Hit NameLength (aa)HSP LengthHSP ScoreHSP Significance
YJL074C (SMC3)1230120859580.0
Scas_711.391227121738820.0
CAGL0H02805g1219121034250.0
AAL182W1231122431100.0
Kwal_14.24351247120730220.0
KLLA0A00286g1280121128090.0
AGR236W11707324032e-39
KLLA0D16005g11707343594e-34
YFL008W (SMC1)122512943183e-29
CAGL0D05258g11704282736e-24
Kwal_55.2042111702352665e-23
Sklu_2249.210832432584e-22
AGR089C13707312532e-21
Scas_565.611701932513e-21
YFR031C (SMC2)11701892083e-16
CAGL0F02079g12237132041e-15
CAGL0L12188g13982042012e-15
Scas_681.414091011871e-13
Kwal_56.238251396841852e-13
YLR086W (SMC4)1418951833e-13
KLLA0F19085g1372821781e-12
AGL023W12222161771e-12
Scas_707.2312232091546e-10
KLLA0D07502g1243711422e-08
Kwal_23.50431225711403e-08
KLLA0F07997g11192221323e-07
Scas_643.1110952721313e-07
AEL337C10972021314e-07
AER044W11034621288e-07
Kwal_26.720411171971233e-06
CAGL0F01155g11054661127e-05
YOL034W (SMC5)10932221063e-04
CAGL0H05071g11101541063e-04
Scas_719.610961581000.002
Kwal_33.13526129892890.035
YBL047C (EDE1)1381213850.087
KLLA0E05247g1098109850.093
YLR383W (RHC18)111483850.097
CAGL0G02937g56474840.10
YDL058W (USO1)1790180820.20
KLLA0B14256g127184820.20
Kwal_26.9380110275820.21
Scas_636.1460853810.24
YDR091C60863800.28
CAGL0G08041g60782790.45
Kwal_56.2342953953770.73
AGR125W60763770.79
YPR049C (ATG11)1178100761.0
CAGL0L01221g99449732.2
KLLA0C13926g78479704.4
KLLA0C01991g70656696.6
CAGL0J07788g130592697.1
KLLA0E00891g38742688.0
AFR637W129652688.1
KLLA0C17556g60782689.2
BLASTP 2.2.26 [Sep-21-2011]

Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, 
Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), 
"Gapped BLAST and PSI-BLAST: a new generation of protein database search
programs",  Nucleic Acids Res. 25:3389-3402.

Reference for compositional score matrix adjustment: Altschul, Stephen F., 
John C. Wootton, E. Michael Gertz, Richa Agarwala, Aleksandr Morgulis,
Alejandro A. Schaffer, and Yi-Kuo Yu (2005) "Protein database searches
using compositionally adjusted substitution matrices", FEBS J. 272:5101-5109.

Query= YJL074C
         (1208 letters)

Database: blastdb 
           34,618 sequences; 16,596,109 total letters

Searching..................................................done

                                                                 Score    E
Sequences producing significant alignments:                      (bits) Value

YJL074C (SMC3) [2838] chr10 complement(299073..302765) Cohesin, ...  2299   0.0  
Scas_711.39                                                          1499   0.0  
CAGL0H02805g complement(256682..260341) similar to sp|P47037 Sac...  1323   0.0  
AAL182W [5] [Homologous to ScYJL074C (SMC3) - SH] complement(161...  1202   0.0  
Kwal_14.2435                                                         1168   0.0  
KLLA0A00286g complement(22024..25866) similar to sp|P47037 Sacch...  1086   0.0  
AGR236W [4547] [Homologous to ScYFR031C (SMC2) - SH] complement(...   159   2e-39
KLLA0D16005g complement(1346492..1350004) similar to sp|P38989 S...   142   4e-34
YFL008W (SMC1) [1674] chr6 (119424..123101) Coiled-coil protein ...   127   3e-29
CAGL0D05258g 500858..504370 similar to sp|P38989 Saccharomyces c...   109   6e-24
Kwal_55.20421                                                         107   5e-23
Sklu_2249.2 YFR031C, Contig c2249 627-3873 reverse complement         103   4e-22
AGR089C [4399] [Homologous to ScYLR086W (SMC4) - SH] (901443..90...   102   2e-21
Scas_565.6                                                            101   3e-21
YFR031C (SMC2) [1711] chr6 complement(216582..220094) Subunit of...    85   3e-16
CAGL0F02079g 201002..204673 similar to sp|P32908 Saccharomyces c...    83   1e-15
CAGL0L12188g 1308672..1312868 similar to tr|Q12267 Saccharomyces...    82   2e-15
Scas_681.4                                                             77   1e-13
Kwal_56.23825                                                          76   2e-13
YLR086W (SMC4) [3501] chr12 (302244..306500) Subunit of condensi...    75   3e-13
KLLA0F19085g 1758111..1762229 similar to sgd|S0004081 Saccharomy...    73   1e-12
AGL023W [4288] [Homologous to ScYFL008W (SMC1) - SH] complement(...    73   1e-12
Scas_707.23                                                            64   6e-10
KLLA0D07502g complement(642751..646482) similar to sp|P32908 Sac...    59   2e-08
Kwal_23.5043                                                           59   3e-08
KLLA0F07997g complement(748561..751920) similar to sgd|S0005394 ...    55   3e-07
Scas_643.11                                                            55   3e-07
AEL337C [2168] [Homologous to ScYOL034W - SH] (14613..17906) [32...    55   4e-07
AER044W [2549] [Homologous to ScYLR383W (RHC18) - SH] complement...    54   8e-07
Kwal_26.7204                                                           52   3e-06
CAGL0F01155g complement(116762..120079) similar to tr|Q08204 Sac...    48   7e-05
YOL034W (SMC5) [4782] chr15 (259923..263204) Protein containing ...    45   3e-04
CAGL0H05071g 486899..490231 similar to sp|Q12749 Saccharomyces c...    45   3e-04
Scas_719.6                                                             43   0.002
Kwal_33.13526                                                          39   0.035
YBL047C (EDE1) [147] chr2 complement(127860..132005) Protein wit...    37   0.087
KLLA0E05247g complement(472583..475879) similar to sp|Q12749 Sac...    37   0.093
YLR383W (RHC18) [3762] chr12 (885288..888632) Protein involved i...    37   0.097
CAGL0G02937g complement(268985..270679) highly similar to sp|P06...    37   0.10 
YDL058W (USO1) [807] chr4 (345665..351037) Coiled-coil protein w...    36   0.20 
KLLA0B14256g 1248654..1252469 similar to sp|P12866 Saccharomyces...    36   0.20 
Kwal_26.9380                                                           36   0.21 
Scas_636.14                                                            36   0.24 
YDR091C (YDR091C) [943] chr4 complement(626702..628528) Putative...    35   0.28 
CAGL0G08041g complement(758811..760634) highly similar to tr|Q03...    35   0.45 
Kwal_56.23429                                                          34   0.73 
AGR125W [4436] [Homologous to ScYDR091C (RLI1) - SH] complement(...    34   0.79 
YPR049C (ATG11) [5481] chr16 complement(661132..664668) Peripher...    34   1.0  
CAGL0L01221g 137742..140726 similar to sp|P32618 Saccharomyces c...    33   2.2  
KLLA0C13926g 1195709..1198063 similar to sp|P40850 Saccharomyces...    32   4.4  
KLLA0C01991g 160778..162898 similar to sp|P33310 Saccharomyces c...    31   6.6  
CAGL0J07788g complement(757051..760968) similar to sp|P12753 Sac...    31   7.1  
KLLA0E00891g complement(98423..99586) similar to sp|P39952 Sacch...    31   8.0  
AFR637W [3829] [Homologous to ScYNL250W (RAD50) - SH] complement...    31   8.1  
KLLA0C17556g complement(1544404..1546227) highly similar to sgd|...    31   9.2  

>YJL074C (SMC3) [2838] chr10 complement(299073..302765) Cohesin,
            coiled-coil protein of the SMC family involved in
            chromosome condensation and segregation [3693 bp, 1230
            aa]
          Length = 1230

 Score = 2299 bits (5958), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 1149/1208 (95%), Positives = 1149/1208 (95%)

Query: 1    MYIKRVIIKGFKTYRNETIIDNFSPHQNVIIGSNGSGKSNFFAAIRFVLSDDYSNLKREE 60
            MYIKRVIIKGFKTYRNETIIDNFSPHQNVIIGSNGSGKSNFFAAIRFVLSDDYSNLKREE
Sbjct: 1    MYIKRVIIKGFKTYRNETIIDNFSPHQNVIIGSNGSGKSNFFAAIRFVLSDDYSNLKREE 60

Query: 61   RQGLIHQGSGGSVMSASVEIVFHDPDHSMILPSGVLSRGDDEVTIRRTVGLKKDDYQLND 120
            RQGLIHQGSGGSVMSASVEIVFHDPDHSMILPSGVLSRGDDEVTIRRTVGLKKDDYQLND
Sbjct: 61   RQGLIHQGSGGSVMSASVEIVFHDPDHSMILPSGVLSRGDDEVTIRRTVGLKKDDYQLND 120

Query: 121  RNVTKGDIVRMLETAGFSMNNPYNIVPQGKIVALTNAKDKERLQLLEDVVGAKSFEVKLK 180
            RNVTKGDIVRMLETAGFSMNNPYNIVPQGKIVALTNAKDKERLQLLEDVVGAKSFEVKLK
Sbjct: 121  RNVTKGDIVRMLETAGFSMNNPYNIVPQGKIVALTNAKDKERLQLLEDVVGAKSFEVKLK 180

Query: 181  ASLKKMEETEQKKIQINKEMGELNSKLSEMEQERKELEKYNELERNRKIYQFTLYDRELN 240
            ASLKKMEETEQKKIQINKEMGELNSKLSEMEQERKELEKYNELERNRKIYQFTLYDRELN
Sbjct: 181  ASLKKMEETEQKKIQINKEMGELNSKLSEMEQERKELEKYNELERNRKIYQFTLYDRELN 240

Query: 241  EVINQMERLDGDYNNTVYSSEQYIQELDKREDMIDQVSKKLSSIEASLKIKNATDLQQAK 300
            EVINQMERLDGDYNNTVYSSEQYIQELDKREDMIDQVSKKLSSIEASLKIKNATDLQQAK
Sbjct: 241  EVINQMERLDGDYNNTVYSSEQYIQELDKREDMIDQVSKKLSSIEASLKIKNATDLQQAK 300

Query: 301  LRESEISQKLTNVNVKIKDVQQQIESNEEQRNLDSATLKEIKSIIEQRKQKLSKILPRYQ 360
            LRESEISQKLTNVNVKIKDVQQQIESNEEQRNLDSATLKEIKSIIEQRKQKLSKILPRYQ
Sbjct: 301  LRESEISQKLTNVNVKIKDVQQQIESNEEQRNLDSATLKEIKSIIEQRKQKLSKILPRYQ 360

Query: 361  ELTKEEAMYKLQLASLQQKQRDLILKKGEYARFKSKDERDTWIHSEIEELKSSIQNLNEL 420
            ELTKEEAMYKLQLASLQQKQRDLILKKGEYARFKSKDERDTWIHSEIEELKSSIQNLNEL
Sbjct: 361  ELTKEEAMYKLQLASLQQKQRDLILKKGEYARFKSKDERDTWIHSEIEELKSSIQNLNEL 420

Query: 421  ESQLQMDRTSLRKQYSAXXXXXXXXXXXXNGPDTKGQLEDFDSELIHLKQKLSESLDTRK 480
            ESQLQMDRTSLRKQYSA            NGPDTKGQLEDFDSELIHLKQKLSESLDTRK
Sbjct: 421  ESQLQMDRTSLRKQYSAIDEEIEELIDSINGPDTKGQLEDFDSELIHLKQKLSESLDTRK 480

Query: 481  ELWRKEQKLQTVLETLLSDVNQNQRNVNETMSRSLANGIINVKEITEKLKISPESVFGTL 540
            ELWRKEQKLQTVLETLLSDVNQNQRNVNETMSRSLANGIINVKEITEKLKISPESVFGTL
Sbjct: 481  ELWRKEQKLQTVLETLLSDVNQNQRNVNETMSRSLANGIINVKEITEKLKISPESVFGTL 540

Query: 541  GELIKVNDKYKTCAEVIGGNSLFHIVVDTEETATLIMNELYRMKGGRVTFIPLNRLSLDS 600
            GELIKVNDKYKTCAEVIGGNSLFHIVVDTEETATLIMNELYRMKGGRVTFIPLNRLSLDS
Sbjct: 541  GELIKVNDKYKTCAEVIGGNSLFHIVVDTEETATLIMNELYRMKGGRVTFIPLNRLSLDS 600

Query: 601  DVKFPSNTTTQIQFTPLIKKIKYEPRFEKAVKHVFGKTIVVKDLGQGLKLAKKHKLNAIT 660
            DVKFPSNTTTQIQFTPLIKKIKYEPRFEKAVKHVFGKTIVVKDLGQGLKLAKKHKLNAIT
Sbjct: 601  DVKFPSNTTTQIQFTPLIKKIKYEPRFEKAVKHVFGKTIVVKDLGQGLKLAKKHKLNAIT 660

Query: 661  LDGDRADKRGVLTGGYLDQHKRTRLESLKNLNESRSQHKKILEELDFVRNELNDIDTKID 720
            LDGDRADKRGVLTGGYLDQHKRTRLESLKNLNESRSQHKKILEELDFVRNELNDIDTKID
Sbjct: 661  LDGDRADKRGVLTGGYLDQHKRTRLESLKNLNESRSQHKKILEELDFVRNELNDIDTKID 720

Query: 721  QVNGNIRKVSNDRESVLTNIEVYRTSLNTKKNEKLILEESLNAIILKLEKLNTNRTFAQE 780
            QVNGNIRKVSNDRESVLTNIEVYRTSLNTKKNEKLILEESLNAIILKLEKLNTNRTFAQE
Sbjct: 721  QVNGNIRKVSNDRESVLTNIEVYRTSLNTKKNEKLILEESLNAIILKLEKLNTNRTFAQE 780

Query: 781  KLNTFENDLLQEFDXXXXXXXXXXXXXXXXXISAAHNKLNITSDALEGITTTIDSLNAEL 840
            KLNTFENDLLQEFD                 ISAAHNKLNITSDALEGITTTIDSLNAEL
Sbjct: 781  KLNTFENDLLQEFDSELSKEEKERLESLTKEISAAHNKLNITSDALEGITTTIDSLNAEL 840

Query: 841  ESKLIPQENDLESKMSEVGDAFIFGXXXXXXXXXXXXXXXXXXHENAVLELGTVQREIES 900
            ESKLIPQENDLESKMSEVGDAFIFG                  HENAVLELGTVQREIES
Sbjct: 841  ESKLIPQENDLESKMSEVGDAFIFGLQDELKELQLEKESVEKQHENAVLELGTVQREIES 900

Query: 901  LIAEETNNKKLLEKANNQQRLLLKKLDNFQKSVEKTMIKKTTLVTXXXXXXXXXXXXGLL 960
            LIAEETNNKKLLEKANNQQRLLLKKLDNFQKSVEKTMIKKTTLVT            GLL
Sbjct: 901  LIAEETNNKKLLEKANNQQRLLLKKLDNFQKSVEKTMIKKTTLVTRREELQQRIREIGLL 960

Query: 961  PEDALVNDFSDITSDQLLQRLNDMNTEISGLKNVNKRAFENFKKFNERRKDLAERASELD 1020
            PEDALVNDFSDITSDQLLQRLNDMNTEISGLKNVNKRAFENFKKFNERRKDLAERASELD
Sbjct: 961  PEDALVNDFSDITSDQLLQRLNDMNTEISGLKNVNKRAFENFKKFNERRKDLAERASELD 1020

Query: 1021 ESKDSIQDLIVKLKQQKVNAVDSTFQKVSENFEAVFERLVPRGTAKLIIHRKNDNANDHD 1080
            ESKDSIQDLIVKLKQQKVNAVDSTFQKVSENFEAVFERLVPRGTAKLIIHRKNDNANDHD
Sbjct: 1021 ESKDSIQDLIVKLKQQKVNAVDSTFQKVSENFEAVFERLVPRGTAKLIIHRKNDNANDHD 1080

Query: 1081 ESIDVDMDAESNESQNGKDSEIMYTGVSISVSFNSKQNEQLHVEQLSGGQKTVCAIALIL 1140
            ESIDVDMDAESNESQNGKDSEIMYTGVSISVSFNSKQNEQLHVEQLSGGQKTVCAIALIL
Sbjct: 1081 ESIDVDMDAESNESQNGKDSEIMYTGVSISVSFNSKQNEQLHVEQLSGGQKTVCAIALIL 1140

Query: 1141 AIQMVDPASFYLFDEIDAALDKQYRTAVATLLKELSKNAQFICTTFRTDMLQVADKFFRV 1200
            AIQMVDPASFYLFDEIDAALDKQYRTAVATLLKELSKNAQFICTTFRTDMLQVADKFFRV
Sbjct: 1141 AIQMVDPASFYLFDEIDAALDKQYRTAVATLLKELSKNAQFICTTFRTDMLQVADKFFRV 1200

Query: 1201 KYENKIST 1208
            KYENKIST
Sbjct: 1201 KYENKIST 1208

>Scas_711.39
          Length = 1227

 Score = 1499 bits (3882), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 759/1217 (62%), Positives = 945/1217 (77%), Gaps = 21/1217 (1%)

Query: 1    MYIKRVIIKGFKTYRNETIIDNFSPHQNVIIGSNGSGKSNFFAAIRFVLSDDYSNLKREE 60
            MYIKRV+IKGFKTYRN+T+ID+FSPH N++IGSNGSGKSNFF+AIRFVLSDDYSNLKREE
Sbjct: 1    MYIKRVVIKGFKTYRNQTVIDDFSPHHNIVIGSNGSGKSNFFSAIRFVLSDDYSNLKREE 60

Query: 61   RQGLIHQGSGGSVMSASVEIVFHDPDHSMILPSGVLSR-GDDEVTIRRTVGLKKDDYQLN 119
            RQGLIHQGSGGSVMSASVEIVFHDP+H MILPSGV+ R  +DE+ IRRTVGLKKDDYQLN
Sbjct: 61   RQGLIHQGSGGSVMSASVEIVFHDPEHKMILPSGVVPRENNDEICIRRTVGLKKDDYQLN 120

Query: 120  DRNVTKGDIVRMLETAGFSMNNPYNIVPQGKIVALTNAKDKERLQLLEDVVGAKSFEVKL 179
            DRNVTKGD+VRMLE+ GFSM+NPYNIVPQGKI++LTNAKDKERLQLLEDVVGAKSFEVKL
Sbjct: 121  DRNVTKGDVVRMLESTGFSMSNPYNIVPQGKIISLTNAKDKERLQLLEDVVGAKSFEVKL 180

Query: 180  KASLKKMEETEQKKIQINKEMGELNSKLSEMEQERKELEKYNELERNRKIYQFTLYDREL 239
            KASLKKMEETEQK+ +I KEM ELNSKL EMEQERKELEKYN LE+NRK++QFTLYDREL
Sbjct: 181  KASLKKMEETEQKRARIAKEMDELNSKLKEMEQERKELEKYNALEKNRKVFQFTLYDREL 240

Query: 240  NEVINQMERLDGDYNNTVYSSEQYIQELDKREDMIDQVSKKLSSIEASLKIKNATDLQQA 299
            N++INQ+ERLD DYN T  SSEQYI+ELDKRE++I  +SK LS I+++LKIK  TDL QA
Sbjct: 241  NDIINQVERLDDDYNVTANSSEQYIKELDKREEIISNISKNLSEIDSTLKIKTTTDLPQA 300

Query: 300  KLRESEISQKLTNVNVKIKDVQQQIESNEEQRNLDSATLKEIKSIIEQRKQKLSKILPRY 359
            K R SE++ +LTN+ V+IKD++ QI++ E Q N D  TL  I   I++R+QKLS I P++
Sbjct: 301  KSRHSELTNQLTNLQVQIKDLKLQIKAQERQANSDQKTLDIINDEIQKREQKLSSISPKF 360

Query: 360  QELTKEEAMYKLQLASLQQKQRDLILKKGEYARFKSKDERDTWIHSEIEELKSSIQNLNE 419
            QEL+KEE  +KLQ   LQQ+QRDL+LKKG YARF S +ER+ WI +EIEE   ++Q L +
Sbjct: 361  QELSKEELKFKLQYNKLQQRQRDLLLKKGRYARFASIEERNEWIQNEIEESDKTLQGLVD 420

Query: 420  LESQLQMDRTSLRKQYSAXXXXXXXXXXXXNGPDTKGQLEDFDSELIHLKQKLSESLDTR 479
            +++++ ++R  +  +  +             GP+  G+LE    EL  LK + + S+D R
Sbjct: 421  IKNKILIERDEINSKVRSLDEDIDNLNDSIEGPNVTGELEVIQDELEKLKSEYAASIDKR 480

Query: 480  KELWRKEQKLQTVLETLLSDVNQNQRNVNETMSRSLANGIINVKEITEKLKISPESVFGT 539
            KELWR EQK++TVL+ LL +V   +RNVNETM RSLANGI +VKEI  KLK+  +SVFGT
Sbjct: 481  KELWRNEQKIETVLQNLLENVKVLERNVNETMDRSLANGIKSVKEIATKLKLPEDSVFGT 540

Query: 540  LGELIKVNDKYKTCAEVIGGNSLFHIVVDTEETATLIMNELYRMKGGRVTFIPLNRLSLD 599
            LGELI VN+KYK CAEV+GGNSLFHIVVDTEETAT+IM ELY+MKGGRVTFIPLNR+ LD
Sbjct: 541  LGELINVNEKYKICAEVVGGNSLFHIVVDTEETATIIMKELYKMKGGRVTFIPLNRIYLD 600

Query: 600  SDVKFPSNTTTQIQFTPLIKKIKYEPRFEKAVKHVFGKTIVVKDLGQGLKLAKKHKLNAI 659
            +++++P N   Q  FTPLI KIKY+ RF+KAV+H+FGKTIVVKDL  GL+++KK KLN+I
Sbjct: 601  ANIQYPPN--DQTSFTPLINKIKYDQRFDKAVRHIFGKTIVVKDLTTGLRISKKFKLNSI 658

