSTGATLDQP--VTVAKRRP----------QALKNSALRISTPLAHQIYP 224

Query: 221 PPSSK----IVSNNSDDE--DEDIGERSFLXXXXXXXXXXIRISSGIDAGKKIKSSIVEE 274
           PPS +    + S+  +DE  D++IG++S L          IRISS I A K++K +   E
Sbjct: 225 PPSQRNPKQVNSDYEEDEYGDDEIGDKSILPPPTVPQSPPIRISSSI-AQKRLKIN-GSE 282

Query: 275 DIVSRSATVDPDKTKQQRLLSGTPI--MSTM-TPNRVTLTGQRVVSEHAHKNELVXXXXX 331
           D VS+S TVDP K KQQRL SGTP+  M+ + TPNR         ++H  +         
Sbjct: 283 DTVSKSETVDPSKAKQQRLPSGTPMKPMNVIETPNRPGFLAMPQQAQHLLR--------- 333

Query: 332 XXXXXXNGGTAAVTAQDINRKPPVTTPRITSGMLKIPEPRISEIEKELKEGPSSPAS-IL 390
                            IN  P VT  RITSGML+IPEPRISE+E+ + EG SSPA+ +L
Sbjct: 334 -----------------INSTPVVTNKRITSGMLRIPEPRISEMERTMHEGLSSPAAGLL 376

Query: 391 XXXXXXXXXXXXYLXXXXXXXXXXXXXXXXXXTPETEPHSKASL-----QRSQSSIADNN 445
                       Y+                  +     +SKA L      R+ SSIAD+N
Sbjct: 377 PPKSAKIPMKKQYIPDEHDSSSSEGEFTEDKESVPVRVNSKAPLPVSVQSRAPSSIADDN 436

Query: 446 GSPVKNSPLGDAMPHNVHLAELPKASNTSITKSSNGESWGKQQEHQPPRKSSLETIVEK 504
           GSP K SPL      NV +A+LP                       P RKSSLE  VEK
Sbjct: 437 GSPTKKSPLDATKRMNVKVADLP-----------------------PQRKSSLEAKVEK 472

 Score = 75.1 bits (183), Expect = 3e-13,   Method: Compositional matrix adjust.
 Identities = 39/79 (49%), Positives = 50/79 (63%), Gaps = 3/79 (3%)

Query: 603 TVRIVPQDSDSSSFPKSDLFKMIEGDDTDLPQWFK---GKNSRTSGNSKNSKPYTTVLNK 659
           TV I P D    SF KS+L ++++G   D+P  F+   G       N ++ KPY TVLNK
Sbjct: 513 TVCIHPTDRMDGSFQKSELLELLKGSKFDVPPAFRRAAGALQENDINKRSRKPYLTVLNK 572

Query: 660 DIDNSKPDPRNILPQRTPR 678
           DIDNS+PDPRNILP + PR
Sbjct: 573 DIDNSEPDPRNILPSKLPR 591

>AAL181C [6] [Homologous to ScYJL076W (NET1) - SH; ScYKR010C (TOF2)
           - SH] (20056..23721) [3666 bp, 1221 aa]
          Length = 1221

 Score =  272 bits (696), Expect = 3e-75,   Method: Compositional matrix adjust.
 Identities = 191/501 (38%), Positives = 261/501 (52%), Gaps = 79/501 (15%)

Query: 1   MYKLQVVLVPPSLQATMPI---------QFGYGPTIAE---SSQLLPNRTNMAQSAGDAS 48
           MYKLQVVLVPPS++  +P+           G+    A+   +S +   R   +   G+ S
Sbjct: 1   MYKLQVVLVPPSIETELPVVGLPAGSLDNSGFAQGHAQPISTSSIAGGRGEFSSGIGNTS 60