Query: 660  TLDGDRADKRGVLTGGYLDQHKRTRLESLKNLNESRSQHKKILEELDFVRNELNDIDTKI 719
            TLDGDRADKRGVLTGGY DQ+K++RL+SL  LNES ++H+++  EL  ++  + ++D+ I
Sbjct: 659  TLDGDRADKRGVLTGGYYDQYKQSRLDSLSTLNESTAKHRELSLELTSIKQAIQEVDSNI 718

Query: 720  DQVNGNIRKVSNDRESVLTNIEVYRTSLNTKKNEKLILEESLNAIILKLEKLNTNRTFAQ 779
            D +N +IRK + +RES+L+NIE  ++ L  KKN+K++LEESL A+ +K EK   N     
Sbjct: 719  DTLNNSIRKHNTNRESLLSNIEGMKSKLRNKKNDKILLEESLQALAIKTEKNEINIRVTA 778

Query: 780  EKLNTFENDLLQEFDXXXXXXXXXXXXXXXXXISAAHNKLNITSDALEGITTTIDSLNAE 839
            +K  T+  D+  EF+                 +     KL +T++ LE +T+ ++SLNAE
Sbjct: 779  DKKETYVKDMSSEFNSELSLVEKEELEVTSISLLEIEKKLTLTTENLETVTSEMNSLNAE 838

Query: 840  LESKLIPQENDLESKMSEVGDAFIFGXXXXXXXXXXXXXXXXXXHENAVLELGTVQREIE 899
            L SKL PQ+ D+ S+MS+ G +++                      +A+  + T+Q+EIE
Sbjct: 839  LNSKLFPQKQDILSQMSQEGLSYLSSLRRDVDSMTSKLEAVQNQCNSALQHVDTIQKEIE 898

Query: 900  SLIAEETNNKKLLEKANNQQRLLLKKLDNFQKSVEKTMIKKTTLVTXXXXXXXXXXXXGL 959
             L +E+ NN K+LEKAN+QQRLLLKKL+ FQK VEKTMIKKT L+T            GL
Sbjct: 899  DLKSEKRNNDKILEKANSQQRLLLKKLETFQKDVEKTMIKKTALITRRDELQQKIREIGL 958

Query: 960  LPEDALVNDFSDITSDQLLQRLNDMNTEISGLKNVNKRAFENFKKFNERRKDLAERASEL 1019
            L EDAL N F+D++S++LL+RLN ++ +ISGLKNVNKRA+ENF+KF+E++K+L ERA+EL
Sbjct: 959  LAEDAL-NAFNDLSSEELLKRLNSVSEDISGLKNVNKRAYENFRKFDEKQKELVERATEL 1017

Query: 1020 DESKDSIQDLIVKLKQQKVNAVDSTFQKVSENFEAVFERLVPRGTAKLIIHRKNDNANDH 1079
            DESK SIQDLI +L+QQKV AVDSTF KV+ENFE VFE+LVP G AKLIIHR ++NA   
Sbjct: 1018 DESKTSIQDLITRLRQQKVTAVDSTFLKVAENFETVFEKLVPIGKAKLIIHRVDNNAR-- 1075

Query: 1080 DESIDVDMDAESNESQNGK--------DSEIMYTGVSISVSFNSKQNEQLHVEQLSGGQK 1131
                   M+  SN+             ++E +YTGVSISVSFNSK+NEQLHVEQLSGGQK
Sbjct: 1076 -------METNSNDDDVDMDQEDEVINNNESIYTGVSISVSFNSKENEQLHVEQLSGGQK 1128

Query: 1132 TVCAIALILAIQMVDPASFYLFDEIDAALDKQYRTAVATLLKELSKNAQFICTTFRTDML 1191
            TVCAIALILAIQMVDPA FYLFDEIDAALDKQYRTAVA ++K+LS NAQFICTTFRTDML
Sbjct: 1129 TVCAIALILAIQMVDPAPFYLFDEIDAALDKQYRTAVANIIKQLSVNAQFICTTFRTDML 1188

Query: 1192 QVADKFFRVKYENKIST 1208
            QVAD+FFRVKYENKIST
Sbjct: 1189 QVADRFFRVKYENKIST 1205

>CAGL0H02805g complement(256682..260341) similar to sp|P47037
            Saccharomyces cerevisiae YJL074c SMC3 required for
            structural maintenance of chromosomes, start by
            similarity
          Length = 1219

 Score = 1323 bits (3425), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 678/1210 (56%), Positives = 901/1210 (74%), Gaps = 15/1210 (1%)

Query: 1    MYIKRVIIKGFKTYRNETIIDNFSPHQNVIIGSNGSGKSNFFAAIRFVLSDDYSNLKREE 60
            MYIKRVIIKGFKTYRNETII +FSPH NV+IG+NGSGKSNFFAA+RFVLSDDYSNLKREE
Sbjct: 1    MYIKRVIIKGFKTYRNETIIGDFSPHHNVVIGANGSGKSNFFAAVRFVLSDDYSNLKREE 60

Query: 61   RQGLIHQGSGGSVMSASVEIVFHDPDHSMILPSGVLSRGD-DEVTIRRTVGLKKDDYQLN 119
            RQGLIHQG+G SVMSASVEIVFHDP+HS+I P+G+ S G  DEV IRRTVGLKKDDYQ+N
Sbjct: 61   RQGLIHQGAGASVMSASVEIVFHDPEHSIIAPTGINSNGSSDEVRIRRTVGLKKDDYQVN 120

Query: 120  DRNVTKGDIVRMLETAGFSMNNPYNIVPQGKIVALTNAKDKERLQLLEDVVGAKSFEVKL 179
            DRNVTKGD+VRMLE+AGF M+NPYNIVPQG+IV+LTNAKDKERLQLLE+VVGAKSFEVKL
Sbjct: 121  DRNVTKGDLVRMLESAGFYMSNPYNIVPQGRIVSLTNAKDKERLQLLEEVVGAKSFEVKL 180

Query: 180  KASLKKMEETEQKKIQINKEMGELNSKLSEMEQERKELEKYNELERNRKIYQFTLYDREL 239
            KAS+K+M+ETEQK+ QI+ EM EL SKL+EME+ERKELEKYN LER+RK+ ++TL+DREL
Sbjct: 181  KASMKQMDETEQKRAQISAEMEELESKLNEMEKERKELEKYNSLERDRKVLRYTLHDREL 240

Query: 240  NEVINQMERLDGDYNNTVYSSEQYIQELDKREDMIDQVSKKLSSIEASLKIKNATDLQQA 299
             ++I+Q+E LDGDYN+T+ SS++YI EL+KRE+MI +V++++ +++ SLK+K   DL+QA
Sbjct: 241  QDIISQIESLDGDYNDTLGSSKKYILELEKRENMIKEVNEEIKNLQKSLKLKATVDLEQA 300

Query: 300  KLRESEISQKLTNVNVKIKDVQQQIESNEEQRNLDSATLKEIKSIIEQRKQKLSKILPRY 359
            K    E  ++   + +++KD++++I+ N+EQ + D   LK I  II+ +K K  KI PR+
Sbjct: 301  KAILEESLERSEAIKLQLKDIKEKIKQNKEQHDNDRKNLKLITEIIDSKKSKRRKISPRF 360

Query: 360  QELTKEEAMYKLQLASLQQKQRDLILKKGEYARFKSKDERDTWIHSEIEELKSSIQNLNE 419
             +L  EE + K  L    +KQ + +LKKG YARFKSK+ERD WI+S+I+EL  SI  +  
Sbjct: 361  DQLQSEEKLIKHHLKECIEKQNNFLLKKGSYARFKSKEERDEWINSKIKELSESINTMKA 420

Query: 420  LESQLQMDRTSLRKQYSAXXXXXXXXXXXXNGPDTKGQLEDFDSELIHLKQKLSESLDTR 479
              ++L+  ++S+  + +             NGP  K ++ED + ELI+L++K + ++D R
Sbjct: 421  STTELKEQKSSIDVKINESENNIEELEDSLNGPGIKAEIEDIEKELINLRRKYTANIDAR 480

Query: 480  KELWRKEQKLQTVLETLLSDVNQNQRNVNETMSRSLANGIINVKEITEKLKISPESVFGT 539
            KE WR+EQKLQ + ++L+++V +N+R++NETMSRSLANG  NVKEI E+L +  ESVFGT
Sbjct: 481  KEKWREEQKLQMISDSLVNEVKENERSLNETMSRSLANGFKNVKEICERLNLGTESVFGT 540

Query: 540  LGELIKVNDKYKTCAEVIGGNSLFHIVVDTEETATLIMNELYRMKGGRVTFIPLNRL-SL 598
            +GELI+VN+KYK CAEVIGGNSLFH+VVDT+ETA+++MNEL+RMKGGRVTF+PLN+L + 
Sbjct: 541  VGELIQVNEKYKVCAEVIGGNSLFHVVVDTDETASILMNELFRMKGGRVTFMPLNKLKNG 600

Query: 599  DSDVKFPSNTTTQIQFTPLIKKIKYEPRFEKAVKHVFGKTIVVKDLGQGLKLAKKHKLNA 658
            + ++ +PS+    I  TPLIKKIKY+ +F+  VK VFG+ +VVKDL  GL ++K++KL+ 
Sbjct: 601  NQNIDYPSDPN--IPCTPLIKKIKYDMQFDCVVKQVFGRALVVKDLTNGLSISKQYKLSC 658

Query: 659  ITLDGDRADKRGVLTGGYLDQHKRTRLESLKNLNESRSQHKKILEELDFVRNELNDIDTK 718
            ITLDGDR D +GVLTGGYL+Q K++RLE L+ +  S+ Q  +I  +L  ++NEL ++D  
Sbjct: 659  ITLDGDRVDGKGVLTGGYLEQSKKSRLELLQTVALSKRQLLEISAKLTEIKNELTEMDND 718

Query: 719  IDQVNGNIRKVSNDRESVLTNIEVYRTSLNTKKNEKLILEESLNAIILKLEKLNTNRTFA 778
            ID  NG+IR V N +E++ +N+  ++  L+ ++NE L L++    I  K++ ++ N   +
Sbjct: 719  IDSTNGSIRLVMNRKENMQSNLNTWKHKLSHERNELLFLQQEKTNICEKIDSVDLNLGVS 778

Query: 779  QEKLNTFENDLLQEFDXXXXXXXXXXXXXXXXXISAAHNKLNITSDALEGITTTIDSLNA 838
             EKL   + DL + F+                 I    NKLN+TS+ L  ++  ID++ A
Sbjct: 779  GEKLTQLKIDLTKTFNNELTTEEKKEIEILSKEILENQNKLNLTSETLSHLSVEIDTITA 838

Query: 839  ELESKLIPQENDLESKMSEVGDAFIFGXXXXXXXXXXXXXXXXXXHENAVLELGTVQREI 898
            ELESKLIPQ+ND++ K+ +  D+ I                           L ++++EI
Sbjct: 839  ELESKLIPQQNDIKQKLLDSSDSIIEQLLLDSEELEGRASEADNQLTIQKRALQSIEKEI 898

Query: 899  ESLIAEETNNKKLLEKANNQQRLLLKKLDNFQKSVEKTMIKKTTLVTXXXXXXXXXXXXG 958
            ES  AE TN +++LEKANNQQRLLLKKLD +QK V+KTMIKKTTL T            G
Sbjct: 899  ESTKAEITNKERILEKANNQQRLLLKKLDEYQKDVDKTMIKKTTLATRKKEIEQKIREVG 958

Query: 959  LLPEDALVNDFSDITSDQLLQRLNDMNTEISGLKNVNKRAFENFKKFNERRKDLAERASE 1018
            ++ ED L + F  ++S+ LL +LN+ N EISG++N+NKRAFEN+KKFNE++ +L ERA+E
Sbjct: 959  IISEDTL-DKFKTLSSEDLLLKLNEANKEISGMRNINKRAFENYKKFNEKQSELRERATE 1017

Query: 1019 LDESKDSIQDLIVKLKQQKVNAVDSTFQKVSENFEAVFERLVPRGTAKLIIHRKNDNAND 1078
            LD+SK SIQDLI+KLK+QK+NAVD TF KVS+NF  +FE++VPRGTA L IHR N    D
Sbjct: 1018 LDDSKQSIQDLIIKLKEQKLNAVDKTFDKVSKNFVMIFEKIVPRGTATLNIHRINLQGTD 1077

Query: 1079 HDESIDVDMDAESNESQNGKDSEIMYTGVSISVSFNSKQNEQLHVEQLSGGQKTVCAIAL 1138
             +     ++  +SNE          Y GVSISVSFNSKQ+EQL VEQLSGGQKTVCAIAL
Sbjct: 1078 DNS----ELFTQSNEHTTP------YEGVSISVSFNSKQDEQLKVEQLSGGQKTVCAIAL 1127

Query: 1139 ILAIQMVDPASFYLFDEIDAALDKQYRTAVATLLKELSKNAQFICTTFRTDMLQVADKFF 1198
            ILAIQMV+PA FYLFDEIDAALDKQYR AVA  + +LS NAQFICTTFR+DM+  A+KF+
Sbjct: 1128 ILAIQMVEPAPFYLFDEIDAALDKQYRRAVAQTISQLSNNAQFICTTFRSDMVDAANKFY 1187

Query: 1199 RVKYENKIST 1208
            RVKYENK S+
Sbjct: 1188 RVKYENKQSS 1197

>AAL182W [5] [Homologous to ScYJL074C (SMC3) - SH]
            complement(16155..19850) [3696 bp, 1231 aa]
          Length = 1231

 Score = 1202 bits (3110), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 626/1224 (51%), Positives = 863/1224 (70%), Gaps = 32/1224 (2%)

Query: 1    MYIKRVIIKGFKTYRNETIIDNFSPHQNVIIGSNGSGKSNFFAAIRFVLSDDYSNLKREE 60
            MYIK+VII+GFKTY+N+T IDNFSPH NV++G NGSGKSNFFAAIRFVLSDDY+NLKREE
Sbjct: 1    MYIKKVIIRGFKTYKNKTEIDNFSPHHNVVVGFNGSGKSNFFAAIRFVLSDDYTNLKREE 60

Query: 61   RQGLIHQGSGGSVMSASVEIVFHDPDHSMILPS---GVLSRGDDEVTIRRTVGLKKDDYQ 117
            R+ LI+QG+  SVMS  VEIVFH  ++  +L +   GV       + IRRTVGLKKD+Y 
Sbjct: 61   RRSLIYQGTS-SVMSGYVEIVFHGAENRTLLGAQDGGV-------IHIRRTVGLKKDEYM 112

Query: 118  LNDRNVTKGDIVRMLETAGFSMNNPYNIVPQGKIVALTNAKDKERLQLLEDVVGAKSFEV 177
            +N++N ++ D+ R+LE+AGFS +NPYNIVPQG+IV+LTNA+++ERLQLLE+V+GAKSFE 
Sbjct: 113  INNKNASRSDVQRLLESAGFSTSNPYNIVPQGRIVSLTNAQNRERLQLLEEVIGAKSFER 172

Query: 178  KLKASLKKMEETEQKKIQINKEMGELNSKLSEMEQERKELEKYNELERNRKIYQFTLYDR 237
            KLK SL+KME TE+ + +I  E+ E+ +KL+E+++ERKELEKYN L+R RK+ QF LYDR
Sbjct: 173  KLKESLQKMETTEKNREKIRIELEEVEAKLNELDEERKELEKYNSLDRKRKMCQFALYDR 232

Query: 238  ELNEVINQMERLDGDYNNTVYSSEQYIQELDKREDMIDQVSKKLSSIEASLKIKNATDLQ 297
            ELNEV + +E+LDG+Y NT+  SEQYIQEL+KRE +I+ ++K L+ + + LK+K +TDLQ
Sbjct: 233  ELNEVTSMVEKLDGEYTNTLVLSEQYIQELEKRESLIETLTKSLNQLGSELKMKESTDLQ 292

Query: 298  QAKLRESEISQKLTNVNVKIKDVQQQIESNEEQRNLDSATLKEIKSIIEQRKQKLSKILP 357
            QAK  E E+++ L ++NVK +++  Q  + +EQ   +S +L  I+S I  ++Q+L+++ P
Sbjct: 293  QAKDSELELAKHLADLNVKYEELISQNNALKEQSASNSESLLAIRSQIAVKEQQLARLSP 352

Query: 358  RYQELTKEEAMYKLQLASLQQKQRDLILKKGEYARFKSKDERDTWIHSEIEELKSSIQNL 417
            R+++LT EEA  K +  +LQQ+QRDL+ K+G+Y++F++K ERD WI  E+  LK  +Q  
Sbjct: 353  RFEQLTIEEAAMKAEFKALQQRQRDLLAKRGKYSQFRNKAERDAWIDQELSILKEELQCS 412

Query: 418  NELESQLQMDRTSLRKQYSAXXXXXXXXXXXXNGPDTKGQLEDFDSELIHLKQKLSESLD 477
            +   + +  +R SLR + +             +GP    +LED   EL  LK+     +D
Sbjct: 413  SIALTSISEERDSLRIKLTTLDDQIMELNDSAHGPGINAELEDVQQELTVLKKAHLFKID 472

Query: 478  TRKELWRKEQKLQTVLETLLSDVNQNQRNVNETMSRSLANGIINVKEITEKLKISPESVF 537
             RK+LWR EQK+Q+VLE+L+ DV + +  ++ETM RSLA G+ NV EI ++L +   SVF
Sbjct: 473  ERKQLWRSEQKIQSVLESLVDDVKRAEGTLSETMDRSLATGLKNVSEIAQRLNLPEGSVF 532

Query: 538  GTLGELIKVNDKYKTCAEVIGGNSLFHIVVDTEETATLIMNELYRMKGGRVTFIPLNRLS 597
            G LGELIK+++KYK CAEV+GG SLFH+VVDTE TA L+M ELY  KGGRVTFIPLNR+ 
Sbjct: 533  GPLGELIKISEKYKACAEVVGGTSLFHVVVDTENTAALLMQELYNSKGGRVTFIPLNRVH 592

Query: 598  LDSDVKFPSNTTTQIQFTPLIKKIKYEPRFEKAVKHVFGKTIVVKDLGQGLKLAKKHKLN 657
            +DS++ +PSN   +   TPLIKKIKY+P+FE+A+KHVFGKTIVVKDL QG KLAK+ +LN
Sbjct: 593  VDSNIVYPSN--DEHHCTPLIKKIKYDPKFERAIKHVFGKTIVVKDLNQGTKLAKQFRLN 650

Query: 658  AITLDGDRADKRGVLTGGYLDQHKRTRLESLKNLNESRSQHKKILEELDFVRNELNDIDT 717
            AITLDGD+AD RGVLTGG+ D HK+ RL+S+++L   + + +    +L+ V+ +L+ ID 
Sbjct: 651  AITLDGDKADSRGVLTGGFHDHHKQKRLDSMRDLKSLKKEQQGNKSQLEEVKEKLHSIDQ 710

Query: 718  KIDQVNGNIRKVSNDRESVLTNIEVYRTSLNTKKNEKLILEESLNAIILKLEKLNTNRTF 777
            +ID++N  I+K  + RE +LT +E     L   K E+ +LEE++  +I K EK   N+  
Sbjct: 711  EIDELNDKIKKSMSRREMILTQVEAVNIKLEKAKRERFLLEETMVQLISKEEKAKINQKL 770

Query: 778  AQEKLNTFENDLLQEFDXXXXXXXXXXXXXXXXXISAAHNKLNITSDALEGITTTIDSLN 837
             Q+KL+ +  DL ++FD                 +    N LN T+DAL  +   IDSL 
Sbjct: 771  LQDKLDMYTEDLSRDFDTELTLTEREELDEIAKKLPDLENLLNTTTDALSSVVVKIDSLK 830

Query: 838  AELESKLIPQENDLESKMSEVGDAFIFGXXXXXXXXXXXXXXXXXXHENAV-LELGTVQR 896
            AEL+SKL PQ  +LE + +E+                          ++ V  E+  +  
Sbjct: 831  AELDSKLKPQAKELEDQPNEIMSTTAIQNLQEHIDAVEDERKTLLERKSTVDNEVQKISE 890

Query: 897  EIESLIAEETNNKKLLEKANNQQRLLLKKLDNFQKSVEKTMIKKTTLVTXXXXXXXXXXX 956
             I++L + +   +K LEKAN+QQR LLKKLDN+QK  EK+M++K TL T           
Sbjct: 891  IIDTLKSRQEEEEKSLEKANSQQRALLKKLDNYQKEAEKSMLRKMTLSTRRDELQQKIRD 950

Query: 957  XGLLPEDALVNDFSDITSDQLLQRLNDMNTEISGLKNVNKRAFENFKKFNERRKDLAERA 1016
             GLLP+D+  + + +++S +LL+ L+ +N +IS + NVNKRA ENFKKF++++KD+ +RA
Sbjct: 951  IGLLPDDS-ADKYHNMSSSELLKELSSINDKISKMTNVNKRALENFKKFDDKQKDVMKRA 1009

Query: 1017 SELDESKDSIQDLIVKLKQQKVNAVDSTFQKVSENFEAVFERLVPRGTAKLIIHRKNDNA 1076
             ELDESK+SI+ LI KLK+QKV AV++TF+KVSENF  +FE++VPRGT KL+IHR+ +  
Sbjct: 1010 KELDESKESIEKLIDKLKKQKVEAVENTFKKVSENFTQLFEKMVPRGTGKLVIHRRENEP 1069

Query: 1077 N------------DHDESIDVDMDAESNESQNGKDSEIMYTGVSISVSFNSKQNEQLHVE 1124
            +               E +  + D + N SQ+      +Y+GVSI VSFNSK++EQ+HVE
Sbjct: 1070 SKPSKRQQKKRKRQETEDVHFNDDQDENSSQDS-----IYSGVSIEVSFNSKKDEQVHVE 1124

Query: 1125 QLSGGQKTVCAIALILAIQMVDPASFYLFDEIDAALDKQYRTAVATLLKELSKNAQFICT 1184
            QLSGGQKTVCAIALILAIQMVDPA FYLFDEIDAALDKQYRTAVA  +K+LS  AQFICT
Sbjct: 1125 QLSGGQKTVCAIALILAIQMVDPAPFYLFDEIDAALDKQYRTAVAATVKQLSSQAQFICT 1184

Query: 1185 TFRTDMLQVADKFFRVKYENKIST 1208
            TFR DM+ VAD+F+RV +ENKIST
Sbjct: 1185 TFRGDMIAVADRFYRVNFENKIST 1208

>Kwal_14.2435
          Length = 1247

 Score = 1168 bits (3022), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 600/1207 (49%), Positives = 833/1207 (69%), Gaps = 7/1207 (0%)

Query: 1    MYIKRVIIKGFKTYRNETIIDNFSPHQNVIIGSNGSGKSNFFAAIRFVLSDDYSNLKREE 60
            MYI+ V+I+GFKTYRN T +++FSPH NV+IG NGSGKSNFFAA+RFVLSDDYS+LKREE
Sbjct: 25   MYIQSVLIQGFKTYRNITAVEDFSPHFNVVIGGNGSGKSNFFAAVRFVLSDDYSSLKREE 84

Query: 61   RQGLIHQGSGGSVMSASVEIVFHDPDHSMILPSGVLSRGDDEVTIRRTVGLKKDDYQLND 120
            RQGLIHQG+G S+MSA VEIVFHDP   M++ SG+    +  V +RRT+GLKKD+Y +N 
Sbjct: 85   RQGLIHQGTG-SIMSAYVEIVFHDPSDQMMMTSGIPVTEEHIVRVRRTIGLKKDEYSVNG 143

Query: 121  RNVTKGDIVRMLETAGFSMNNPYNIVPQGKIVALTNAKDKERLQLLEDVVGAKSFEVKLK 180
            +   K DI RM E+ GFS +NPYNIVPQG+IVA+TNAKDKERL LLEDVVGA+SFE+KL+
Sbjct: 144  KTCHKSDISRMFESVGFSASNPYNIVPQGRIVAVTNAKDKERLLLLEDVVGARSFEIKLR 203

Query: 181  ASLKKMEETEQKKIQINKEMGELNSKLSEMEQERKELEKYNELERNRKIYQFTLYDRELN 240
             S KKME T + + +I  E+ EL ++L E+++ER+ELEKY ELER+R+I+QF LYDRELN
Sbjct: 204  ESSKKMEATNRDRAKITSELSELKARLEELDEERQELEKYQELERDRRIFQFVLYDRELN 263

Query: 241  EVINQMERLDGDYNNTVYSSEQYIQELDKREDMIDQVSKKLSSIEASLKIKNATDLQQAK 300
            EV +Q+E L+ +YNN + SSE+YIQEL KRE +I  ++K +S++EA LK+K +TD QQ K
Sbjct: 264  EVTSQIESLEDEYNNVLQSSEEYIQELYKRETLIANLTKNISNVEAELKLKESTDFQQDK 323

Query: 301  LRESEISQKLTNVNVKIKDVQQQIESNEEQRNLDSATLKEIKSIIEQRKQKLSKILPRYQ 360
             R  EI ++  ++ ++ ++ ++Q +    Q  +    L  ++  I+    +L+++ PRY+
Sbjct: 324  SRLQEIVKRKADLEIRYEETKRQRDQVHGQCAVYRKNLATVEEEIQNTSTQLNRLSPRYE 383

Query: 361  ELTKEEAMYKLQLASLQQKQRDLILKKGEYARFKSKDERDTWIHSEIEELKSSIQNLNEL 420
            +L  E   ++ QL+  Q+KQR++I K+G YA+F+++ ERD WI  E+  LK+   +L + 
Sbjct: 384  QLKLEAEAFEAQLSQYQRKQREIISKRGIYAQFENQSERDAWIAKELSSLKAQTDDLKKN 443

Query: 421  ESQLQMDRTSLRKQYSAXXXXXXXXXXXXNGPDTKGQLEDFDSELIHLKQKLSESLDTRK 480
               ++ ++  +  +                GP    +L+D  + L  LK+   E +D RK
Sbjct: 444  VEIMEAEKEQVAAEIQQDKEAITELNDSVRGPGISSELQDIQTHLNDLKRSYLEKIDERK 503

Query: 481  ELWRKEQKLQTVLETLLSDVNQNQRNVNETMSRSLANGIINVKEITEKLKISPESVFGTL 540
            ELWR EQ+LQTV E LL  V +++RN++ETM R+LANG+  V+EIT++LK+ P +V G L
Sbjct: 504  ELWRSEQRLQTVSEALLDGVKRSERNLSETMDRNLANGLKAVREITQRLKLPPGAVHGPL 563

Query: 541  GELIKVNDKYKTCAEVIGGNSLFHIVVDTEETATLIMNELYRMKGGRVTFIPLNRLSLDS 600
            GELIKVN+KYKTCAE +GGNSL H+VVDTEETA+++M+ELY  K GRVTFIPLNR+S  +
Sbjct: 564  GELIKVNEKYKTCAEAVGGNSLLHVVVDTEETASILMSELYNTKAGRVTFIPLNRISDRN 623

Query: 601  DVKFPSNTTTQIQFTPLIKKIKYEPRFEKAVKHVFGKTIVVKDLGQGLKLAKKHKLNAIT 660
             V FP N   Q + TPL+ KIKY+  FEKAV+HVFG+TIVV+DLG G KLA+ + L+A+T
Sbjct: 624  AVTFPEN--AQAECTPLLWKIKYDKVFEKAVRHVFGRTIVVRDLGNGSKLARSYNLDAVT 681

Query: 661  LDGDRADKRGVLTGGYLDQHKRTRLESLKNLNESRSQHKKILEELDFVRNELNDIDTKID 720
            LDGDRAD RGV+TGGY D HKRTRL+ LK+++ ++ Q  +  + L+ VR ++  ID++ID
Sbjct: 682  LDGDRADNRGVITGGYHDYHKRTRLDCLKDISSAKEQLTQATQSLNAVRLKIGAIDSEID 741

Query: 721  QVNGNIRKVSNDRESVLTNIEVYRTSLNTKKNEKLILEESLNAIILKLEKLNTNRTFAQE 780
             VNG ++  +  ++++L NIE  R  ++    +     E+L A+ +KL +L T+ T  +E
Sbjct: 742  NVNGELKAQAARKDAILANIEGLRLKMSKMTADSTFKMENLEAMTVKLNRLKTSLTVNEE 801

Query: 781  KLNTFENDLLQEFDXXXXXXXXXXXXXXXXXISAAHNKLNITSDALEGITTTIDSLNAEL 840
            K+  +E+DL + F+                 I      +  T++AL  ++  ID L  EL
Sbjct: 802  KIEKYEDDLKKPFEKNLSDEEEEALKSLAVEIRKLSEPMARTTEALSELSLRIDLLKTEL 861

Query: 841  ESKLIPQENDLESKMSEVGDAFIFGXXXXXXXXXXXXXXXXXXHENAVLELGTVQREIES 900
              KL PQ+ DLE+++ E                           ++    L ++   I +
Sbjct: 862  NVKLNPQKRDLENRLEEEYSRDDLTTNRELEHMADELKKLAVKEQDLQTSLASLTEAIGT 921

Query: 901  LIAEETNNKKLLEKANNQQRLLLKKLDNFQKSVEKTMIKKTTLVTXXXXXXXXXXXXGLL 960
            L  E  N ++LLEKA++QQR L+KKLD FQK  EK++IKKT+L+T            GLL
Sbjct: 922  LSEERANYQQLLEKADSQQRALVKKLDTFQKEAEKSVIKKTSLITRRDEVQLRISEIGLL 981

Query: 961  PEDALVNDFSDITSDQLLQRLNDMNTEISGLKNVNKRAFENFKKFNERRKDLAERASELD 1020
             E++L     ++ ++++L++LN +N +IS + N+N+RA ENFKKFN++R+DL  RA EL+
Sbjct: 982  SEESL-ERHQNLETERILRKLNTVNDKISKMSNINRRAIENFKKFNDKREDLESRAEELE 1040

Query: 1021 ESKDSIQDLIVKLKQQKVNAVDSTFQKVSENFEAVFERLVPRGTAKLIIHRKNDNANDHD 1080
            +SK+SI+ L+  LK+QKV AV++TF KV+ NF  +FE+LVP G  +LIIHR  + +N   
Sbjct: 1041 QSKESIEKLVESLKKQKVEAVEATFSKVATNFTTIFEKLVPAGIGRLIIHRTTEKSNRGT 1100

Query: 1081 ESIDVDMDAESNESQNGKDSEIMYTGVSISVSFNSKQNEQLHVEQLSGGQKTVCAIALIL 1140
                 +    S  + N    + MY+GVSISVSFNSK NEQL+VEQLSGGQKTVCAIALIL
Sbjct: 1101 GQRSPEY---SPLNSNADTLDSMYSGVSISVSFNSKNNEQLYVEQLSGGQKTVCAIALIL 1157

Query: 1141 AIQMVDPASFYLFDEIDAALDKQYRTAVATLLKELSKNAQFICTTFRTDMLQVADKFFRV 1200
            AIQMVDPA FYLFDEIDAALDKQYRT+VA  +KELS +AQFICTTFRTDMLQVAD F+RV
Sbjct: 1158 AIQMVDPAPFYLFDEIDAALDKQYRTSVANTIKELSAHAQFICTTFRTDMLQVADSFYRV 1217

Query: 1201 KYENKIS 1207
            K+ENKIS
Sbjct: 1218 KFENKIS 1224

>KLLA0A00286g complement(22024..25866) similar to sp|P47037
            Saccharomyces cerevisiae YJL074c SMC3 required for
            structural maintenance of chromosomes, start by
            similarity
          Length = 1280

 Score = 1086 bits (2809), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 575/1211 (47%), Positives = 820/1211 (67%), Gaps = 13/1211 (1%)

Query: 1    MYIKRVIIKGFKTYRNETIIDNFSPHQNVIIGSNGSGKSNFFAAIRFVLSDDYSNLKREE 60
            ++IK VII GFKTY+N T+++NFSPH NV++GSNGSGKSNFFAAIRFVLS++ SNLKRE+
Sbjct: 58   VHIKTVIISGFKTYKNRTVVENFSPHHNVVVGSNGSGKSNFFAAIRFVLSEENSNLKRED 117

Query: 61   RQGLIHQGSGGSVMSASVEIVFHDPDHSMILPSGVLSRGDDEVTIRRTVGLKKDDYQLND 120
            R+G I+QG+G  VMSA VEI+F DP++ M+ P   L     EV IRRTVGLKKD+Y +ND
Sbjct: 118  RKGFIYQGAG-QVMSAFVEIIFDDPENLMLAP---LRNDTGEVRIRRTVGLKKDEYMIND 173

Query: 121  RNVTKGDIVRMLETAGFSMNNPYNIVPQGKIVALTNAKDKERLQLLEDVVGAKSFEVKLK 180
            +N T+ D+ R+LE  GFS +NPYNIVPQG+I++LTNAKD ERL LLEDVVGAKSFE KLK
Sbjct: 174  KNSTRQDVRRVLENVGFSTSNPYNIVPQGRIISLTNAKDLERLHLLEDVVGAKSFENKLK 233

Query: 181  ASLKKMEETEQKKIQINKEMGELNSKLSEMEQERKELEKYNELERNRKIYQFTLYDRELN 240
             SLKKME  E+ + +I  E+ EL+ +LSE+  E++ELEKYN L R+RK+ QF LYDRELN
Sbjct: 234  ESLKKMEAAERDRTKITNELNELDKRLSELSDEKEELEKYNNLNRDRKVLQFCLYDRELN 293

Query: 241  EVINQMERLDGDYNNTVYSSEQYIQELDKREDMIDQVSKKLSSIEASLKIKNATDLQQAK 300
            ++ NQ+E+L+G+YN+ + +S +Y+ EL+KRE +  +++K+++S+E+ +KIK +TDL Q K
Sbjct: 294  DITNQIEQLEGEYNSIIENSSEYVNELEKREVLAVELNKRMNSLESEIKIKQSTDLPQLK 353

Query: 301  LRESEISQKLTNVNVKIKDVQQQIESNEEQRNLDSATLKEIKSIIEQRKQKLSKILPRYQ 360
              + E++ +L +++ ++ D+Q Q+++++     +   + E+K  IE     ++++ P++Q
Sbjct: 354  ASKLEVAGELADLDTRLNDIQMQLDASQAHLESNVKEIGEVKKQIEINCSSIAEVQPKFQ 413

Query: 361  ELTKEEAMYKLQLASLQQKQRDLILKKGEYARFKSKDERDTWIHSEIEELKSSIQNLNEL 420
            +L+ E  + K+++  L ++QR+L+ KKG+Y  F++ +ER+ WI  +I  L  S+   N L
Sbjct: 414  KLSNEAEILKVEIEKLTKRQRELLSKKGKYEDFRTVNERNDWIQEQINLLNQSLNKSNIL 473

Query: 421  ESQLQMDRTSLRKQYSAXXXXXXXXXXXXNGPDTKGQLEDFDSELIHLKQKLSESLDTRK 480
            + QL    ++L+                 NG  +  Q ED  +++   K++    +D RK
Sbjct: 474  KDQLTSQLSTLQHDLENLNAEIEDLADSVNGMGSVAQQEDLQNKVTQAKKEYLTKIDQRK 533

Query: 481  ELWRKEQKLQTVLETLLSDVNQNQRNVNETMSRSLANGIINVKEITEKLKISPESVFGTL 540
            +LWR EQ+LQT+  +L +DV + + ++NET+ RSLA G+ NV +I  +L +  E VFG +
Sbjct: 534  QLWRTEQRLQTISTSLDNDVKRFESDMNETIDRSLALGLQNVNDIVNRLNLH-EHVFGPV 592

Query: 541  GELIKVNDKYKTCAEVIGGNSLFHIVVDTEETATLIMNELYRMKGGRVTFIPLNRLSLDS 600
            GELIKV+DKYK CAEV+GGNSLF++VVD EETA+L++ EL+  KGGRVTFIPLN+L +D+
Sbjct: 593  GELIKVSDKYKICAEVVGGNSLFNVVVDNEETASLLIKELFATKGGRVTFIPLNKLHVDT 652

Query: 601  DVKFPSNTTTQIQFTPLIKKIKYEPRFEKAVKHVFGKTIVVKDLGQGLKLAKKHKLNAIT 660
            +  +P+N     Q TPLIKKIKY+ +FEK +K VFG+T+VVK L  G  LAK++KLNAIT
Sbjct: 653  NFTYPNNLEKN-QCTPLIKKIKYDVKFEKVIKQVFGRTLVVKSLIDGASLAKEYKLNAIT 711

Query: 661  LDGDRADKRGVLTGGYLDQHKRTRLESLKNLNESRSQHKKILEELDFVRNELNDIDTKID 720
            LDGDRAD +GVL+GGYLDQ+K  RL++L++  +S+ ++KKI  EL  ++  L  I+ +ID
Sbjct: 712  LDGDRADSKGVLSGGYLDQYKSNRLDTLRDFKQSKREYKKIQVELQEIKQALQSIEQEID 771

Query: 721  QVNGNIRKVSNDRESVLTNIEVYRTSLNTKKNEKLILEESLNAIILKLEKLNTNRTFAQE 780
             +N  ++  + +R++    IE  R+ L  K ++K+ +++S+ A+  +L K++T     +E
Sbjct: 772  GLNNVVKDAAAERDAYEAGIEKARSQLKAKLSQKITIDDSIKALKARLNKIDTELEQCRE 831

Query: 781  KLNTFENDLLQEFDXXXXXXXXXXXXXXXXXISAAHNKLNITSDALEGITTTIDSLNAEL 840
            + N F  D+ + F                  I      LN     L  +++ +D LNAEL
Sbjct: 832  RTNAFAADISKPFVNELDADEKAELLAISNSIQTKETSLNFNLSTLNELSSKLDELNAEL 891

Query: 841  ESKLIPQENDLESKMSEVGDAFIFGXXXXXXXXXXXXXXXXXXHENAVLELGTVQREIES 900
             SKL+P+ ++LE K S      I                     E    EL  +   I+S
Sbjct: 892  NSKLLPKLHELERKPSSSHSLQISQINNQMELVLMEKQTVTRTKEQVESELSVLDSSIKS 951

Query: 901  LIAEETNNKKLLEKANNQQRLLLKKLDNFQKSVEKTMIKKTTLVTXXXXXXXXXXXXGLL 960
            L  E+   +K L+KAN+QQR L+K++ NFQK+ EK ++KK+TL +            GLL
Sbjct: 952  LRGEKATLQKDLDKANSQQRSLVKRITNFQKNAEKVLLKKSTLNSRKEELQQLIREVGLL 1011

Query: 961  PEDALVNDFSDITSDQLLQRLNDMNTEISGLKNVNKRAFENFKKFNERRKDLAERASELD 1020
             E++L   +  + SD++L++LN     +S + NVNKRA EN+ +F ++R +L  RA ELD
Sbjct: 1012 AEESL-KKYKPLASDEILKKLNTTTGHLSKMTNVNKRASENYTRFEDKRGELTSRAEELD 1070

Query: 1021 ESKDSIQDLIVKLKQQKVNAVDSTFQKVSENFEAVFERLVPRGTAKLII-HRKNDNANDH 1079
            ESK SI++LI +LK+QK+ A++ TF KV++NF  VF  LVPRG  KLII HRKN    D+
Sbjct: 1071 ESKQSIENLIDQLKEQKITAIEKTFNKVADNFSRVFATLVPRGIGKLIINHRKN---TDN 1127

Query: 1080 DESIDVDMDAESNESQNGKDS--EIMYTGVSISVSFNSKQNEQLHVEQLSGGQKTVCAIA 1137
             E         + + QN  ++  E  YTGVSI VSFNSK++EQL VEQLSGGQKTVCAIA
Sbjct: 1128 SEVSTKKRRRGARQEQNSAEALNESKYTGVSIQVSFNSKKDEQLRVEQLSGGQKTVCAIA 1187

Query: 1138 LILAIQMVDPASFYLFDEIDAALDKQYRTAVATLLKELSKNAQFICTTFRTDMLQVADKF 1197
            LILAIQMVDPA FYLFDEIDAALDKQYR AVA  +K LS  AQFICTTFRTDM+ VAD F
Sbjct: 1188 LILAIQMVDPAPFYLFDEIDAALDKQYRIAVARTIKNLSDTAQFICTTFRTDMINVADTF 1247

Query: 1198 FRVKYENKIST 1208
            FRVK+ENK+ST
Sbjct: 1248 FRVKFENKVST 1258

>AGR236W [4547] [Homologous to ScYFR031C (SMC2) - SH]
           complement(1189851..1193363) [3513 bp, 1170 aa]
          Length = 1170

 Score =  159 bits (403), Expect = 2e-39,   Method: Compositional matrix adjust.
 Identities = 183/732 (25%), Positives = 343/732 (46%), Gaps = 62/732 (8%)

Query: 1   MYIKRVIIKGFKTYRNETIIDNFSPHQNVIIGSNGSGKSNFFAAIRFVLS-DDYSNLKRE 59
           M ++ +II GFK+Y   T+I  + P  N I G NGSGKSN   +I FVL     + ++ +
Sbjct: 1   MKVEELIIDGFKSYATRTVISGWDPQFNAITGLNGSGKSNILDSICFVLGISSMATVRAQ 60

Query: 60  ERQGLIHQGSGGSVMSASVEIVFHDPDHSMILPSGVLSRGDDEVTIRRTVGLKKDDYQLN 119
             Q LI++     V+ ASV IVF + D S   P G  +     VT R+ +      Y +N
Sbjct: 61  NLQDLIYKRGQAGVIKASVTIVFDNSDPSSS-PFGFETYPKISVT-RQIILGGTSKYLIN 118

Query: 120 DRNVTKGDIVRMLETAGFSMNNPYNIVPQGKIVALTNAKDKERLQLLEDVVGAKSFEVKL 179
                +  ++ + ++   ++NNP  ++ QGKI  + N K  E L L+E+  G + FE + 
Sbjct: 119 GHRAQQLTVLHLFQSVQLNINNPNFLIMQGKITKVLNMKPDEILALIEEAAGTRMFEDRR 178

Query: 180 KASLKKMEETEQKKIQINK-EMGELNSKLSEMEQERKELEKYNE----LERNRKIYQFTL 234
           + + K M + E K  +I    + E+  KL+ +  E++   ++ +    LE+  +I     
Sbjct: 179 EKAEKTMAKKETKLQEIRALLLEEIEPKLNRLRNEKRAFLEFQQTQTDLEKTSRIVNTYD 238

Query: 235 YDRELNEVINQMERLDGD---YNNTVYSSEQYIQELDKREDMIDQVSKKLSSI--EASLK 289
           Y   + +  +  ERL  D     +  +S E+Y        D I  +++   SI  +   +
Sbjct: 239 YQTLVQKRSSMQERLQSDQKRIKDLEFSVEKY-------RDEISTLTEDFESIRRQKEKQ 291

Query: 290 IKNATDLQQAKLRESEISQKLTNVNVKIKDVQQQIESNEEQRNLDSATLKEIKSIIEQRK 349
           ++  T LQ  + +E+ +S +L+ V   +   +  +   +EQRNL +  L   KS     +
Sbjct: 292 LQKDTTLQTLEAKENSLSTELSRVTAALGITRDDLA--DEQRNLSALNLSIAKS-----E 344

Query: 350 QKLSKILPRYQELTKEEAMYKLQLASLQQ--KQRDLILKKGEYARFKSKDERDTWIHSEI 407
           Q+L+ +   Y E   E  +   ++  L+   + ++ +L         +      +     
Sbjct: 345 QELTSLSKTYSETENEYVVLNAEIEKLKTICRNKEELLSTLTTGISSTGTTEGGYTA--- 401