Query: 49  LQYANLRSANVSFTPSYFNQSRFRKFLLFTKPTNTLLNLSDEIIDKCEKMYPSLQEDIEI 108
                L         ++  ++R RKFL FTKPTN+L  L+DEI++KC KMYP L E+ EI
Sbjct: 61  ANAVYLSG----LVGAHIRRARGRKFLHFTKPTNSLYELADEIVEKCAKMYPGLAEEPEI 116

Query: 109 LSLQDNSGCDLDPDFLVKDVFNVNNIVRVILKNEIDLDDSAP-VSLYKSVKRSKLNNGXX 167
           ++LQD + CDLDPDF+VKDVFN++N VRV+L+N  DLD++A   ++Y  +K+ KLN    
Sbjct: 117 VTLQDVNECDLDPDFVVKDVFNMDNTVRVLLRN--DLDEAAGDRTIY--MKKRKLNT--G 170

Query: 168 XXXXXXXXXXXXXGVLRIAKKRPPXXXXXXXXIRSATNGSMRVSTPLARQIYPPPSSKIV 227
                         VL +AKKR            S    ++RVSTPLA QIYPPP+ K V
Sbjct: 171 AAGVPAAGGSVQAAVLNVAKKR-----------ASIKTSALRVSTPLANQIYPPPTKKQV 219

Query: 228 SNNSDDEDEDIGERSFLXXXXXXXXXXIRISSGIDAGKKIKSSIVEEDIVSRSATVDPDK 287
             NSD ED+D+ ++S L          IRISSG+D  K+I    + ++ VS+S TVDP+K
Sbjct: 220 --NSDFEDDDVADKSIL-PPPPPQSPPIRISSGMDQ-KRIN---MNDNAVSKSETVDPNK 272

Query: 288 TKQQRLLSGT---PIMSTMTPNRVTLTGQRVVSEHAHKNELVXXXXXXXXXXXNGGTAAV 344
           ++QQRL SGT   P+    TPNRV+LTG  V+SE                        + 
Sbjct: 273 SRQQRLPSGTPMRPVSMVETPNRVSLTGPTVLSE------------------------ST 308

Query: 345 TAQDINRKPPVTTPRITSGMLKIPEPRISEIEKELKEGPSSPASILXXXXXXXXXXXXYL 404
            +Q     P +T  RITSGML+IPEPR+SE+EKELKEGP+SPA  L            Y 
Sbjct: 309 VSQKSTATPIITNIRITSGMLRIPEPRLSEVEKELKEGPASPAVDLPARPSRIPMKKPYN 368

Query: 405 XXXXXXXXXXXXXXXXXXTPETEPHSK--------ASLQRSQSSIADNNGSPVKNSPLGD 456
                                  P+           + ++S S+IAD+ GSP K S    
Sbjct: 369 PSMQQDEDLSSSSSSTEDNVPAVPYENELERSGPTMATRQSSSTIADDQGSPTKKSRFEK 428

Query: 457 AMPHNVHLAELPKASNTSITK 477
              +N+ L ELP    +S+ K
Sbjct: 429 ---NNIGLVELPSPRKSSLEK 446

 Score = 70.9 bits (172), Expect = 5e-12,   Method: Compositional matrix adjust.
 Identities = 38/75 (50%), Positives = 45/75 (60%), Gaps = 4/75 (5%)

Query: 608 PQDSDSSSFPKSDLFKMIEGDDTDLPQWFKGKNSR----TSGNSKNSKPYTTVLNKDIDN 663
           P+     SF KS+L K+      DLP  FK   S     +S  S+  KPY TVLNKDIDN
Sbjct: 492 PETQREKSFQKSELLKIFNSKRFDLPPRFKNSASEDEPTSSNQSRKKKPYVTVLNKDIDN 551

Query: 664 SKPDPRNILPQRTPR 678
           S PDPRNI+P+RT R
Sbjct: 552 SSPDPRNIIPRRTQR 566

>CAGL0B03179g complement(309816..312599) weakly similar to sp|P47035
           Saccharomyces cerevisiae YJL076w NET1 required for rDNA
           silencing and nucleolar integrity, start by similarity
          Length = 927