Query: 408 EELKSSIQNLNELE---SQLQMDRTSLRKQYSAXXXXXXXXXXXXNGPDTKGQLEDFDSE 464
            +L ++   LNE +    +++M  T LRK+ +                  + +L +  S 
Sbjct: 402 -QLNNAKLQLNEAQIAVKKVEMRITMLRKELATNEPLLERAKKENEVK--RAELSENKSH 458

Query: 465 LIHLKQKLSES---LDTRKELWRKEQKLQTVLETLLSDVNQNQRNVNETMSRSLANGIIN 521
           +  L++ L+ S    +  K+L +KE +L+T L  + +D         E + R +AN   +
Sbjct: 459 VERLQESLTASGFKPELLKQLKQKEAELKTELYAISTDA--------EYLKRKVANLEFS 510

Query: 522 VKEITEKLKISPESVFGTLGELIKVNDKYKTCA---EVIGGNSLFHIVVDTEETATLIMN 578
               +++   +P+SV G   ++  ++++    A   +V  G  LF+++VD E+TA+ ++ 
Sbjct: 511 YSPPSKEF--NPKSVKGIAAQVFTLSEENFDSANALQVCAGGRLFNVIVDNEKTASQLL- 567

Query: 579 ELYRMKGGRVTFIPLNRLS---LDSDVKFPSNTTTQIQFTPLIKKIKYEPRFEKAVKHVF 635
           E  R++  RVT IPLN++S   +++D    + +         +  I YE    +A++ +F
Sbjct: 568 ERGRLR-KRVTIIPLNKISARVINTDALNKAKSLAPGAVELALNLIGYEAEVARAMEFIF 626

Query: 636 GKTIVVKDLGQGLKLAKKHKLNA--ITLDGDRADKRGVLTGGYLDQHKRTRLESLKNLNE 693
           G +++ +D     K+    ++ A  ITLDGD  D  G L+GG    H  + L  ++  NE
Sbjct: 627 GGSLICRDAATAKKVTFHPQVRARSITLDGDIYDPEGTLSGGS-RSHTSSLLIDIQKYNE 685

Query: 694 SRSQHKKILEEL 705
           +  Q   + +EL
Sbjct: 686 AAKQMMVLEKEL 697

 Score = 67.4 bits (163), Expect = 6e-11,   Method: Compositional matrix adjust.
 Identities = 54/189 (28%), Positives = 94/189 (49%), Gaps = 30/189 (15%)

Query: 1019 LDESKDSIQDLIVKLKQQKVNAVDSTFQKVSENFEAVFERLVPRGTAKLIIHRKNDNAND 1078
            +++ K  I + I KL + K +A+  T++KV+ +F  +F  L+P   AKL           
Sbjct: 1007 IEKDKMKIVETIEKLNEYKRDALVKTWEKVNVDFGNIFAELLPNSFAKLA---------- 1056

Query: 1079 HDESIDVDMDAESNESQNGKDSEIMYTGVSISVSFNSKQNEQLHVEQLSGGQKTVCAIAL 1138
                           +  GKD   +  G+ + V   +   E L   +LSGGQ+++ A++L
Sbjct: 1057 ---------------AIEGKD---VTAGLEVKVKLGTLWKESLV--ELSGGQRSLIALSL 1096

Query: 1139 ILAIQMVDPASFYLFDEIDAALDKQYRTAVATLLKELSKNAQFICTTFRTDMLQVADKFF 1198
            ILA+    PA  Y+ DE+DAALD  +   +  L+K   K +QFI  + +  M   A++ F
Sbjct: 1097 ILALLQFKPAPMYILDEVDAALDLSHTQNIGHLIKTRFKGSQFIVVSLKEGMFTNANRVF 1156

Query: 1199 RVKYENKIS 1207
            + ++++  S
Sbjct: 1157 KTRFQDGTS 1165

>KLLA0D16005g complement(1346492..1350004) similar to sp|P38989
           Saccharomyces cerevisiae YFR031c SMC2 chromosome
           segregation protein, start by similarity
          Length = 1170

 Score =  142 bits (359), Expect = 4e-34,   Method: Compositional matrix adjust.
 Identities = 171/734 (23%), Positives = 330/734 (44%), Gaps = 131/734 (17%)

Query: 1   MYIKRVIIKGFKTYRNETIIDNFSPHQNVIIGSNGSGKSNFFAAIRFVLS-DDYSNLKRE 59
           M ++ +II GFK+Y   T+I ++ P  N I G NGSGKSN   AI FVL     + ++ +
Sbjct: 1   MKVEELIIDGFKSYATRTVITDWDPQFNAITGLNGSGKSNILDAICFVLGISSMATVRAQ 60

Query: 60  ERQGLIHQGSGGSVMSASVEIVFHDPDHSMILPSGVLSRGDDEVTIRRTV---GLKKDDY 116
             Q LI++     V  ASV IVF++ D S   P G  S    +++I R +   G+ K  Y
Sbjct: 61  NLQDLIYKRGQAGVTKASVTIVFNNSDTSNS-PIGFESHA--KISITRQIILGGVSK--Y 115

Query: 117 QLNDRNVTKGDIVRMLETAGFSMNNPYNIVPQGKIVALTNAKDKERLQLLEDVVGAKSFE 176
            +N     +  ++++ ++   ++NNP  ++ QGKI  + N K +E L L+E+  G + FE
Sbjct: 116 LINGHRAQQQTVLQLFQSVQLNINNPNFLIMQGKITKVLNMKPQEILSLIEEAAGTRMFE 175

Query: 177 VKLKASLKKMEETEQKKIQINKEMGE-LNSKLSEMEQERKELEKYNELERNRKIYQFTLY 235
            + + + + M + E K  +I   + E +  KL     E++   ++ E + + +     + 
Sbjct: 176 DRREKAERTMAKKETKLQEIRTLLTEEIEPKLERFRNEKRTYLEFQETQSDLENVMRVVN 235

Query: 236 DRELNEVINQMERLDGDYNNTVYSSEQYIQELDKREDMIDQVSKKLSSIEASL------- 288
             E +++ N+ + ++     +++S +  ++EL   ED I ++  ++ ++ + L       
Sbjct: 236 AFEFSQLSNKKKHIE----ESLHSGQSRLEEL---EDTISRLKNEVENLGSDLDALKEQR 288

Query: 289 --KIKNATDLQQAKLRESEISQKLTNVN--------------VKIKDVQQQIESNEEQR- 331
             +++    + + + +ESEIS +L+ V               V+I ++++ IE  ++Q  
Sbjct: 289 HKEVQLGGRMSELETKESEISNELSRVQTSLNIALEDSGEEKVRISNLKKNIERWKQQHQ 348

Query: 332 -------------NLDSATLKEIKSIIEQRKQKLSKILPRYQELTKEEAMYKLQLASLQQ 378
                        N+ +  L+E+K+I +++++ LS +             Y  QL+++++
Sbjct: 349 EKKTLYDSKYKEYNIQNKKLEELKAIHKEKQELLSTLTTGISSTGTTANGYNFQLSTIKE 408

Query: 379 KQRDLIL----KKGEYARFK----SKDERDTWIHSEIEELKSSIQNL----NELESQLQM 426
           K ++  +    K+ E    K    S   + +   +E E+    IQN+    N LE QL+ 
Sbjct: 409 KLQNTRIEIREKEMEVEMLKEELNSNTPKISAAKAEKEKYDKEIQNMQHHCNNLEKQLE- 467

Query: 427 DRTSLRKQYSAXXXXXXXXXXXXNGPDTKGQLEDFDSELIHLKQKLSESLDTRKELWRKE 486
                  QY                P     L+D +  L H   +LS+            
Sbjct: 468 -------QYGY-------------DPILLKNLKDNERSLKHTHYQLSQE----------- 496

Query: 487 QKLQTVLETLLSDVNQNQRNVNETMSRSLANGIINVKEITEKLKISPESVFGTLGELIKV 546
                                 E++ R ++N   N    ++   +S  SV G +G+L  +
Sbjct: 497 ---------------------TESLHRKVSNLDFNYVPPSKNFDVS--SVKGVVGQLFTL 533

Query: 547 NDK---YKTCAEVIGGNSLFHIVVDTEETATLIMNELYRMKGGRVTFIPLNRLS---LDS 600
           ++         +V  G  LF++VVD E TA+ ++ E  R++  RVT IPLN++S   ++ 
Sbjct: 534 DEANIDSSAALQVCAGGRLFNVVVDNERTASQLL-EHGRLR-KRVTIIPLNKISSRRINE 591

Query: 601 DVKFPSNTTTQIQFTPLIKKIKYEPRFEKAVKHVFGKTIVVKDL--GQGLKLAKKHKLNA 658
            +   +      +    I  I +E    +A++ +FG + + +D    + +    + +  +
Sbjct: 592 SILHLAKELAPGKVELAINLIGFEEEVTRAMEFIFGTSFICRDAETAKQITFNPRIRSRS 651

Query: 659 ITLDGDRADKRGVL 672
           ITL GD  D  G L
Sbjct: 652 ITLQGDVYDPEGTL 665

 Score = 74.7 bits (182), Expect = 3e-13,   Method: Compositional matrix adjust.
 Identities = 71/253 (28%), Positives = 116/253 (45%), Gaps = 35/253 (13%)

Query: 960  LPEDALVNDF----SDITSDQLLQRLNDMNTEISGLKN-VNKRAFENFKKFNERRKDLAE 1014
            L + ++VN       +I  DQ  +R +D+      L+  VN       +   ++   L  
Sbjct: 943  LEDTSMVNSILTQNKNINLDQYKKRGSDLAESFQSLRRKVNPEVMSMIESVEKKETALKT 1002

Query: 1015 RASELDESKDSIQDLIVKLKQQKVNAVDSTFQKVSENFEAVFERLVPRGTAKLIIHRKND 1074
                +++ K  IQ+ I KL + K   +  T++KVS +F  +F  L+P   AKL       
Sbjct: 1003 MIKTIEKDKQKIQETIEKLNEYKRETLIKTWEKVSVDFGNIFGDLLPNSFAKL------- 1055

Query: 1075 NANDHDESIDVDMDAESNESQNGKDSEIMYTGVSISVSFNSKQNEQLHVEQLSGGQKTVC 1134
                              E   GKD   +  G+ + V       E L VE LSGGQ+++ 
Sbjct: 1056 ------------------EPSEGKD---VTEGLEVKVKLGKIWKESL-VE-LSGGQRSLI 1092

Query: 1135 AIALILAIQMVDPASFYLFDEIDAALDKQYRTAVATLLKELSKNAQFICTTFRTDMLQVA 1194
            A++LILA+    PA  Y+ DE+DAALD  +   +  L+K   K +QFI  + +  M   A
Sbjct: 1093 ALSLILALLQFKPAPMYILDEVDAALDLSHTQNIGHLIKTRFKGSQFIVVSLKEGMFTNA 1152

Query: 1195 DKFFRVKYENKIS 1207
            ++ FR ++++  S
Sbjct: 1153 NRVFRTRFQDGTS 1165

>YFL008W (SMC1) [1674] chr6 (119424..123101) Coiled-coil protein of
            the SMC family involved in chromosome condensation and
            segregation [3678 bp, 1225 aa]
          Length = 1225

 Score =  127 bits (318), Expect = 3e-29,   Method: Compositional matrix adjust.
 Identities = 280/1294 (21%), Positives = 538/1294 (41%), Gaps = 199/1294 (15%)

Query: 8    IKGFKTYRNETIIDNFSPHQNVIIGSNGSGKSNFFAAIRFVLSDDYSNLKREERQGLIHQ 67
            +  FK+YR  T +     +   IIG NGSGKSN   AI FVL    ++L+    + LI++
Sbjct: 9    LSNFKSYRGVTKVGFGESNFTSIIGPNGSGKSNMMDAISFVLGVRSNHLRSNILKDLIYR 68

Query: 68   GSGGSVMSASVE---IVFHDPDHSMILPSGVLSRGDDEVTIRRTVGLKKD-DYQLNDRNV 123
            G      S   +       +P  + +       +G+  V + R +    D  Y+++ + V
Sbjct: 69   GVLNDENSDDYDNEGAASSNPQSAYV--KAFYQKGNKLVELMRIISRNGDTSYKIDGKTV 126

Query: 124  TKGDIVRMLETAGFSMNNPYNIVPQGKIVALTNAKDKERLQLLEDVVGA-------KSFE 176
            +  D    LE     +     +V QG +  +      E  ++ E+V G+       +  +
Sbjct: 127  SYKDYSIFLENENILIKAKNFLVFQGDVEQIAAQSPVELSRMFEEVSGSIQYKKEYEELK 186

Query: 177  VKLKASLKKMEETEQKKIQINKEMGELNSKLSEMEQERKELEKYNELERNRKIYQFTLYD 236
             K++   K   E+ + + +I+ E+      +++ E+ RK+L+K NEL++ + ++Q    +
Sbjct: 187  EKIEKLSKSATESIKNRRRIHGELKTYKEGINKNEEYRKQLDKKNELQKFQALWQLYHLE 246

Query: 237  RELNEVINQMERLD-------GDYNNTVYSSEQYIQELDKREDMIDQVSKKLSSIEASLK 289
            ++  E+ +++  L+       G  NN + S ++      K   +I +   KL  I    K
Sbjct: 247  QQKEELTDKLSALNSEISSLKGKINNEMKSLQRSKSSFVKESAVISKQKSKLDYIFKD-K 305

Query: 290  IKNATDLQQAKLRESEISQKLTNVNVKIKDVQQQIESNEEQRNLDSATLKEIKSIIEQRK 349
             K  +DL+  K+ +    ++++++  +I+ +Q+ +     QR          K+ +E+ +
Sbjct: 306  EKLVSDLRLIKVPQQAAGKRISHIEKRIESLQKDL-----QRQ---------KTYVERFE 351

Query: 350  QKLSKILPRYQELTKEEAMYKLQLASLQQKQRD---LILKKGEYARFKSKDERDTWIHSE 406
             +L K++ R +E  +EE         ++Q  R+     L + +   +    E+       
Sbjct: 352  TQL-KVVTRSKEAFEEE---------IKQSARNYDKFKLNENDLKTYNCLHEKYLTEGGS 401

Query: 407  IEELKSSIQNLNELESQLQMDRTSLRKQYSAXXXXXXXXXXXXNGPDTKGQLEDFDSELI 466
            I E K ++ N ++ E Q +++R + R   S                      E  D++L 
Sbjct: 402  ILEEKIAVLNNDKREIQEELERFNKRADISKRRITEELSITG----------EKLDTQLN 451

Query: 467  HLKQKLSESLDTRKELWRKEQKLQTVLETL-----------------LSDVNQNQRNVNE 509
             L+  L+E      E   + +KLQ+ +E+                  + D++ NQR   E
Sbjct: 452  DLRVSLNEKNALHTERLHELKKLQSDIESANNQEYDLNFKLRETLVKIDDLSANQR---E 508

Query: 510  TM-SRSLANGIINVKEITEKLKISPESVFGTLGELIKVN-DKYKTCAEVIGGNSLFHIVV 567
            TM  R L   I  +K     +K       G + +L     +KY      I G +   ++V
Sbjct: 509  TMKERKLRENIAMLKRFFPGVK-------GLVHDLCHPKKEKYGLAVSTILGKNFDSVIV 561

Query: 568  DTEETATLIMNELYRMKGGRVTFIPLNRLSLDSDVKFPSNTTTQIQ-FTPLIKKIKYEPR 626
            +    A   +  L + + G  +FIPL+ +    + + P+ +    Q +   I  I YEP 
Sbjct: 562  ENLTVAQECIAFLKKQRAGTASFIPLDTI----ETELPTLSLPDSQDYILSINAIDYEPE 617

Query: 627  FEKAVKHVFGKTIVVKDL--GQGLKLAKKHKLNAITLDGDRADKRGVLTGGYL-DQHKRT 683
            +EKA+++V G +I+   L   + LK  K  +   +T++G    K G++TGG   D + R 
Sbjct: 618  YEKAMQYVCGDSIICNTLNIAKDLKWKKGIRGKLVTIEGALIHKAGLMTGGISGDANNRW 677

Query: 684  RLESLKNLNESRSQHKKILEELDFVRNELNDIDTKIDQVNGNIRKVSNDRESVLTNIEVY 743
              E  ++L    S   K+L ++D + N       +  +V  ++  +++D  ++ T +   
Sbjct: 678  DKEEYQSL---MSLKDKLLIQIDELSNGQRSNSIRAREVENSVSLLNSDIANLRTQVTQQ 734

Query: 744  RTSLNTKKNE----KLILEESLNAIILKLEKL-----NTNRTFAQEKLNTFENDLLQEFD 794
            + SL+  + E      ++E+ +   I +L+K      NT     +EK    +N++ +EF 
Sbjct: 735  KRSLDENRLEIKYHNDLIEKEIQPKITELKKKLDDLENTKDNLVKEK-EALQNNIFKEFT 793

Query: 795  XX--------------XXXXXXXXXXXXXXXISAAHNKLNITSDALEGITTTI-----DS 835
                                           I    NKL   +D L            D 
Sbjct: 794  SKIGFTIKEYENHSGELMRQQSKELQQLQKQILTVENKLQFETDRLSTTQRRYEKAQKDL 853

Query: 836  LNAELESK-LIPQENDLESKMSEVGDAFIFGXXXXXXXXXXXXXXXXXXHENAVLELGTV 894
             NA++E K L  QE  +E K+  +                         H+N + EL   
Sbjct: 854  ENAQVEMKSLEEQEYAIEMKIGSIESKL-------------------EEHKNHLDEL--- 891

Query: 895  QREIESLIAEETNNKKLLEKANNQQRLLLKKLDNFQKSVEKTMIKKTTL-----VTXXXX 949
            Q++  +  +E  +++ +LE  N+  ++L ++ D  ++ +EK  +++ T      ++    
Sbjct: 892  QKKFVTKQSELNSSEDILEDMNSNLQVLKRERDGIKEDIEKFDLERVTALKNCKISNINI 951

Query: 950  XXXXXXXXGLLP------EDALVNDFSDITSDQLLQRLNDMNT---------------EI 988
                      LP      E   +++  DI    L ++  + NT               EI
Sbjct: 952  PISSETTIDDLPISSTDNEAITISNSIDINYKGLPKKYKENNTDSARKELEQKIHEVEEI 1011

Query: 989  SGLKNVNKRAFENFKKFNERRKDLAERASELDESKDSIQDLIVKLKQQKVNAVDSTFQKV 1048
                  N RA E + +   R + +     +L   +  I +  +K+K+++    + TF  V
Sbjct: 1012 LNELQPNARALERYDEAEGRFEVINNETEQLKAEEKKILNQFLKIKKKRKELFEKTFDYV 1071

Query: 1049 SENFEAVFERLVPRGTAKLIIHRKNDNANDHDESIDVDMDAESNESQNGKD-SEIMYTGV 1107
            S++ +A++  L            KN N+N       V++ A  N S   +D  E    G+
Sbjct: 1072 SDHLDAIYRELT-----------KNPNSN-------VEL-AGGNASLTIEDEDEPFNAGI 1112

Query: 1108 SISVSFNSKQNEQLHVEQLSGGQKTVCAIALILAIQMVDPASFYLFDEIDAALD-KQYRT 1166
                +   K+ + +  E LSGG+KTV A+AL+ AI    P+ F++ DE+DAALD    + 
Sbjct: 1113 KYHATPPLKRFKDM--EYLSGGEKTVAALALLFAINSYQPSPFFVLDEVDAALDITNVQR 1170

Query: 1167 AVATLLKELSKNAQFICTTFRTDMLQVADKFFRV 1200
              A + +  + + QFI  + +  M + +D    V
Sbjct: 1171 IAAYIRRHRNPDLQFIVISLKNTMFEKSDALVGV 1204

>CAGL0D05258g 500858..504370 similar to sp|P38989 Saccharomyces
           cerevisiae YFR031c SMC2 chromosome segregation protein,
           start by similarity
          Length = 1170

 Score =  109 bits (273), Expect = 6e-24,   Method: Compositional matrix adjust.
 Identities = 117/428 (27%), Positives = 202/428 (47%), Gaps = 62/428 (14%)

Query: 1   MYIKRVIIKGFKTYRNETIIDNFSPHQNVIIGSNGSGKSNFFAAIRFVLS-DDYSNLKRE 59
           M ++ +II GFK+Y   T+I ++ P  N I G NGSGKSN   AI FVL     + ++  
Sbjct: 1   MKVEELIIDGFKSYATRTVISDWDPQFNAITGLNGSGKSNILDAICFVLGISSMATVRAS 60

Query: 60  ERQGLIHQGSGGSVMSASVEIVFHDPDHSMILPSGVLSRGDDEVTIRRTVGLKKDDYQLN 119
             Q LI++     V  ASV IVF + D S   P G        VT R+ V      Y +N
Sbjct: 61  NLQDLIYKRGQAGVTKASVTIVFDNTDKSNT-PIGFSEYPKISVT-RQIVLGGTSKYLIN 118

Query: 120 DRNVTKGDIVRMLETAGFSMNNPYNIVPQGKIVALTNAKDKERLQLLEDVVGAKSFEVKL 179
                +  ++++ ++   ++NNP  ++ QGKI  + N K  E L L+E+  G K FE + 
Sbjct: 119 GHRAPQQSVLQLFQSVQLNINNPNFLIMQGKITKILNMKPSEILSLIEEAAGTKMFEDRK 178

Query: 180 KASLKKMEETEQKKIQINKEM--GELNSKLSEMEQERKELEKYN----ELERNRKIYQFT 233
           + + + M++ E  K+Q N+ +   E++ +L ++  E++   ++     +LE   K+   T
Sbjct: 179 EKAERTMQKKET-KLQENRTLLKEEIDPQLEKLRNEKRLFLEFQTIQADLETTEKVVIAT 237

Query: 234 LYDRELNEVINQMERLDGDYNNTVY-SSEQYIQELDKREDMIDQVSKKLSSIEASLK--- 289
            Y + LN           D   TV  +S   + EL K+   ID V++++S++   L+   
Sbjct: 238 DYQKMLN---------SRDSIKTVLETSNSKMDELQKK---IDLVNREISNLNEDLQQTM 285

Query: 290 ------IKNATDLQQAKLRE----SEIS-----------------QKLTNVNVKIKDVQQ 322
                 ++N T+++  + +E    SEI+                 QK   + VKI+  +Q
Sbjct: 286 KQKKKELENDTNIKAMESKEDKLLSEIAKLKANLKINGDNILDGKQKQKRLTVKIEKSKQ 345

Query: 323 QIESNEE--------QRNLDSATLKEIKSIIEQRKQKLSKILPRYQELTKEEAMYKLQLA 374
            ++S  +         RN + A L  + SI +Q+++ LS +          E  Y+ Q++
Sbjct: 346 LLDSKSQLLEDSKSKSRNCE-ADLTRLNSIFKQKEELLSVLSTGISSTGGTEGGYEAQIS 404

Query: 375 SLQQKQRD 382
           S+  K  D
Sbjct: 405 SVNDKIND 412

 Score = 88.6 bits (218), Expect = 2e-17,   Method: Compositional matrix adjust.
 Identities = 54/189 (28%), Positives = 95/189 (50%), Gaps = 30/189 (15%)

Query: 1019 LDESKDSIQDLIVKLKQQKVNAVDSTFQKVSENFEAVFERLVPRGTAKLIIHRKNDNAND 1078
            +++ K  I+D I KL + K   +  T++KV+++F  +F  L+P  +AKL+          
Sbjct: 1007 IEKDKKKIEDTISKLNEYKKETLVKTWKKVTKDFGNIFCDLLPNSSAKLV---------- 1056

Query: 1079 HDESIDVDMDAESNESQNGKDSEIMYTGVSISVSFNSKQNEQLHVEQLSGGQKTVCAIAL 1138
                              GKD   +  G+ + V   +   E L   +LSGGQ+++ A++L
Sbjct: 1057 ---------------PCEGKD---ITEGLEVKVKLGNLWKESLV--ELSGGQRSLIALSL 1096

Query: 1139 ILAIQMVDPASFYLFDEIDAALDKQYRTAVATLLKELSKNAQFICTTFRTDMLQVADKFF 1198
            I+A+    PA  Y+ DE+DAALD  +   +  L+K   K +QFI  + +  M   A++ F
Sbjct: 1097 IMALLQFRPAPMYILDEVDAALDLSHTQNIGHLIKTRFKGSQFIVVSLKEGMFTNANRVF 1156

Query: 1199 RVKYENKIS 1207
            R ++++  S
Sbjct: 1157 RTRFQDGTS 1165

 Score = 59.3 bits (142), Expect = 2e-08,   Method: Compositional matrix adjust.
 Identities = 47/160 (29%), Positives = 76/160 (47%), Gaps = 28/160 (17%)

Query: 533 PESVFGTLGELIKV---NDKYKTCAEVIGGNSLFHIVVDTEETATLIMNELYRMKGGRVT 589
           P SV G   EL  +   N KY    ++  G  L++++VD E+T + ++ +  R++  RVT
Sbjct: 520 PNSVKGVTAELFSIPEQNMKYVIGLQICAGGRLYNVIVDNEKTGSALLQK-GRLR-KRVT 577

Query: 590 FIPLNRLSLDSDVKFPSNTTT---QIQFTP-----LIKKIKYEPRFEKAVKHVFGKTIVV 641
            IPL+++     +  P N        Q  P      +  I Y     KA++ +FG +++ 
Sbjct: 578 IIPLDKV-----ISRPLNQNKLKLAKQLAPGKVELALNLIGYSDEVVKAMEFIFGNSLIC 632

Query: 642 KDLGQGLKLAKKHKLN------AITLDGDRADKRGVLTGG 675
            D     + AKK   N      +ITL+GD  D  G L+GG
Sbjct: 633 DD----AETAKKITFNPGIRTRSITLEGDIYDPEGTLSGG 668

>Kwal_55.20421
          Length = 1170

 Score =  107 bits (266), Expect = 5e-23,   Method: Compositional matrix adjust.
 Identities = 77/235 (32%), Positives = 119/235 (50%), Gaps = 8/235 (3%)

Query: 1   MYIKRVIIKGFKTYRNETIIDNFSPHQNVIIGSNGSGKSNFFAAIRFVLS-DDYSNLKRE 59
           M ++ +II GFK+Y   T+I N+ P  N I G NGSGKSN   AI FVL     S ++  
Sbjct: 1   MKVEELIIDGFKSYATRTVISNWDPQFNAITGLNGSGKSNILDAICFVLGISSMSTVRAS 60

Query: 60  ERQGLIHQGSGGSVMSASVEIVFHDPDHSMILPSGVLSRGDDEVTIRRTVGLKKDDYQLN 119
             Q LI++     V  ASV IVF + D +   P G  S     VT R+ V      Y +N
Sbjct: 61  NLQDLIYKRGQAGVTKASVTIVFANSDKNNS-PIGFESYPKISVT-RQIVLGGTSKYLIN 118

Query: 120 DRNVTKGDIVRMLETAGFSMNNPYNIVPQGKIVALTNAKDKERLQLLEDVVGAKSFEVKL 179
                +  ++ + ++   ++NNP  ++ QGKI  + N K  E L L+E+  G K FE + 
Sbjct: 119 GHRAQQQTVLHLFQSVQLNINNPNFLIMQGKITKVLNMKPTEILSLIEEAAGTKMFEDRR 178

Query: 180 KASLKKMEETEQKKIQINKEMG-ELNSKLSEMEQERKEL----EKYNELERNRKI 229
           + + + M + E K  +I   +  E+  KL+++  E++      E  ++LE   KI
Sbjct: 179 EKAERTMNKKETKLQEIRSLLQEEVEPKLNKLRNEKRAFLDFQETQSDLENTSKI 233

 Score = 74.3 bits (181), Expect = 5e-13,   Method: Compositional matrix adjust.
 Identities = 62/230 (26%), Positives = 110/230 (47%), Gaps = 31/230 (13%)

Query: 979  QRLNDMNTEISGLKN-VNKRAFENFKKFNERRKDLAERASELDESKDSIQDLIVKLKQQK 1037
            QR + +N + S L+  VN       +   ++   L    S +++ K  IQ+ + KL + K
Sbjct: 966  QRADQLNEKFSALRRKVNPNIMSMIESVEKKESALKTMISTIEKDKRKIQETVAKLNEYK 1025

Query: 1038 VNAVDSTFQKVSENFEAVFERLVPRGTAKLIIHRKNDNANDHDESIDVDMDAESNESQNG 1097
               +  T++KV+ +F  +F  L+P   AKL                 V ++ +S      
Sbjct: 1026 RETLIKTWEKVTVDFGNIFGDLLPNSFAKL-----------------VPIEGKS------ 1062

Query: 1098 KDSEIMYTGVSISVSFNSKQNEQLHVEQLSGGQKTVCAIALILAIQMVDPASFYLFDEID 1157
                 +  G+ + +   S   E L   +LSGGQ+++ A++LILA+    PA  Y+ DE+D
Sbjct: 1063 -----VTEGLEVKIRLGSIWKESLV--ELSGGQRSLIALSLILALLQFKPAPMYILDEVD 1115

Query: 1158 AALDKQYRTAVATLLKELSKNAQFICTTFRTDMLQVADKFFRVKYENKIS 1207
            AALD  +   +  L+K   K +QFI  + +  M   A++ FR ++++  S
Sbjct: 1116 AALDLSHTQNIGHLIKTRFKGSQFIVVSLKEGMFTNANRVFRTRFQDGTS 1165

>Sklu_2249.2 YFR031C, Contig c2249 627-3873 reverse complement
          Length = 1083

 Score =  103 bits (258), Expect = 4e-22,   Method: Compositional matrix adjust.
 Identities = 75/243 (30%), Positives = 121/243 (49%), Gaps = 9/243 (3%)

Query: 1   MYIKRVIIKGFKTYRNETIIDNFSPHQNVIIGSNGSGKSNFFAAIRFVLS-DDYSNLKRE 59
           M ++ +II GFK+Y   T+I N+ P  N I G NGSGKSN   +I FVL       ++  
Sbjct: 1   MKVEELIIDGFKSYATRTVISNWDPQFNAITGLNGSGKSNILDSICFVLGISSMVTVRAS 60

Query: 60  ERQGLIHQGSGGSVMSASVEIVFHDPDHSMILPSGVLSRGDDEVTIRRTVGLKKDDYQLN 119
             Q LI++     V  ASV IVF + D S   P G  S     VT R+ +      Y +N
Sbjct: 61  NLQDLIYKRGQAGVTKASVTIVFDNTDKSSS-PIGFESYPKISVT-RQIILGGTSKYLIN 118

Query: 120 DRNVTKGDIVRMLETAGFSMNNPYNIVPQGKIVALTNAKDKERLQLLEDVVGAKSFEVKL 179
                +  ++ + ++   ++NNP  ++ QGKI  + N K  E L L+E+  G + FE + 
Sbjct: 119 GHRAQQQTVLHLFQSVQLNINNPNFLIMQGKITKVLNMKPTEILSLIEEAAGTRMFEDRR 178

Query: 180 KASLKKMEETEQKKIQINKEM-GELNSKLSEMEQERKELEKYNE----LERNRKIYQ-FT 233
           + + K M + E K  +I   +  E+  KL ++  +++   ++ E    LE+  +I   + 
Sbjct: 179 EKAEKTMAKKETKLQEIRTLLEEEIEPKLEKLRNQKRAFLEFQETQTDLEKTLRILNAYE 238

Query: 234 LYD 236
            YD
Sbjct: 239 YYD 241

 Score = 37.7 bits (86), Expect = 0.073,   Method: Compositional matrix adjust.
 Identities = 28/105 (26%), Positives = 51/105 (48%), Gaps = 1/105 (0%)

Query: 965  LVNDFSDITSDQLLQRLNDMNTEISGLKN-VNKRAFENFKKFNERRKDLAERASELDESK 1023
            ++N    I  ++  QR N +  +  G+K  VN       +   ++   L      +++ K
Sbjct: 952  IINQNEGINLEEYRQRGNQLQEKFQGMKRKVNPNIMSMIENVEKKETALKTMIKTIEKDK 1011

Query: 1024 DSIQDLIVKLKQQKVNAVDSTFQKVSENFEAVFERLVPRGTAKLI 1068
              IQ+ I KL + K + +  T++KVS +F  +F  L+P   AKL+
Sbjct: 1012 TKIQETIEKLNEYKRDTLLKTWEKVSVDFGNIFGDLLPNSFAKLV 1056

>AGR089C [4399] [Homologous to ScYLR086W (SMC4) - SH]
           (901443..905555) [4113 bp, 1370 aa]
          Length = 1370

 Score =  102 bits (253), Expect = 2e-21,   Method: Compositional matrix adjust.
 Identities = 163/731 (22%), Positives = 313/731 (42%), Gaps = 116/731 (15%)

Query: 1   MYIKRVIIKGFKTYRNETIIDNFSPHQNVIIGSNGSGKSNFFAAIRFVLSDDYSNLKREE 60
           + I+ ++++ FK+Y    ++  F    + ++G NGSGKSN   ++ F      + +++ +
Sbjct: 106 LCIRTLVLENFKSYAGRQVVGPFHSSFSAVVGPNGSGKSNVIDSMLFAFGFRANKMRQGK 165

Query: 61  RQGLIHQGSGGSVMS-ASVEIVFH----DPDHSMILPSGVLSRGDDEVTIRRTVGLKKDD 115
              LIH+      +   SVEI F     +PD +    + VLS   +   +R+        
Sbjct: 166 LSHLIHKSEKYPDLDFCSVEIQFQYVVDEPDGT----TRVLSGKPELSVMRKAFKNNTSK 221

Query: 116 YQLNDRNVTKGDIVRMLETAGFSMNNPYNIVPQGKIVALTNAKDKER-------LQLLED 168
           Y LN +  T  ++ R+L   G  +++   ++ QG++ ++   K K         L+ LED
Sbjct: 222 YYLNGKESTYTEVTRLLRDEGIDLDHKRFLILQGEVESIAQMKPKAEHEGDDGLLEYLED 281

Query: 169 VVGAKSFEVKLKASLKKMEETEQKKIQINKEMGELNSKLSEMEQERKELEKYNE-----L 223
           ++G   ++ +++ +L +++        +N    E  ++   +E+E+  LE   +     L
Sbjct: 282 IIGTTKYKAQIEQALVEVD-------SLNDICMEKENRFDLVEKEKLSLEPGKDEALAFL 334

Query: 224 ERNR-------KIYQFTLYD------RELNEVINQMERLDGDYNNTVYSSEQYIQELDKR 270
           ++ +       K YQ+ L+       + L+ V N M +L+ +    V + ++ ++  D  
Sbjct: 335 KKEKDLTLLMSKKYQYHLFHNGSKLAKTLSNVSNTMNKLEQEKAKKVEAQKEIVELTDAS 394

Query: 271 EDMIDQ-VSKKLSSIEASLKIKN------ATDLQQAKL--RESEISQKLTNVNVKIKDVQ 321
           E + ++ VS   ++ E+  K++       + + +Q  L  + S+  + L  V   IK  +
Sbjct: 395 EQLANRLVSMNNTNKESLAKMRQLERELVSNEEKQKSLLQKRSKAEKTLNTVEKSIKQCE 454

Query: 322 QQIESNEEQRNLDSATLKEIKSIIEQRKQKLSK----ILPRYQELTKEEAMYKLQLAS-- 375
            +IE    Q      +L  +   I   + +L K    +  +  ++TKE A+ + +L    
Sbjct: 455 NKIEEYISQNQEYETSLTTLNHTIVDAQAELEKMKLALSDKTGDITKEVAVLEKELEPWT 514

Query: 376 --LQQKQRDLILKKGEYARFKSKD----ERDTWIHSEIEELKSSIQNLNELESQLQMDRT 429
             +++K+ ++ L + E +  K  D         +  EIE+L+ +I +  E    L ++ +
Sbjct: 515 NKVEEKKSEIKLVESEISIIKEADLKLESEIANLSQEIEQLRGNISHREESIETLNVESS 574

Query: 430 SLRKQYSAXXXXXXXXXXXXNGPDTKGQLEDFDSELIHLKQKLSESLDTRKELWRKEQKL 489
           S+R                      + +LE+    L+  +Q+++   D R  +   E   
Sbjct: 575 SIRDYILVGERECT---------SARSKLEEMKKVLVTHRQRVN---DARSAVSSAE--- 619

Query: 490 QTVLETLLSDVNQNQRNVNETMSRSLANGIINVKEITEKLKISPESVFGTLGELIKVNDK 549
                        N+  V   +SR   +G I+                G LG+L  ++DK
Sbjct: 620 -------------NKNKVLTALSRLQKSGRID-------------GYHGRLGDLGTIDDK 653

Query: 550 YKTCAEVIGGNSLFHIVVDTEETATLIMNELYRMKGGRVTFIPLNRLSLDSDVKF---PS 606
           Y   A       L  IVVDT E     +  L + K G   FI L++L      KF   P+
Sbjct: 654 YD-IAISTACPRLDDIVVDTVECGQQCIEHLRKNKLGYARFILLDKLR-----KFNLQPA 707

Query: 607 NTTTQI-QFTPLIKKIKYEPRFEKAVKHVFGKTIVVKDLGQGLKLA-KKHKLNAITLDGD 664
           +T   + +   L+K    EP+F  A   V   T+V  DL Q  ++A  K +   +TLDG 
Sbjct: 708 HTPENVPRLFDLVKP--KEPKFAPAFYSVLRDTLVTTDLSQANRVAYGKKRYRVVTLDGK 765

Query: 665 RADKRGVLTGG 675
             D  G +TGG
Sbjct: 766 LIDISGTMTGG 776

 Score = 74.3 bits (181), Expect = 4e-13,   Method: Compositional matrix adjust.
 Identities = 34/83 (40%), Positives = 54/83 (65%), Gaps = 1/83 (1%)

Query: 1122 HVEQLSGGQKTVCAIALILAIQMVDPASFYLFDEIDAALDKQYRTAVATLLKELSKNAQF 1181
            ++  LSGG+KT+ ++AL+ A+    P   Y+ DEIDAALD +  + VA  +KE +KNAQF
Sbjct: 1271 NISNLSGGEKTLSSLALVFALHKYKPTPLYVMDEIDAALDFRNVSIVANYIKERTKNAQF 1330

Query: 1182 ICTTFRTDMLQVADKFFRVKYEN 1204
            I  + R +M ++A +   + Y+N
Sbjct: 1331 IVISLRNNMFELAQRLVGI-YKN 1352

>Scas_565.6
          Length = 1170

 Score =  101 bits (251), Expect = 3e-21,   Method: Compositional matrix adjust.
 Identities = 64/193 (33%), Positives = 99/193 (51%), Gaps = 3/193 (1%)

Query: 1   MYIKRVIIKGFKTYRNETIIDNFSPHQNVIIGSNGSGKSNFFAAIRFVLSDDYSNLKREE 60
           M ++ +II GFK+Y   T+I ++ P  N I G NGSGKSN   AI FVL      + R  
Sbjct: 1   MKVEELIIDGFKSYATRTVIADWDPQFNAITGLNGSGKSNILDAICFVLGISSMTIVRAS 60

Query: 61  R-QGLIHQGSGGSVMSASVEIVFHDPDHSMILPSGVLSRGDDEVTIRRTVGLKKDDYQLN 119
             Q LI++     V  ASV IVF + D +   P G  +     VT R+ +      Y +N
Sbjct: 61  NLQDLIYKRGQAGVTKASVTIVFDNSDKTNS-PIGFNNSSKISVT-RQIILGGTSKYLIN 118

Query: 120 DRNVTKGDIVRMLETAGFSMNNPYNIVPQGKIVALTNAKDKERLQLLEDVVGAKSFEVKL 179
                +  ++++ ++   ++NNP  ++ QGKI  + N K  E L L+E+  G K FE + 
Sbjct: 119 GHRAPQQSVLQLFQSVQLNINNPNFLIMQGKITKVLNMKPNEILSLIEEAAGTKMFENRR 178

Query: 180 KASLKKMEETEQK 192
           + + + M + E K
Sbjct: 179 EKAERTMAKKETK 191

 Score = 92.4 bits (228), Expect = 1e-18,   Method: Compositional matrix adjust.
 Identities = 81/314 (25%), Positives = 147/314 (46%), Gaps = 42/314 (13%)

Query: 896  REIESLIAEETNNKKLLEKANNQQRLLLKKLDNFQKSVEKTMIKKTTLVTXXXXXXXXXX 955
            RE+E+LI E+  NK   E    +Q+ L  +LD  + +      + + L+T          
Sbjct: 892  RELENLIKEKNENKANWEL---EQQRLTHELDKNKSNTNSLQKRISDLLTEQEWLRDNDL 948

Query: 956  XXGLLPEDALVN--DFSDITSDQLLQRLNDMNTEISGLKNVNKRAFENFKKFNERRKDLA 1013
              G++ E+  VN  ++ +   +QL ++ ++M       + +N       +   ++   L 
Sbjct: 949  VEGIIQENRGVNLAEYRE-RGNQLEEKFHEMR------RKINPNIMSMIENVEKKESALK 1001

Query: 1014 ERASELDESKDSIQDLIVKLKQQKVNAVDSTFQKVSENFEAVFERLVPRGTAKLIIHRKN 1073
                 +++ K  IQ+ I KL + K + +  T++KV+E+F  +F  L+P   AKL+     
Sbjct: 1002 VMIRTIEKDKVKIQETISKLNEYKRDTLIKTWEKVTEDFGHIFADLLPNSFAKLV----- 1056

Query: 1074 DNANDHDESIDVDMDAESNESQNGKDSEIMYTGVSISVSFNSKQNEQLHVEQLSGGQKTV 1133
                                   GKD   +  G+ + V   +   + L VE LSGGQ+++
Sbjct: 1057 --------------------PSEGKD---VTEGLEVRVKLGNLWKDSL-VE-LSGGQRSL 1091

Query: 1134 CAIALILAIQMVDPASFYLFDEIDAALDKQYRTAVATLLKELSKNAQFICTTFRTDMLQV 1193
             A++LI+A+    PA  Y+ DE+DAALD  +   +  L+K   K +QFI  + +  M   
Sbjct: 1092 VALSLIMALLQFRPAPMYILDEVDAALDLSHTQNIGHLIKTRFKGSQFIVVSLKEGMFSN 1151

Query: 1194 ADKFFRVKYENKIS 1207
            A++ FR +++N  S
Sbjct: 1152 ANRVFRTRFQNGTS 1165

>YFR031C (SMC2) [1711] chr6 complement(216582..220094) Subunit of
            condensin protein complex required for chromosome
            condensation and segregation, coiled-coil protein of the
            SMC family [3513 bp, 1170 aa]
          Length = 1170

 Score = 84.7 bits (208), Expect = 3e-16,   Method: Compositional matrix adjust.
 Identities = 54/189 (28%), Positives = 93/189 (49%), Gaps = 30/189 (15%)

Query: 1019 LDESKDSIQDLIVKLKQQKVNAVDSTFQKVSENFEAVFERLVPRGTAKLIIHRKNDNAND 1078
            +++ K  IQ+ I KL + K   +  T++KV+ +F  +F  L+P   AKL+          
Sbjct: 1007 IEKDKMKIQETISKLNEYKRETLVKTWEKVTLDFGNIFADLLPNSFAKLV---------- 1056

Query: 1079 HDESIDVDMDAESNESQNGKDSEIMYTGVSISVSFNSKQNEQLHVEQLSGGQKTVCAIAL 1138
                              GKD   +  G+ + V   +   E L   +LSGGQ+++ A++L
Sbjct: 1057 ---------------PCEGKD---VTQGLEVKVKLGNIWKESLI--ELSGGQRSLIALSL 1096

Query: 1139 ILAIQMVDPASFYLFDEIDAALDKQYRTAVATLLKELSKNAQFICTTFRTDMLQVADKFF 1198
            I+A+    PA  Y+ DE+DAALD  +   +  L+K   K +QFI  + +  M   A++ F
Sbjct: 1097 IMALLQFRPAPMYILDEVDAALDLSHTQNIGHLIKTRFKGSQFIVVSLKEGMFANANRVF 1156