 Score =  157 bits (396), Expect = 9e-39,   Method: Compositional matrix adjust.
 Identities = 120/340 (35%), Positives = 165/340 (48%), Gaps = 63/340 (18%)

Query: 1   MYKLQVVLVPPSLQATMPIQFGYGPTIAESSQLLPNRTNMAQSAGDAS--LQYANLRSAN 58
           MYKLQVVL+ P  Q                      + N     GD S       +R+  
Sbjct: 1   MYKLQVVLIQPQNQL---------------------KANGYSIDGDNSDDQTITTIRNG- 38

Query: 59  VSFTPSYFNQSRFRKFLLFTKPTNTLLNLSDEIIDKCEKMYPSLQ-EDIEILSLQDNSGC 117
                 +  +   RKFL FTKP NTLL L+DEI ++  K+Y +L  E  EILSLQD + C
Sbjct: 39  -----GHIIRDHTRKFLHFTKPENTLLQLADEIENRITKLYSNLNIESFEILSLQDINHC 93

Query: 118 DLDPDFLVKDVFNVNNIVRVILKNEI------------DLDDSAPVSLYKSVKRSKLNNG 165
           DLD  +LVKDVF+++N V VILKNE+            DL D+  +S Y SV++ + +  
Sbjct: 94  DLDATYLVKDVFSMDNTVLVILKNELEFIDANGTLNANDLHDAGRISAYSSVRKRRSSKA 153

Query: 166 XXXXXXXXXXXXXXXGVLRIAKKRPPXXXXXXXXIRSATNGSMRVSTPLARQIYPPP--S 223
                            + + K+  P          +  + ++RV++PLA +I      S
Sbjct: 154 FGNSSRIEPQ-------ILVPKRSKPNNL-------APLSNNLRVTSPLANEISNDEINS 199

Query: 224 SKIVSNNS-----DDEDEDIGERSFLXXXXXXXXXXIRISSGIDAGKKIKSSIVEEDIVS 278
           S +V N +           + +RSFL          IRISSGI  GK+I S     D+VS
Sbjct: 200 STVVINRNVSTAFAANRSTLTDRSFLPPPAQPQSPAIRISSGIGDGKRIFSESQNLDVVS 259

Query: 279 RSATVDPDKTKQQRLLSGTPIMSTMTPNRVTLTGQRVVSE 318
           RS  VDPDK+KQQ ++   P+    TPNRV L+GQRV+SE
Sbjct: 260 RSEVVDPDKSKQQLIVPDIPMEFISTPNRVNLSGQRVISE 299

>YKR010C (TOF2) [3266] chr11 complement(458567..460882) Protein that
           interacts with DNA topoisomerase I [2316 bp, 771 aa]
          Length = 771

 Score =  103 bits (258), Expect = 2e-22,   Method: Compositional matrix adjust.
 Identities = 57/169 (33%), Positives = 98/169 (57%), Gaps = 8/169 (4%)

Query: 1   MYKLQVVLVPPS-------LQATMPIQFGYGPTIAESSQLLPNRTNMAQSAGDASLQYAN 53
           M++LQ+VLVPPS       L+A +       P +  +  ++ +  ++   +  +    ++
Sbjct: 4   MWRLQIVLVPPSAQDIITFLEARLNTPQSVSPMVQYNEDIITHNNSINNCSDPSPTSPSS 63

Query: 54  LRSANVSFTPSYFNQS-RFRKFLLFTKPTNTLLNLSDEIIDKCEKMYPSLQEDIEILSLQ 112
             S   + +  + N     +KFL FT   NTLL LS+EI+ K +++YP+ +E IEI+SLQ
Sbjct: 64  QNSIQSNRSSDFINYLPNCKKFLHFTDGDNTLLQLSNEILTKFDRLYPNFKESIEIVSLQ 123