Query: 1199 RVKYENKIS 1207
            R ++++  S
Sbjct: 1157 RTRFQDGTS 1165

>CAGL0F02079g 201002..204673 similar to sp|P32908 Saccharomyces
           cerevisiae YFL008w SMC1 chromosome segregation protein,
           start by similarity
          Length = 1223

 Score = 83.2 bits (204), Expect = 1e-15,   Method: Compositional matrix adjust.
 Identities = 169/713 (23%), Positives = 308/713 (43%), Gaps = 106/713 (14%)

Query: 11  FKTYRNETIIDNFSPHQNVIIGSNGSGKSNFFAAIRFVLSDDYSNLKREERQGLIHQ--- 67
           FK+Y+    +D    +   IIG NGSGKSN   AI FVL    S+L+    + LI++   
Sbjct: 12  FKSYKGTVNVDFGDSNFTSIIGPNGSGKSNLMDAISFVLGIRSSSLRSSALKDLIYRDII 71

Query: 68  -----GSGG-----SVMSASVEIVFHDPDHSMILPSGVLSRGDDEVTIRRTVGLKKDDYQ 117
                 +G         +A V+  F++ D  ++    ++SR            L    Y+
Sbjct: 72  SRENTPTGADNDENGNRTAYVK-AFYEYDGKVVELMRLISR------------LGDTSYK 118

Query: 118 LNDRNVTKGDIVRMLETAGFSMNNPYNIVPQGKIVALTNAKDKERLQLLEDVVGA----K 173
           L+   VT  +  + LE+    +     +V QG +  + +       +L+E+V G+    K
Sbjct: 119 LDGNTVTYKEYSQFLESQNILIKAKNFLVFQGDVEQIASQSPLGLTKLIEEVSGSMQYKK 178

Query: 174 SFEVKLKASLKKM----EETEQKKIQINKEMGELNSKLSEMEQERKELEKYNELERNRKI 229
            +E +LK    K+     E+ +K+ +I+ E+      +S  E+ RK ++K   ++ N  +
Sbjct: 179 EYE-ELKDQYDKICQASTESIKKRRRIHAELKTYKEGMSRDEEYRKYVQKKKRVQTNLSL 237

Query: 230 YQFTLYDRELNEVINQMERLDGDYNNTVYSSEQYIQELDKREDMIDQVSKKLSSIEASL- 288
           +Q    + E  + + ++E    D +         I+E  + E+   +V KK  S EA L 
Sbjct: 238 WQLYHMEDERYQCLQKLEESQNDVD--------VIREKLEAEEKNLEVFKKALSKEAVLL 289

Query: 289 -------------KIKNATDLQQAKLRESEISQKLTNVNVKIKDVQQQIESNEEQRNLDS 335
                        K K  +DL+  K+ ++    +L N++ ++  +Q+ +E   E+ NL+ 
Sbjct: 290 TKKKNHIRSISKEKEKAESDLKVVKIPQNASINRLKNLDKRVDSLQKDLE--REEANLEK 347

Query: 336 ATLKEIKSIIEQRKQKLSKILPRYQELTKEEAMYKLQLASLQQKQRDLILKKGEYARFKS 395
               ++K + + +     +I      L+K +   K  L+    K  D +  KGEY     
Sbjct: 348 YK-HQLKVVTDSKNAFEQEI------LSKSKNNNKFTLSEDDLKLYDEL--KGEYLNNGG 398

Query: 396 KDERDT--WIHSEIEELKSSIQNLNELESQLQMDRTSLRKQYSAXXXXXXXXXXXXNGPD 453
            +  DT   + ++ EE+ + ++ +N        D+  + KQ                  D
Sbjct: 399 IEIEDTLNLLDNKKEEITADLKIIN--------DKVEISKQRIEDELVTKKEEQDAKIRD 450

Query: 454 TKGQLEDFDSELIHLKQKLSESLDTRK--ELWRKEQ-----KLQTVLETLLSDVNQNQRN 506
           +   L + +    H   KL E   T+K  E W  ++     KL+  L   L D+N  QR 
Sbjct: 451 STLLLNEKNDLHSH---KLDELRKTQKDIEYWNNKEFDLNHKLRDTL-VKLDDLNATQRE 506

Query: 507 VNETMSRSLANGIINVKEITEKLKISPESVFGTLGELIKV-NDKYKTCAEVIGGNSLFHI 565
            N+   R L   +  +K      +  P  V G + EL K   DKYK     + G +   +
Sbjct: 507 SNK--ERKLRENVAMLK------RFFP-GVRGLVHELCKPKRDKYKLAVSTVLGKNFDSV 557

Query: 566 VVDTEETATLIMNELYRMKGGRVTFIPLNRLSLDSD-VKFPSNTTTQIQFTPLIKKIKYE 624
           +VD+   A   ++ L + + G ++FIPL+ +   +  +  P + T    +T  I  ++Y+
Sbjct: 558 IVDSLSVAQECISFLKKQRAGVISFIPLDTIDAATPRMPVPESET----YTLAINTVEYK 613

Query: 625 PRFEKAVKHVFGKTIVVK--DLGQGLKLAKKHKLNAITLDGDRADKRGVLTGG 675
               +A+ +V   TI+    D+ + LK  K   +  +TLDG   +K G++TGG
Sbjct: 614 DDLVRAMYYVCSDTIICDNLDIARDLKWNKNANVKIVTLDGALINKTGLMTGG 666

 Score = 72.8 bits (177), Expect = 1e-12,   Method: Compositional matrix adjust.
 Identities = 61/241 (25%), Positives = 107/241 (44%), Gaps = 48/241 (19%)

Query: 983  DMNTEISGLKNV------NKRAFENFKKFNERRKDLAERASELDESKDSIQDLIVKLKQQ 1036
            D+N +I  + +V      N RA E F     R  ++ +    L   +  + D  +K+KQ+
Sbjct: 998  DLNNQIRDIDDVLEELQPNARAVERFDDAKSRFDEVDKETEGLKTEERKVFDEFLKVKQK 1057

Query: 1037 KVNAVDSTFQKVSENFEAVFERL---------VPRGTAKLIIHRKNDNANDHDESIDVDM 1087
            +    ++ F+K++E+ +A++  L         +  G+A + I        D DE  +   
Sbjct: 1058 RKELFENAFEKINEHLDAIYSELTRNVNSTSILGGGSASMTIE-------DEDEPFN--- 1107

Query: 1088 DAESNESQNGKDSEIMYTGVSISVSFNSKQNEQLHVEQLSGGQKTVCAIALILAIQMVDP 1147
                        + I Y        F         +E LSGG+KTV A+AL+ AI   +P
Sbjct: 1108 ------------AGIRYHATPPMKRFKD-------MEYLSGGEKTVAALALLFAINSYNP 1148

Query: 1148 ASFYLFDEIDAALD-KQYRTAVATLLKELSKNAQFICTTFRTDMLQVADKF---FRVKYE 1203
            + F++ DE+DAALD    +   A + +  + + QFI  + +  M + +D     FR + E
Sbjct: 1149 SPFFILDEVDAALDISNVQRIAAYIRRHGNPDLQFIVISLKNTMFEKSDALVGVFRQQQE 1208

Query: 1204 N 1204
            N
Sbjct: 1209 N 1209

>CAGL0L12188g 1308672..1312868 similar to tr|Q12267 Saccharomyces
            cerevisiae YLR086w Stable Maintenance of Chromosomes,
            start by similarity
          Length = 1398

 Score = 82.0 bits (201), Expect = 2e-15,   Method: Compositional matrix adjust.
 Identities = 59/204 (28%), Positives = 103/204 (50%), Gaps = 34/204 (16%)

Query: 1002 FKKFNERRKDLAERASELDESKDSIQDLIVKLKQQKVNAVDSTFQKVSENFEAVFERLVP 1061
            F +FN+R+ DL        +S+DS++D +  +K+++ +     F+ +S   + +++ +  
Sbjct: 1212 FVEFNKRKNDLNSAV----QSRDSVKDRLEGIKRKRYDEFMEGFKIISMTLKEMYQMITL 1267

Query: 1062 RGTAKLIIHRKNDNANDHDESIDVDMDAESNESQNGKDSEIMYTGVSISVSFNSKQNEQL 1121
             G A+L             E +D  +D  S              GV+ SV    K     
Sbjct: 1268 GGNAEL-------------ELVD-SLDPFSE-------------GVTFSVMPPKKS--WR 1298

Query: 1122 HVEQLSGGQKTVCAIALILAIQMVDPASFYLFDEIDAALDKQYRTAVATLLKELSKNAQF 1181
            ++  LSGG+KT+ ++AL+ A+    P   Y+ DEIDAALD +  + VA  +KE +KNAQF
Sbjct: 1299 NISNLSGGEKTLSSLALVFALHKYKPTPLYVMDEIDAALDFRNVSIVANYIKERTKNAQF 1358

Query: 1182 ICTTFRTDMLQVADKFFRV-KYEN 1204
            I  + R +M ++  +   + K+EN
Sbjct: 1359 IVISLRNNMFELTKQLVGIYKHEN 1382

 Score = 70.9 bits (172), Expect = 6e-12,   Method: Compositional matrix adjust.
 Identities = 98/397 (24%), Positives = 184/397 (46%), Gaps = 87/397 (21%)

Query: 1   MYIKRVIIKGFKTYRNETIIDNFSPHQNVIIGSNGSGKSNFFAAIRFVLSDDYSNLKREE 60
           ++I ++++  FK+Y    +I  F    + I+G NGSGKSN   ++ FV     + ++++ 
Sbjct: 128 LFIHQLVLNDFKSYAGRQVIGPFHTSFSAIVGPNGSGKSNVIDSMLFVFGFRANKMRQDR 187

Query: 61  RQGLIHQG-SGGSVMSASVEIVFHDPDHSMILPSGVLSRGDDEVTIRRTVG--------L 111
              LIH+  +   + S SVE+ F            V+ + D   TI  T G         
Sbjct: 188 LSDLIHKSETFPDLKSCSVEVHFK----------YVIDKDDGSTTIDETKGNLVVTRKAF 237

Query: 112 KKD--DYQLNDRNVTKGDIVRMLETAGFSMNNPYNIVPQGKI--VALTNAK-----DKER 162
           K +   Y +N +     ++  +L+  G  +++   ++ QG++  +A   AK     D   
Sbjct: 238 KNNASKYFVNGKESNYTEVTTLLKKEGIDLDHKRFLILQGEVENIAQMKAKAEKENDDGL 297

Query: 163 LQLLEDVVGAKSFEVKLKASLKK--MEETEQKKIQINKEMGELNSKLSEMEQERKELEKY 220
           L+ LED++G      K K S++K  ME     +I + KE     ++ S +E+E+  LE  
Sbjct: 298 LEYLEDIIGTS----KYKESIEKLSMEIESLNEICVEKE-----NRFSIVEREKNSLESG 348

Query: 221 NE-------------LERNRKIYQFTLY--DRELNEVINQMERLDGDYNNTVYSSEQYIQ 265
            E             LE++ K+YQ+ L   +++L++V+N+   +               Q
Sbjct: 349 KEEALQFLNKEKELVLEKS-KLYQYNLMQDNKKLDDVLNKKTNVQ--------------Q 393

Query: 266 ELDKREDMIDQVSKKLSSIEASLKIKNATDLQQAKLRESEIS--------------QKLT 311
           E  K+ED   + +  +S I ASL +  A DL++    E  +S              Q + 
Sbjct: 394 EQTKQEDEFRKANSHISDITASLNVLKA-DLEKVHTEEVNLSKTKRTLENKKVENEQIVN 452

Query: 312 NVNVKIKDVQQQIESNEEQRNLDSATLKEIKSIIEQR 348
           N++ K K+ ++Q +  +++ N   +T +EI++IIE++
Sbjct: 453 NLDSKRKEFEEQSKILQDKIN---STDQEIQTIIEEQ 486

>Scas_681.4
          Length = 1409

 Score = 76.6 bits (187), Expect = 1e-13,   Method: Compositional matrix adjust.
 Identities = 40/101 (39%), Positives = 61/101 (60%), Gaps = 3/101 (2%)

Query: 1106 GVSISVSFNSKQNEQLHVEQLSGGQKTVCAIALILAIQMVDPASFYLFDEIDAALDKQYR 1165
            GV+ SV    K     ++  LSGG+KT+ ++AL+ A+    P   Y+ DEIDAALD +  
Sbjct: 1292 GVTFSVMPPKKS--WRNISNLSGGEKTLSSLALVFALHKYKPTPLYVMDEIDAALDFRNV 1349

Query: 1166 TAVATLLKELSKNAQFICTTFRTDMLQVADKFFRV-KYENK 1205
            + VA  +KE +KNAQFI  + R +M ++A +   + K EN+
Sbjct: 1350 SIVANYIKERTKNAQFIVISLRNNMFELAQQLVGIYKCENR 1390

 Score = 65.1 bits (157), Expect = 4e-10,   Method: Compositional matrix adjust.
 Identities = 84/404 (20%), Positives = 181/404 (44%), Gaps = 57/404 (14%)

Query: 1   MYIKRVIIKGFKTYRNETIIDNFSPHQNVIIGSNGSGKSNFFAAIRFVLSDDYSNLKREE 60
           ++I ++ +  FK+Y  + ++  F    + ++G NGSGKSN   ++ FV     + ++++ 
Sbjct: 149 LFINKLTLNNFKSYAGQQVVGPFHTSFSAVVGPNGSGKSNVIDSMLFVFGFRANKMRQDR 208

Query: 61  RQGLIHQGSG-GSVMSASVEIVF------HDPDH--SMILPSGVLSRGDDEVTIRRTVGL 111
              LIH+      + S SV++ F      HD D   S   P  V+S        R+    
Sbjct: 209 LSDLIHKSEKFPDLTSCSVDVEFLYAIDEHDGDTKISETKPKLVIS--------RKAFKN 260

Query: 112 KKDDYQLNDRNVTKGDIVRMLETAGFSMNNPYNIVPQGKIVALTNAKDKER-------LQ 164
               Y +N +     D+ ++L+  G  +++   ++ QG++  +   K K         L+
Sbjct: 261 NSSKYYINGKESNYTDVTKLLKEEGIDLDHKRFLILQGEVENIAQMKPKAEKESDDGLLE 320

Query: 165 LLEDVVGAKSFEVKLKASLKKMEETEQKKIQ-------INKEMGELNSKLSEMEQERKEL 217
            LED++G   ++  ++  L ++E   +  I+       +++E   L S    +  E  E 
Sbjct: 321 YLEDIIGTSKYKQLIEKDLIEIESLNEICIEKENRFEIVDREKNSLESG-KNLALEFLEK 379

Query: 218 EKYNELERNRKIYQFTLY--DRELNEVINQMERLDGDYNNTVYSSEQYIQELDKREDMID 275
           EK   L ++ K+ Q+ L+  + +L   + ++  L+ +YN     ++    E+++ + +++
Sbjct: 380 EKQLTLSKS-KLLQYNLWQNNSKLTNTLQKISALNEEYNVEKSKNQTLQNEINRTKQLLN 438

Query: 276 QVSKKLSSIEASLKIKNATDLQQAKLRESEISQKLTNVNVKIKDVQQQIESNEEQRNLDS 335
           +   K+  +E   K      L+  ++ E E      +++ K+K++ Q+    E+      
Sbjct: 439 ESQSKIKVLEGEEK----QQLKSKRILEGE----HVSLDEKLKNLTQKKAKTEK------ 484

Query: 336 ATLKEIKSIIEQRKQKLSKILPRYQELTKEEAMYKLQLASLQQK 379
                   II   ++ +S +    QEL K +  Y  +L +L Q+
Sbjct: 485 --------IIATTEKTISSLTSEIQELEKSQKEYSDELETLNQQ 520

>Kwal_56.23825
          Length = 1396

 Score = 75.9 bits (185), Expect = 2e-13,   Method: Compositional matrix adjust.
 Identities = 36/84 (42%), Positives = 55/84 (65%), Gaps = 1/84 (1%)

Query: 1122 HVEQLSGGQKTVCAIALILAIQMVDPASFYLFDEIDAALDKQYRTAVATLLKELSKNAQF 1181
            ++  LSGG+KT+ ++AL+ A+    P   Y+ DEIDAALD +  + VA  +KE +KNAQF
Sbjct: 1297 NITNLSGGEKTLSSLALVFALHKYKPTPLYVMDEIDAALDFRNVSIVANYIKERTKNAQF 1356

Query: 1182 ICTTFRTDMLQVADKFFRVKYENK 1205
            I  + R +M ++A +   V Y+NK
Sbjct: 1357 IVISLRNNMFELAKQLVGV-YKNK 1379

 Score = 55.1 bits (131), Expect = 4e-07,   Method: Compositional matrix adjust.
 Identities = 46/142 (32%), Positives = 67/142 (47%), Gaps = 11/142 (7%)

Query: 538 GTLGELIKVNDKYKTCAEVIGGNSLFHIVVDTEETATLIMNELYRMKGGRVTFIPLNRL- 596
           G LG+L  ++DKY           L  IVV+T E     +  L + K G   FI L++L 
Sbjct: 663 GRLGDLGTIDDKYDVAIST-ACPRLDDIVVETVECGQQCIEYLRKNKLGYARFILLDKLR 721

Query: 597 --SLDSDVKFPSNTTTQIQFTPLIKKIKYEPRFEKAVKHVFGKTIVVKDLGQGLKLA-KK 653
             +L S +K P N     +   L++     P+F  A   V   T+V KDL +  K+A  K
Sbjct: 722 NFNL-SPIKTPENVP---RLYDLVRP--NNPKFRNAFYSVLRDTLVAKDLKEANKVAYGK 775

Query: 654 HKLNAITLDGDRADKRGVLTGG 675
            +   +TLDG   D  G ++GG
Sbjct: 776 QRYRVVTLDGKLIDLSGTMSGG 797

>YLR086W (SMC4) [3501] chr12 (302244..306500) Subunit of condensin
            protein complex required for proper chromosome
            condensation and segregation, coiled-coil protein of the
            SMC family [4257 bp, 1418 aa]
          Length = 1418

 Score = 75.1 bits (183), Expect = 3e-13,   Method: Compositional matrix adjust.
 Identities = 38/95 (40%), Positives = 57/95 (60%), Gaps = 2/95 (2%)

Query: 1106 GVSISVSFNSKQNEQLHVEQLSGGQKTVCAIALILAIQMVDPASFYLFDEIDAALDKQYR 1165
            GV+ SV    K     ++  LSGG+KT+ ++AL+ A+    P   Y+ DEIDAALD +  
Sbjct: 1305 GVTFSVMPPKKS--WRNITNLSGGEKTLSSLALVFALHKYKPTPLYVMDEIDAALDFRNV 1362

Query: 1166 TAVATLLKELSKNAQFICTTFRTDMLQVADKFFRV 1200
            + VA  +KE +KNAQFI  + R +M ++A +   V
Sbjct: 1363 SIVANYIKERTKNAQFIVISLRNNMFELAQQLVGV 1397

 Score = 70.1 bits (170), Expect = 1e-11,   Method: Compositional matrix adjust.
 Identities = 44/199 (22%), Positives = 99/199 (49%), Gaps = 16/199 (8%)

Query: 1   MYIKRVIIKGFKTYRNETIIDNFSPHQNVIIGSNGSGKSNFFAAIRFVLSDDYSNLKREE 60
           ++I  ++++ FK+Y  + ++  F    + ++G NGSGKSN   ++ FV     + ++++ 
Sbjct: 154 LFINELVLENFKSYAGKQVVGPFHTSFSAVVGPNGSGKSNVIDSMLFVFGFRANKMRQDR 213

Query: 61  RQGLIHQGSG-GSVMSASVEIVFHDPDHSMILPSGVLSRGDDE----VTIRRTVGLKKDD 115
              LIH+     S+ S SV + F      +I  S   SR D+E    +  R+        
Sbjct: 214 LSDLIHKSEAFPSLQSCSVAVHF----QYVIDESSGTSRIDEEKPGLIITRKAFKNNSSK 269

Query: 116 YQLNDRNVTKGDIVRMLETAGFSMNNPYNIVPQGKIVALTNAKDKER-------LQLLED 168
           Y +N++  +  ++ ++L+  G  +++   ++ QG++  +   K K         L+ LED
Sbjct: 270 YYINEKESSYTEVTKLLKNEGIDLDHKRFLILQGEVENIAQMKPKAEKESDDGLLEYLED 329

Query: 169 VVGAKSFEVKLKASLKKME 187
           ++G  +++  ++  + ++E
Sbjct: 330 IIGTANYKPLIEERMGQIE 348

>KLLA0F19085g 1758111..1762229 similar to sgd|S0004081 Saccharomyces
            cerevisiae YLR086w SMC4 Stable Maintenance of
            Chromosomes, start by similarity
          Length = 1372

 Score = 73.2 bits (178), Expect = 1e-12,   Method: Compositional matrix adjust.
 Identities = 34/82 (41%), Positives = 52/82 (63%), Gaps = 1/82 (1%)

Query: 1123 VEQLSGGQKTVCAIALILAIQMVDPASFYLFDEIDAALDKQYRTAVATLLKELSKNAQFI 1182
            +  LSGG+KT+ ++AL+ A+    P   Y+ DEIDAALD +  + VA  +KE +KNAQFI
Sbjct: 1274 ISNLSGGEKTLSSLALVFALHKYKPTPLYVMDEIDAALDFRNVSIVANYIKERTKNAQFI 1333

Query: 1183 CTTFRTDMLQVADKFFRVKYEN 1204
              + R +M ++A     + Y+N
Sbjct: 1334 VISLRNNMFELAQNLVGI-YKN 1354

 Score = 44.3 bits (103), Expect = 7e-04,   Method: Compositional matrix adjust.
 Identities = 64/285 (22%), Positives = 124/285 (43%), Gaps = 40/285 (14%)

Query: 538 GTLGELIKVNDKYKTCAEVIGGNSLFHIVVDTEETATLIMNELYRMKGGRVTFIPLNRL- 596
           G LG+L  ++D+Y   A       L  IVV+T E     ++ L + K G   FI L++L 
Sbjct: 659 GRLGDLGTIDDQYDI-AISTACPRLDDIVVETVECGQQCIDHLRKNKLGYGRFILLDKLR 717

Query: 597 --SLDSDVKFPSNTTTQIQFTPLIKKIKYEPRFEKAVKHVFGKTIVVKDLGQGLKLA-KK 653
             +LD  +  P N          ++ +     F  A   V   T+V +DL Q  ++A  K
Sbjct: 718 KCNLDR-IATPENVPRLFDLITPVRDL-----FRPAFYSVLRDTLVARDLQQANRVAYGK 771

Query: 654 HKLNAITLDGDRAD----------------KRGVLTGGYLDQHKRTRLESLK-NLNESRS 696
            +   +TLDG   D                 R   T     Q+ R  +E ++  L+   +
Sbjct: 772 RRFRVVTLDGKLIDISGTMSGGGSSPQSGLMRSKATTA--SQYSRDEVEKMEVQLSTKET 829

Query: 697 QHKKILEELDFVRNELNDIDTKIDQVNGNIRKVSNDRESVLTNIEVYRTSLN-------- 748
            ++  L  +  + + L  +  ++ +++  I K+  ++ S +  +E Y   L+        
Sbjct: 830 NYRSALSMVHEMESALQKLTDRLPEIDIQISKIQLEKGSRVAEVESYHQRLSQLARELSM 889

Query: 749 TKKNEKLILEESLNAIILK--LEKLNTNRTFAQEKLNTFENDLLQ 791
            +KN++ +L+E     IL+  L++      F+Q+K++  ++ ++Q
Sbjct: 890 NEKNQQPLLDEEKKLDILRQHLQQTIDASKFSQDKIDDLKDRIMQ 934

>AGL023W [4288] [Homologous to ScYFL008W (SMC1) - SH]
            complement(670883..674551) [3669 bp, 1222 aa]
          Length = 1222

 Score = 72.8 bits (177), Expect = 1e-12,   Method: Compositional matrix adjust.
 Identities = 54/216 (25%), Positives = 100/216 (46%), Gaps = 28/216 (12%)

Query: 995  NKRAFENFKKFNERRKDLAERASELDESKDSIQDLIVKLKQQKVNAVDSTFQKVSENFEA 1054
            N +A E F +  ++   ++  + +L ES+   ++L +K+K++++N   + F  V +N + 
Sbjct: 1013 NSKAVERFDEARDQFNAVSGESDKLKESERKAKELYLKIKEKRINTFLACFNHVRDNIDR 1072

Query: 1055 VFERLV--PRGTAKLIIHRKNDNANDHDESIDVDMDAESNESQNGKDSEIMYTGVSISVS 1112
            ++  L   P  TA+L     +    D DE                      Y G  I   
Sbjct: 1073 IYRELTRNPGSTAELAGGSASLTLEDEDEP---------------------YLG-GIRYH 1110

Query: 1113 FNSKQNEQLHVEQLSGGQKTVCAIALILAIQMVDPASFYLFDEIDAALDKQYRTAVATLL 1172
                      ++ LSGG+KT+ A+AL+ AI    P+ F++ DE+DAALD      +A  +
Sbjct: 1111 ATPPMKRFKDMDYLSGGEKTMAALALLFAINSYQPSPFFILDEVDAALDVTNVERIAAYI 1170

Query: 1173 -KELSKNAQFICTTFRTDMLQVADKF---FRVKYEN 1204
             +  S   QFI  + ++++   ++     FR ++EN
Sbjct: 1171 RRHASPKMQFIVISLKSNLFSKSESMAGVFRNQHEN 1206

 Score = 57.0 bits (136), Expect = 9e-08,   Method: Compositional matrix adjust.
 Identities = 99/439 (22%), Positives = 185/439 (42%), Gaps = 57/439 (12%)

Query: 488 KLQTVLETLLSDVNQNQRNVNETMSRSLANGIINVKEITEKLKISPESVFGTLGELIKVN 547
           KL+ VL  L  D++ NQR  N+   R L   +  ++      ++ P  V G + +L +  
Sbjct: 487 KLREVLAKL-DDLSANQRETNK--ERKLRENVATLR------RLFP-GVRGLVHDLCRPK 536

Query: 548 -DKYKTCAEVIGGNSLFHIVVDTEETATLIMNELYRMKGGRVTFIPLNRLSLDSDVKFPS 606
            +KY      I G +   ++VD+   A   ++ L + + G  +FIPL+ +   S    P+
Sbjct: 537 KEKYAVGVSTILGKNFDSVIVDSLSVAQQCISYLKKHRSGVASFIPLDTIDTSSPT-LPA 595

Query: 607 NTTTQIQFTPLIKKIKYEPRFEKAVKHVFGKTIVVK--DLGQGLKLAKKHKLNAITLDGD 664
              T    T  +  I+YE   EKA+++V   +I+    D+ + LK  +  K   +TL+G 
Sbjct: 596 GDNTGCILT--LDAIEYESSLEKAMQYVCSDSIICDSLDIARNLKWNRNVKSKLVTLEGA 653

Query: 665 RADKRGVLTGGYLDQHKRTRLESLKNLNESRSQHKKILEELDFVRNELNDIDTKIDQVNG 724
              + G++TGG + ++   R +        + +++ +L   D +  EL+++ T I    G
Sbjct: 654 LIHRAGLMTGG-ITKNNTNRWD--------KEEYQSLLLLKDKISTELSELTTGIR--TG 702

Query: 725 NIRKVSNDRESVLTNIEVYRTSLNTKKNEKLILEESLNAIILKLEKLNTNRTFAQEKLNT 784
           +I+  S D E                 NE  +L   ++++  +L +LN +   A  +LN 
Sbjct: 703 SIK--SRDYE-----------------NEVSLLSTEISSLRSQLNQLNRSMKEALTELN- 742

Query: 785 FENDLLQ-EFDXXXXXXXXXXXXXXXXXISAAHNKLNITSDALEGITTTIDSLNAELE-- 841
           + +DL++ E+                     A +K N+ +   +  +  I     E E  
Sbjct: 743 YHDDLIEKEYSPKVDSLHKMVEEVDGQMADIAKDKANLQASVYKDFSKKIGFDIGEYEQH 802

Query: 842 --SKLIPQENDLESKMSEVGDAFIFGXXXXXXXXXXXXXXXXXXHENAVLELGTVQREIE 899
              +L     +L+    EV                          + A  +L  VQ E++
Sbjct: 803 TGGRLRKHSRELQQLQKEV-----MNIENKLEFETERLESTIKRQQKAREDLKKVQGELD 857

Query: 900 SLIAEETNNKKLLEKANNQ 918
           SL ++ET+ +  LE+  NQ
Sbjct: 858 SLTSQETDIQSNLEQVTNQ 876

 Score = 45.1 bits (105), Expect = 4e-04,   Method: Compositional matrix adjust.
 Identities = 48/177 (27%), Positives = 75/177 (42%), Gaps = 16/177 (9%)

Query: 8   IKGFKTYRNETIIDNFSPHQNVIIGSNGSGKSNFFAAIRFVLSDDYSNLKREERQGLIHQ 67
           +K FK+Y+    +     +   I+G NGSGKSN   AI FVL    S+L+      LI++
Sbjct: 9   VKNFKSYKGVHNVGFGGKNFISIVGPNGSGKSNMMDAISFVLGIRSSHLRSSALVDLIYR 68

Query: 68  G---SGGSVM-----SASVEIVFHDPDHSMILPSGVLSRGDDEVTIRRTVGLKKDDYQLN 119
           G    GGS       SA V   +   D      SG   R +    I  T       Y+L+
Sbjct: 69  GRMEEGGSAHENNPKSAYVTAFYVKQD-----ASGAERRMEFTRVIHNT---GDSTYKLD 120

Query: 120 DRNVTKGDIVRMLETAGFSMNNPYNIVPQGKIVALTNAKDKERLQLLEDVVGAKSFE 176
            + V   + V +LE     +     +V QG +  + +    +  +L E V G+  ++
Sbjct: 121 GKTVGYKEYVDVLEGERILVKARNFLVFQGDVEQIASQSGVDLTKLFEQVSGSVQYQ 177

>Scas_707.23
          Length = 1223

 Score = 63.9 bits (154), Expect = 6e-10,   Method: Compositional matrix adjust.
 Identities = 52/209 (24%), Positives = 90/209 (43%), Gaps = 25/209 (11%)

Query: 995  NKRAFENFKKFNERRKDLAERASELDESKDSIQDLIVKLKQQKVNAVDSTFQKVSENFEA 1054
            N RA E F    ER + + +   +L   +       +K+K+++    ++ F  V+E+ + 
Sbjct: 1016 NARAVERFDDAQERFEVVEKETEDLKAREKKALTQFLKIKKRRRELFENAFDFVNEHLDP 1075

Query: 1055 VFERLV--PRGTAKLIIHRKNDNANDHDESIDVDMDAESNESQNGKDSEIMYTGVSISVS 1112
            ++  L   P  +A L     +    D DE  +                 I Y  +     
Sbjct: 1076 IYRELTRNPNSSALLSGGNASLTLEDEDEPFNAG---------------IKYHAMPPLKR 1120

Query: 1113 FNSKQNEQLHVEQLSGGQKTVCAIALILAIQMVDPASFYLFDEIDAALDKQYRTAVATLL 1172
            F         +E LSGG+KTV A+AL+ AI    P+ F++ DE+DAALD      +A  +
Sbjct: 1121 FKD-------MEYLSGGEKTVAALALLFAINAYQPSPFFVLDEVDAALDITNVERIAAYI 1173

Query: 1173 KEL-SKNAQFICTTFRTDMLQVADKFFRV 1200
            +   + + QFI  + +  M + +D    V
Sbjct: 1174 RRHGNPDLQFIVISLKNTMFEKSDALVGV 1202

 Score = 48.5 bits (114), Expect = 3e-05,   Method: Compositional matrix adjust.
 Identities = 63/242 (26%), Positives = 112/242 (46%), Gaps = 26/242 (10%)

Query: 8   IKGFKTYRNETIIDNFSPHQNVIIGSNGSGKSNFFAAIRFVLSDDYSNLKREERQGLIHQ 67
           +  FK+YR  T I     +   IIG NGSGKSN   AI FVL    S+L+    + LI++
Sbjct: 9   LSNFKSYRGVTKIGFGDSNFTSIIGPNGSGKSNMMDAISFVLGVRSSHLRSNILKDLIYR 68

Query: 68  GSGGSVMSASVEIVFHDP-DHSMILPSGVLSRGDDE-----VTIRRTVGLKKD-DYQLND 120
           G    V+    E    DP D     P+    +   E     V + RT+ +  D  Y++++
Sbjct: 69  G----VIRDFSE---EDPEDGEEQHPTSAYVKAFYEMDGKVVELMRTININGDTTYKIDN 121

Query: 121 RNVTKGDIVRMLETAGFSMNNPYNIVPQGKIVALTNAKDKERLQLLEDVVGAKSFEVK-- 178
           + V+       LE     +     +V QG +  + +    +  +L E++ G+  ++ +  
Sbjct: 122 KTVSYKQYAAFLEKENILIKAKNFLVFQGDVEQIASQSALDLSKLFEEISGSIQYKKEYD 181

Query: 179 -LKASLKKMEETEQKKI----QINKEMGELNSKLSEMEQERKELEKYNELERNRKIYQFT 233
            LK  L+K+ ++  + I    +I+ E+      +S+ E+ +  +EK  + E    +Y FT
Sbjct: 182 SLKDELEKLGKSTTESIRNRRRIHGELKTYKEGISKDEEYKNNVEKKKKYE----MY-FT 236

Query: 234 LY 235
           L+
Sbjct: 237 LW 238

>KLLA0D07502g complement(642751..646482) similar to sp|P32908
            Saccharomyces cerevisiae YFL008w SMC1 chromosome
            segregation protein, start by similarity
          Length = 1243

 Score = 59.3 bits (142), Expect = 2e-08,   Method: Compositional matrix adjust.
 Identities = 28/71 (39%), Positives = 43/71 (60%), Gaps = 1/71 (1%)

Query: 1123 VEQLSGGQKTVCAIALILAIQMVDPASFYLFDEIDAALDKQYRTAVATLLKE-LSKNAQF 1181
            +E LSGG+KT+ A+AL+  I    P+ F++ DE+DAALD      +A  +K   + NAQF
Sbjct: 1143 MEYLSGGEKTMAALALLFTINSYQPSPFFVLDEVDAALDITNVERIAHYIKRNANPNAQF 1202

Query: 1182 ICTTFRTDMLQ 1192
            I  + +  M +
Sbjct: 1203 IVISLKNAMFE 1213

 Score = 45.8 bits (107), Expect = 2e-04,   Method: Compositional matrix adjust.
 Identities = 58/252 (23%), Positives = 103/252 (40%), Gaps = 27/252 (10%)

Query: 8   IKGFKTYRNETIIDNFSPHQNVIIGSNGSGKSNFFAAIRFVLSDDYSNLKREERQGLIHQ 67
           +  FK+Y++   +     +   IIG NGSGKSN   AI FVL    + L+      LI++
Sbjct: 9   LHNFKSYKDTVQVGFGESYFTSIIGPNGSGKSNLMDAISFVLGVRSNQLRSSALVDLIYR 68

Query: 68  G-----------------SGGSVMSASVEIVFHDPDHSMILPSGVLSRGD-DEVT-IRRT 108
           G                 S     +      + + +      S V  + D DE T   RT
Sbjct: 69  GRIENGDPDNGNAKRMHRSDADSEAGPENATYSEEEPRSAYVSCVYQKDDLDEPTKFTRT 128

Query: 109 VGLKKDD-YQLNDRNVTKGDIVRMLETAGFSMNNPYNIVPQGKIVALTNAKDKERLQLLE 167
           +    D  Y++NDR V+       LE+    +     +V QG +  + +   +    LLE
Sbjct: 129 INTSGDSVYKINDRAVSYKKYNEELESENILVKAKNFLVFQGDVERIASQGPESLTLLLE 188

Query: 168 DVVGAKSFE---VKLKA----SLKKMEETEQKKIQINKEMGELNSKLSEMEQERKELEKY 220
            V G+ +++    KLK     +L +  +    + ++  ++      +   EQ R  LE  
Sbjct: 189 QVSGSINYKNDYEKLKEEHKLALAEFTDAHNSRKKVQNDLKSFKEGVQRDEQYRTSLEIR 248

Query: 221 NELERNRKIYQF 232
           ++L+ N  +++ 
Sbjct: 249 DQLKHNFILWEL 260

>Kwal_23.5043
          Length = 1225

 Score = 58.5 bits (140), Expect = 3e-08,   Method: Compositional matrix adjust.
 Identities = 27/71 (38%), Positives = 44/71 (61%), Gaps = 1/71 (1%)

Query: 1123 VEQLSGGQKTVCAIALILAIQMVDPASFYLFDEIDAALDKQYRTAVATLL-KELSKNAQF 1181
            +E LSGG+KT+ A+AL+ AI    P+ F++ DE+DAALD      VA+ + ++   + QF
Sbjct: 1126 MEYLSGGEKTIAALALLFAINSFQPSPFFVLDEVDAALDISNVERVASYIRRKAGADLQF 1185

Query: 1182 ICTTFRTDMLQ 1192
            I  + +  M +
Sbjct: 1186 IVISLKNTMFE 1196

 Score = 52.4 bits (124), Expect = 2e-06,   Method: Compositional matrix adjust.
 Identities = 32/130 (24%), Positives = 62/130 (47%), Gaps = 5/130 (3%)

Query: 548 DKYKTCAEVIGGNSLFHIVVDTEETATLIMNELYRMKGGRVTFIPLNRLSLDSDVKFPSN 607
           +K+      + G +   ++VD    A   ++ L + + G V+FIPL+ + +    K P  
Sbjct: 543 EKFAVAVSTVLGKNFDAVIVDNFLVAQQCVSFLKKQRSGVVSFIPLDTVDVS---KVPMI 599

Query: 608 TTTQIQFTPLIKKIKYEPRFEKAVKHVFGKTIVVKDLGQGLKLAKKHKLNA--ITLDGDR 665
            +        I  I YEP  E+A+++V   +I+   L     L  KH + +  ++++G  
Sbjct: 600 ASEFKGCILAIDAIDYEPDLERAMQYVCSDSIICDTLQIAKDLKWKHNIRSKLVSINGSI 659

Query: 666 ADKRGVLTGG 675
             + G++TGG
Sbjct: 660 VHRAGLMTGG 669

>KLLA0F07997g complement(748561..751920) similar to sgd|S0005394
           Saccharomyces cerevisiae YOL034w, start by similarity
          Length = 1119

 Score = 55.5 bits (132), Expect = 3e-07,   Method: Compositional matrix adjust.
 Identities = 57/222 (25%), Positives = 105/222 (47%), Gaps = 23/222 (10%)

Query: 22  NFSPHQNVIIGSNGSGKSNFFAAIRFVLSDDYSNLKREER-QGLIHQGSGGSVMSASVEI 80
           + SP  N+IIG NGSGKS F  AI   L+     + R ++ +  I  G+   V+  +++ 
Sbjct: 77  HLSPSLNMIIGPNGSGKSTFVCAICLGLAGKPEYIGRSKKVEEYIKNGTDEGVIEITLK- 135

Query: 81  VFHDPDHSMILPS--GVLSRGDDEVTIRRTVGL--KKDDYQLNDRNVTKGDIVRMLETAG 136
                + S +L S   +++  DD V ++R + +  KK  Y +N++ VT+  +  M+    
Sbjct: 136 -----NSSALLHSDFNMINTDDDVVHVKRVLSMEKKKSKYYINNKVVTEEVVKSMVRVLN 190

Query: 137 FSMNNPYNIVPQGKIVALTNAKDKERLQLLEDVVGAKSFEVKLKASLKKME--ETEQKKI 194
             ++N    + Q ++      K      LL + +  +S E  L   L +++  + E  ++
Sbjct: 191 IQLDNLCQFLSQERVEEFARLKPD---TLLNETI--RSIEAGLLEKLSELKSLQAEGNEL 245

Query: 195 QIN-----KEMGELNSKLSEMEQERKELEKYNELERNRKIYQ 231
           QI+      ++ EL S  + +E +   LE Y E  R   I+Q
Sbjct: 246 QIDLGAKENKLKELTSSRAALESQAHALELYEEKARELDIHQ 287

 Score = 35.8 bits (81), Expect = 0.27,   Method: Compositional matrix adjust.
 Identities = 45/209 (21%), Positives = 88/209 (42%), Gaps = 34/209 (16%)

Query: 967  NDFSDITSDQLLQRLNDMNTEISGLKNVNKRAFENFKKFNERRKDLAERASELDESKDSI 1026
            N FS I  + ++ RL+   +E+S + N +    +  KK NE    L +    L     S 
Sbjct: 886  NQFSSIHIESIINRLS---SELSMINN-DTSVIDILKKTNEDISILEKTLPHLRAKLASN 941

Query: 1027 QDLIVKLKQQKVNAVDSTFQKVSENFEAVFERLVPRGTAKLIIHRKNDNANDHDESIDVD 1086
               I++++      +D   +++S+ F  +F  +   G  +L   +K D+ ND        
Sbjct: 942  AQTILEIRNSLEPRLDDIVKQISKKFSHLFAYVGSAGQVEL---KKPDSFND-------- 990

Query: 1087 MDAESNESQNGKDSEIMYTGVSISVSF-NSKQNEQLHVEQLSGGQKTVCAIALILAIQMV 1145
                                + I V F ++ + +QL+    SGG++ V  +  ++A+Q  
Sbjct: 991  ------------------WCIEIKVKFRDNSELQQLNPHVQSGGERAVSTVLYMIALQQF 1032

Query: 1146 DPASFYLFDEIDAALDKQYRTAVATLLKE 1174
              + F + DEI+  +D+     V  ++ E
Sbjct: 1033 TSSPFRVVDEINQGMDQTNERIVHRIMVE 1061

>Scas_643.11
          Length = 1095

 Score = 55.1 bits (131), Expect = 3e-07,   Method: Compositional matrix adjust.
 Identities = 67/272 (24%), Positives = 126/272 (46%), Gaps = 37/272 (13%)

Query: 3   IKRVIIKGFKTYRNETIIDNFSPHQNVIIGSNGSGKSNFFAAIRFVLSDDYSNLKREER- 61
           I ++ ++ F TYR      N SP  N+IIG NGSGKS F  A+   L+     + R +R 
Sbjct: 38  IVKIKLQNFVTYRLTEF--NLSPSLNMIIGPNGSGKSTFVCAVCLGLAGKPEFIGRAKRV 95

Query: 62  QGLIHQGSGGSVMSASVEIV---FHDP---DHSMILPSGVLSRGDDEVT--IRRTVGLKK 113
              I  G   S     +EI    + DP     S+ L   +  +   +VT  I+R     K
Sbjct: 96  DDFIKNGEDTS----RIEIFLKNYEDPTELQSSLNLKFNLAGKDLLKVTRLIQRDGNKCK 151

Query: 114 DDYQLNDRNVTKGDIVRMLETAGFSMNNPYNIVPQGKI------------VALTNAKDKE 161
            DY +ND+ VT+  I  +++     ++N    + Q ++            V    + D +
Sbjct: 152 SDYFINDKPVTENVIKNLVKFLNIQLDNLCQFLSQERVEEFARLKSDKLLVETVRSIDAQ 211

Query: 162 RLQLLEDVVGAKSFEVKLKASLKKMEETEQKKIQINKEMGELNSKLSEMEQERKELEKYN 221
            LQ+L+D+  +++ E  L+  +    + +QK+        EL +  +++E   + L+++ 
Sbjct: 212 LLQILDDLKSSQNDETTLENEV----DIKQKR------FNELETDRNKLEASVRSLKEFE 261

Query: 222 ELERNRKIYQFTLYDRELNEVINQMERLDGDY 253
            ++ + +I++  L   ++ +    ++RL GDY
Sbjct: 262 TMKEDIEIHKKLLPYVKVKDHKENLQRLKGDY 293