Query: 113 DNSGCDLDPDFLVKDVFNVNNIVRVILKNEIDLDDSAPVSLYKSVKRSK 161
           D  GCDLD +F++KDVF  + +V VILK+E+D   +  +SL +  ++ +
Sbjct: 124 DRHGCDLDSEFIIKDVFENDGVVLVILKDELDWSRNQHISLLQLARQRR 172

>Scas_699.53
          Length = 394

 Score = 37.0 bits (84), Expect = 0.079,   Method: Compositional matrix adjust.
 Identities = 32/114 (28%), Positives = 48/114 (42%), Gaps = 8/114 (7%)

Query: 546 TIPHNDQPI-LASSDKSNGTLKSLAGKVSSNNNASKEDGTIINGTIEDDGNDNDEVDTTV 604
           T P N   I L   + ++  L  L G  +    + K+D  ++NG I        E D  +
Sbjct: 28  TTPSNQISIELNDEEDADNELAQLNGLWNQYFKSDKDDEILLNGMIH-------ECDRIL 80

Query: 605 RIVPQDSDSSSFPKSDLFKMIEGDDTDLPQWFKGKNSRTSGNSKNSKPYTTVLN 658
           RIV  D D+SS  +  L K+I  DD     +    +  T   S+N K  +   N
Sbjct: 81  RIVKSDDDASSEERGKLTKLIHSDDRFYACFALALSELTVFKSENVKEVSEFFN 134

>Scas_496.3
          Length = 214

 Score = 31.6 bits (70), Expect = 3.1,   Method: Compositional matrix adjust.
 Identities = 21/64 (32%), Positives = 30/64 (46%), Gaps = 12/64 (18%)

Query: 65  YFNQSRFRKFLLFTKPTNTLLNLSDEIIDKCEKMYPSLQEDIEILSLQDNSGCDLDPDFL 124
           YFNQ R R   LF +  N   N+ + ++ +  K YPS     E  + QDN        F+
Sbjct: 114 YFNQLRDRDLNLFQQSNNLDWNVCENVLAQFGKSYPS-----EFQNQQDNG-------FV 161

Query: 125 VKDV 128
           V D+
Sbjct: 162 VDDL 165

>Kwal_14.1765
          Length = 760

 Score = 30.8 bits (68), Expect = 7.5,   Method: Compositional matrix adjust.
 Identities = 22/78 (28%), Positives = 39/78 (50%), Gaps = 5/78 (6%)

Query: 731 KNMSVPNNGPKDISLHSLKGS--VVPVKDSKII---NKEVDEERNDKRDSQKKSAVSESS 785
           +N+S+  +GPKD   HS K S     +  S      N   +E+++DK  S ++S+  ES+
Sbjct: 448 ENISIKKDGPKDKKEHSTKTSRGAASLGISNFFKRKNSHANEDKSDKHSSSRRSSPGEST 507

Query: 786 VTNSKISEQMAKSFYPNS 803
             N  I     + +Y ++
Sbjct: 508 KMNLCIQNSFLEDYYAST 525

  Database: blastdb
    Posted date:  Apr 3, 2006  3:33 PM
  Number of letters in database: 16,596,109
  Number of sequences in database:  34,618
  
Lambda     K      H
   0.306    0.125    0.338 

Gapped
Lambda     K      H
   0.267   0.0410    0.140 

Matrix: BLOSUM62
Gap Penalties: Existence: 11, Extension: 1
Number of Sequences: 34618
Number of Hits to DB: 32,179,942
Number of extensions: 1370899
Number of successful extensions: 5361
Number of sequences better than 10.0: 152
Number of HSP's gapped: 5378
Number of HSP's successfully gapped: 186
Length of query: 1168
Length of database: 16,596,109
Length adjustment: 113
Effective length of query: 1055
Effective length of database: 12,684,275
Effective search space: 13381910125
Effective search space used: 13381910125
Neighboring words threshold: 11
Window for multiple hits: 40
X1: 16 ( 7.1 bits)
X2: 38 (14.6 bits)
X3: 64 (24.7 bits)
S1: 43 (22.0 bits)
S2: 67 (30.4 bits)