 Score = 31.2 bits (69), Expect = 7.0,   Method: Compositional matrix adjust.
 Identities = 31/120 (25%), Positives = 63/120 (52%), Gaps = 12/120 (10%)

Query: 301 LRESEISQKLTNVNVKIKDVQQQIES--NEEQRNLDSATLKEIKSIIEQRKQKLSKILPR 358
           +R+S  + ++ +V+  +K  +    S  ++EQ+N     ++++KS +E+RK KL      
Sbjct: 627 IRQSSYTGQIYSVDSSLKPTRYYQSSIISDEQKNRIEEDVRKLKSQVEERKAKL------ 680

Query: 359 YQELTKEEAMYKLQLASLQQKQRDLILKKGEYARFKSKDERDTWIHSEIEELKSSIQNLN 418
            + L+ E   +K QL+S+ ++   +  K  E    +   ++ + + S IE L+S  Q LN
Sbjct: 681 -ENLSNERGEFKHQLSSIARENERISQKGHELNEVR---KQYSMVKSTIESLESKFQELN 736

>AEL337C [2168] [Homologous to ScYOL034W - SH] (14613..17906) [3294
           bp, 1097 aa]
          Length = 1097

 Score = 55.1 bits (131), Expect = 4e-07,   Method: Compositional matrix adjust.
 Identities = 54/202 (26%), Positives = 100/202 (49%), Gaps = 18/202 (8%)

Query: 22  NFSPHQNVIIGSNGSGKSNFFAAIRFVLSDDYSNLKREER-QGLIHQGSGGSVMSASVEI 80
           + SP  N+IIG NGSGKS F  AI   L+     + R +R +  I  G+  S    ++EI
Sbjct: 63  HMSPSLNMIIGPNGSGKSTFVCAICLGLAGKPEYIGRAKRVEDFIKNGTAES----TIEI 118

Query: 81  VFHDPDHSMILPSGVLSRGDDEVTIRRTVGLK---KDDYQLNDRNVTKGDIVRMLETAGF 137
              +  +   LP  ++S  D+ + + RTV +K   K  Y +N   V++  +  ++     
Sbjct: 119 QLRNSRNVSGLP--MISAEDEAINV-RTVLMKARRKCAYYINGEPVSENQMRALVSMLNI 175

Query: 138 SMNNPYNIVPQGKIVALTNAK-DKERLQLLEDVVGAKSFEVKLKASLKKMEETEQKKIQI 196
            ++N    + Q ++      K DK    LLE  V  +S +  L   L++++ ++Q+++ +
Sbjct: 176 QLDNLCQFLSQERVEEFARLKADK----LLEQTV--RSVDASLLGLLEQLKTSQQEELSL 229

Query: 197 NKEMGELNSKLSEMEQERKELE 218
           N+E+     KL ++   ++ LE
Sbjct: 230 NREVELGQKKLEKLMTHKESLE 251

 Score = 35.0 bits (79), Expect = 0.52,   Method: Compositional matrix adjust.
 Identities = 15/48 (31%), Positives = 26/48 (54%)

Query: 1127 SGGQKTVCAIALILAIQMVDPASFYLFDEIDAALDKQYRTAVATLLKE 1174
            SGG++ V  +  ++A+Q    A F + DEI+  +D +Y   V   + E
Sbjct: 992  SGGERAVSTVLYMIALQHFTNAPFRVVDEINQGMDTRYERIVHKAMVE 1039

>AER044W [2549] [Homologous to ScYLR383W (RHC18) - SH]
           complement(714355..717666) [3312 bp, 1103 aa]
          Length = 1103

 Score = 53.9 bits (128), Expect = 8e-07,   Method: Compositional matrix adjust.
 Identities = 110/462 (23%), Positives = 192/462 (41%), Gaps = 94/462 (20%)

Query: 2   YIKRVIIKGFKTYRNETIIDNFSPHQNVIIGSNGSGKSNFFAAIRFVLSDDYSNLKRE-E 60
           Y+KR+ +K F  + +  +   F P  N I+GSNGSGKS    AI  V     S+  R   
Sbjct: 61  YMKRITLKNFMCHEHFEL--EFGPRLNFIVGSNGSGKSAILTAITVVFGAKASDTNRGVS 118

Query: 61  RQGLIHQGSGGSVMSASVEIVFHDPDHSMILPSGVLSRG--DDEVTIRRTVGLKKDDYQL 118
            + LI +G G    +A + IV  +         G   +G    E+TI RT  LK+D    
Sbjct: 119 LKSLIREGCG----TARIAIVLANQG------LGAFEQGVYGSEITIERT--LKRDGQSS 166

Query: 119 -------NDRNVT--KGDIVRMLETAGFSMNNPYNIVPQGKIVALTNAKDKE-------R 162
                  N R V+  K D+ R+++     + NP   + Q    +   A   +       R
Sbjct: 167 HFSIKSENGREVSNKKRDLQRIVDYFSIPVLNPMCFLSQDAARSFLTASTPQDKFRHFMR 226

Query: 163 LQLLE--DVVGAKSFEVKLKAS----------LKKMEETEQKKIQINKEM---------- 200
             LLE  D+  AK+ E+ L++S          +K + E  +   ++ KE+          
Sbjct: 227 GTLLEEIDMNLAKAEEI-LRSSKSNLDYHGENMKALREDYEHAKRLFKEIYSTHDWNERK 285

Query: 201 GELNSKLSEM---EQERKELEKYNE----------------LERNRKIYQFTLYDRELNE 241
             L  KL  +   E ER+ L K+ +                 ERN KI ++       +E
Sbjct: 286 KTLQGKLCWLNYKENERR-LRKFKKRQEEISQKIVACDEKITERNLKIERYKADQDSTHE 344

Query: 242 VINQMERLDGDYNNTVYSSEQYIQELDKREDMIDQVSKKLSSIEASLKIKNATDLQQAKL 301
            ++Q      D+      +EQ + +  ++ +++ +  +K+    ASL++      QQ K 
Sbjct: 345 EVDQKMTSLQDHQIKFEEAEQELGQFREKHEVLKEERRKVEREIASLEVSLKAHRQQVKQ 404

Query: 302 RESEISQKLTNVNVKIKDVQQQIESNEEQRNLDSATLKEIKSIIEQRKQKLSKILPRYQE 361
            E E+++ L     ++   ++Q++             +EIK++    K  L  +  ++Q+
Sbjct: 405 LEQELAEALGGSKEQMVTEKRQVD-------------EEIKTL----KGNLPSLEDKFQQ 447

Query: 362 LTKEEAMYKLQL-ASLQQKQRDLILKKGEYARFKSKDERDTW 402
               E  Y  Q   ++QQ Q  + LKK EY    +   +D++
Sbjct: 448 CRDRELEYSHQRNTAIQQLQTSINLKKQEYRESTANRSQDSY 489

 Score = 33.5 bits (75), Expect = 1.3,   Method: Compositional matrix adjust.
 Identities = 25/76 (32%), Positives = 39/76 (51%), Gaps = 4/76 (5%)

Query: 1123 VEQLSGGQKTVCAIALILAIQMVDPASFYLFDEIDAALDKQYRT-AVATLLKELSKN--A 1179
            V+ LSGG+K+   I L+L+      A     DE D  +D+  RT     ++K+ S N   
Sbjct: 1004 VDTLSGGEKSFSQITLLLSTWSTMRARIIALDEFDVFMDQVNRTIGTRMIMKKFSTNIRT 1063

Query: 1180 QFICTTFRTDMLQVAD 1195
            Q I  T + D+ ++AD
Sbjct: 1064 QTIIITPQ-DIGKIAD 1078

>Kwal_26.7204
          Length = 1117

 Score = 52.0 bits (123), Expect = 3e-06,   Method: Compositional matrix adjust.
 Identities = 53/197 (26%), Positives = 92/197 (46%), Gaps = 13/197 (6%)

Query: 22  NFSPHQNVIIGSNGSGKSNFFAAIRFVLSDDYSNLKREER-QGLIHQGSGGSVMSASVEI 80
           + SP  N+IIG NGSGKS F  A+   L+     + R +R    I  G    ++  +++ 
Sbjct: 86  HLSPSLNMIIGPNGSGKSTFVCAVCLGLAGKPEYIGRGKRVDSFIKNGENRGLIEVTLK- 144

Query: 81  VFHDPDHSMILPSGVLSRGDDEVTIRRTVGLKKDDYQLNDRNVTKGDIVRMLETAGFSMN 140
              DP  +    S V   G  +V+    VG KK +Y LND  V++  +  ++      ++
Sbjct: 145 --RDPGRT---GSFVAVDGTTKVSRVLWVG-KKSEYYLNDEPVSELTVKNLMGELNIQLD 198

Query: 141 NPYNIVPQGKIVALTNAKDKERLQLLEDVVGAKSFEVKLKASLKKMEETEQKKIQINKEM 200
           N    + Q ++      K     +LL + V  +S  V L  S K ++  ++++I   KE+
Sbjct: 199 NLCQFLSQERVEEFARLKSD---KLLMETV--RSVNVNLLESFKNLKTLQEEQITEAKEL 253

Query: 201 GELNSKLSEMEQERKEL 217
               SKL ++ + R +L
Sbjct: 254 ELKTSKLRDLNETRDKL 270

 Score = 35.4 bits (80), Expect = 0.38,   Method: Compositional matrix adjust.
 Identities = 45/211 (21%), Positives = 94/211 (44%), Gaps = 38/211 (18%)

Query: 981  LNDMNTEISGLKNVNKRAFENFKKFNERRKDLAERASELDESKDSIQDLIVKLKQQKV-- 1038
            ++ +++EI G+ N ++   E   K  +  K+L      + + + S+ DL + +++++   
Sbjct: 895  IDRLHSEI-GMMNQDESVIE---KMRQTEKELETLNRSIPQIQASLNDLTIAIEKERSVL 950

Query: 1039 -NAVDSTFQKVSENFEAVFERLVPRGTAKLIIHRKNDNANDHDESIDVDMDAESNESQNG 1097
               VD   + +S NF  +F+ +   G+   ++  KN+  ++   +I V            
Sbjct: 951  EPNVDGIVEGISINFSRLFQNV---GSGGSVVLEKNELFSNWKINIMVRF---------- 997

Query: 1098 KDSEIMYTGVSISVSFNSKQNEQLHVEQLSGGQKTVCAIALILAIQMVDPASFYLFDEID 1157
            +DS +M            K + Q+     SGG++ V  +  ++A+Q    A F + DEI+
Sbjct: 998  RDSALM-----------KKLDSQIQ----SGGERAVSTVLYMIALQEFTSAPFRIVDEIN 1042

Query: 1158 AALDKQYRTAVATLLKE---LSKNAQFICTT 1185
              +D +    V   + E     K +Q+I  T
Sbjct: 1043 QGMDTRNERIVHKAMVENACAEKTSQYILVT 1073

>CAGL0F01155g complement(116762..120079) similar to tr|Q08204
           Saccharomyces cerevisiae YOL034w, hypothetical start
          Length = 1105

 Score = 47.8 bits (112), Expect = 7e-05,   Method: Compositional matrix adjust.
 Identities = 104/466 (22%), Positives = 207/466 (44%), Gaps = 79/466 (16%)

Query: 3   IKRVIIKGFKTYRNETIIDNFSPHQNVIIGSNGSGKSNFFAAIRFVLSDDYSNLKREER- 61
           I ++ ++ F TY       N SP  N+IIG NGSGKS +  A+   L+     + R ++ 
Sbjct: 38  IVKIRLENFVTYNYTEF--NLSPSLNMIIGPNGSGKSTYVCAVCLGLAGKPEYIGRSKQV 95

Query: 62  QGLIHQGSGGSVMSASVEIVFH-DPDHSMILPSGVLSR----GDDEVTIRRTVGLKK--- 113
           +  I  G   S     +EIV   DP+  +        R    G+ +  +  T  L+K   
Sbjct: 96  EDFIKNGQDTS----KIEIVLKDDPNIDIEFLGSSFHRIRNNGNYKGLLTITRNLEKRTK 151

Query: 114 ----------DDYQLNDRNVTKGDIVRMLETAGFSMNNPYNIVPQGKIVALTNAKDKERL 163
                      +Y +N    T+ ++  ++      ++N    + Q ++      + +   
Sbjct: 152 IGRNLEKRRTQEYSINGLPTTESNVRNLVSKFHIQLDNLCQFLSQERVEEFAKLRPE--- 208

Query: 164 QLLEDVVGA------KSFEVKLKASLKKMEETEQKKIQINKE-MGELNSKLSEMEQERKE 216
           +LL++ + A        FEV  K  L+++E + +  IQ N + + +L +     +QE + 
Sbjct: 209 KLLDETIRAIDSELLSMFEVLKKLQLQEIEMSNE--IQTNTDSLKKLKTDEENFQQEVQL 266

Query: 217 LEKYNE----LERNRKIYQFTLYDRELNEVINQMERLDGDYNNTVYSSEQYIQELDKRED 272
           L +Y E    L++++K+  +        ++ +  E+L   Y   V  +++ +QE  K  +
Sbjct: 267 LNEYQETLDTLDKHKKLLPYL-------KIQDHREKL-LTYKRQVEGAKKQLQEFQKERE 318

Query: 273 MIDQVSKKLSSIEASLKIKNATDLQQAKLRESEIS--QKLTNVNVKIKDVQQQIESNEEQ 330
              QV   L+  +A L I      ++  + E ++S  +KL     K+  ++++IE    Q
Sbjct: 319 PYMQVLASLNESDAQLNI------EKENIEEKKVSTKRKLEKTVSKLNALREEIEKKNLQ 372

Query: 331 RNLDSATLKEIKSIIEQRKQKLSKILPRYQEL-TKEEAMYKLQLASLQQKQRDLILKKGE 389
                    ++K  IE +K+ +  I  +  ++ T EE+    ++  L++K+ DLI     
Sbjct: 373 IEYYKGRSNKLKIKIETKKEDIDNIKRKISDIETPEES----EVTELERKRNDLI----- 423

Query: 390 YARFKSKDERDTWIHSEIEELKSSI----QNLNELESQLQMDRTSL 431
                   ER++ ++SEI+E+ + +     NL  LE ++   ++SL
Sbjct: 424 --------ERESQVNSEIDEVDTQMSTQNHNLAILERKMVDKKSSL 461

 Score = 33.1 bits (74), Expect = 1.6,   Method: Compositional matrix adjust.
 Identities = 13/42 (30%), Positives = 23/42 (54%)

Query: 1127 SGGQKTVCAIALILAIQMVDPASFYLFDEIDAALDKQYRTAV 1168
            SGG++ V  +  ++A+Q    A F + DEI+  +D  +   V
Sbjct: 1000 SGGERAVSTVLYMIALQKFTQAPFRVVDEINQGMDTNFERLV 1041

>YOL034W (SMC5) [4782] chr15 (259923..263204) Protein containing an
           SMC domain N-terminal domain, which bind ATP in
           chromosome-associated proteins, has low similarity to S.
           pombe Spr18p, which is likely to be involved in the
           maintenance of chromosome structure [3282 bp, 1093 aa]
          Length = 1093

 Score = 45.4 bits (106), Expect = 3e-04,   Method: Compositional matrix adjust.
 Identities = 52/222 (23%), Positives = 103/222 (46%), Gaps = 20/222 (9%)

Query: 3   IKRVIIKGFKTYRNETIID-NFSPHQNVIIGSNGSGKSNFFAAIRFVLSDDYSNLKREER 61
           I ++ ++ F TY   T+ + N SP  N+IIG NGSGKS F  A+   L+     + R ++
Sbjct: 42  IIKIRLQDFVTY---TLTEFNLSPSLNMIIGPNGSGKSTFVCAVCLGLAGKPEYIGRSKK 98

Query: 62  -QGLIHQGSGGSVMSASVEIVF-HDPDHSMILPSGVLSRGDDEVTIRRTV--GLKKDDYQ 117
            +  I  G   S     +EI   + P+ + I     +   D+ + I R +    ++ DY 
Sbjct: 99  VEDFIKNGQDVS----KIEITLKNSPNVTDI---EYIDARDETIKITRIITRSKRRSDYL 151

Query: 118 LNDRNVTKGDIVRMLETAGFSMNNPYNIVPQGKIVALTNAKDKERLQLLEDVVGAKSFEV 177
           +ND  V++  +  ++      ++N    + Q ++      K    ++LL + +  +S + 
Sbjct: 152 INDYQVSESVVKTLVAQLNIQLDNLCQFLSQERVEEFARLKS---VKLLVETI--RSIDA 206

Query: 178 KLKASLKKMEETEQKKIQINKEMGELNSKLSEMEQERKELEK 219
            L   L ++ E +  +  + K++    +K+  + QE  +L K
Sbjct: 207 SLLDVLDELRELQGNEQSLQKDLDFKKAKIVHLRQESDKLRK 248

>CAGL0H05071g 486899..490231 similar to sp|Q12749 Saccharomyces
           cerevisiae YLR383w RHC18, hypothetical start
          Length = 1110

 Score = 45.4 bits (106), Expect = 3e-04,   Method: Compositional matrix adjust.
 Identities = 41/154 (26%), Positives = 62/154 (40%), Gaps = 15/154 (9%)

Query: 2   YIKRVIIKGFKTYRNETIIDNFSPHQNVIIGSNGSGKSNFFAAIRFVLSDDYSNLKREER 61
           YIK++ +  F  +RN  +     P  N I+G NGSGKS    AI   L    S   R   
Sbjct: 79  YIKKLTLHNFMCHRNFDV--ELGPGLNFIVGKNGSGKSAILTAITIGLGAKASETNRGSS 136

Query: 62  -QGLIHQGSGGSVMSASVEIVFHDPDHSMILPSGVLSRGDDEVTIRRTVG-LKKDDYQLN 119
            + LI  G      S+ + I   +      +P G   +  D + I RT+       + L 
Sbjct: 137 LKDLITAGCN----SSRITIYLSNSGIGAYVPKG--KQYGDTIIIERTISRTSTAGFSLK 190

Query: 120 DRNVT-----KGDIVRMLETAGFSMNNPYNIVPQ 148
             N T     K D+  +L+     ++NP   + Q
Sbjct: 191 SENGTEISNKKRDLQEILDYFAIPISNPMCFLSQ 224

>Scas_719.6
          Length = 1096

 Score = 43.1 bits (100), Expect = 0.002,   Method: Compositional matrix adjust.
 Identities = 44/158 (27%), Positives = 67/158 (42%), Gaps = 25/158 (15%)

Query: 2   YIKRVIIKGFKTYRNETIIDNFSPHQNVIIGSNGSGKSNFFAAIRFVLSDDYSNLKREER 61
           YIK+V ++ F  + N  +     P  N I+GSNGSGKS    AI   L    S+  R   
Sbjct: 63  YIKKVSLRNFMCHENFEL--ELGPKLNFIVGSNGSGKSAILTAITIALGAKASDTNRGNS 120

Query: 62  -QGLIHQGSGGSVMSASVEIVFHDPDHSMILPSGVLSRG--DDEVTIRRTVGLKKD---D 115
            + LI +G      SA + +V  +         G   +G    E+ I RT  L++D    
Sbjct: 121 LKELIKEG----CYSAKITLVIENGKQ------GAYDQGTYGKEIIIERT--LRRDGSPS 168

Query: 116 YQLNDRNVT-----KGDIVRMLETAGFSMNNPYNIVPQ 148
           + L   +       K DI  +++     +NNP   + Q
Sbjct: 169 FSLKSESGVEISNKKRDIQTVVDFFSVPVNNPMCFLSQ 206

 Score = 36.2 bits (82), Expect = 0.22,   Method: Compositional matrix adjust.
 Identities = 25/78 (32%), Positives = 40/78 (51%), Gaps = 6/78 (7%)

Query: 1122 HVEQLSGGQKTVCAIALILAIQMVDPASFYLFDEIDAALDKQYRTAVATL----LKELSK 1177
            +V+ LSGG+K+   +AL+LA      +     DE D  +D+  R    TL    LK+L++
Sbjct: 993  NVDTLSGGEKSFSQLALLLATWKPMRSRIIALDEFDVFMDQVNRRIGTTLVVKKLKDLAR 1052

Query: 1178 NAQFICTTFRTDMLQVAD 1195
                I T    D+ ++AD
Sbjct: 1053 TQTIIITP--QDIGKIAD 1068

>Kwal_33.13526
          Length = 1298

 Score = 38.9 bits (89), Expect = 0.035,   Method: Compositional matrix adjust.
 Identities = 27/92 (29%), Positives = 44/92 (47%), Gaps = 9/92 (9%)

Query: 8  IKGFKTYRNETIIDNFSPHQNVIIGSNGSGKSNFFAAIRFVLSDDYSNLKREERQG-LIH 66
          I+ F +   ETI   F     +I+GSNGSGK+     +++  + D   L    + G  +H
Sbjct: 12 IRSFDSNERETI--EFGKPLTLIVGSNGSGKTTIIECLKYATTGD---LPPNSKGGAFVH 66

Query: 67 QG--SGGSVMSASVEIVFHDP-DHSMILPSGV 95
              +G   + A V++ F  P D SMI+   +
Sbjct: 67 DPKITGEKDVRAQVKLAFTSPNDVSMIVTRNI 98

>YBL047C (EDE1) [147] chr2 complement(127860..132005) Protein with
           role in endocytosis, has similarity to cytoskeletal
           proteins Uso1p and Pan1p and to mouse tyrosine kinase
           substrate eps15 [4146 bp, 1381 aa]
          Length = 1381

 Score = 37.4 bits (85), Expect = 0.087,   Method: Compositional matrix adjust.
 Identities = 48/213 (22%), Positives = 96/213 (45%), Gaps = 30/213 (14%)

Query: 201 GELNSKLSEMEQERKELE-KYNELERNRKIY--QFTLYDRELNEVINQMERLDGDYNNTV 257
           GE +++LS    E   L  + N L +   I   + +   +EL  V      +    NN  
Sbjct: 593 GEASAQLSNATTEMANLSNQVNSLSKQASITNDKKSRATQELKRVTEMKNSIQIKLNNLR 652

Query: 258 YSSEQYIQELDKREDMIDQVSKKLSSIEASLKIKNA-------------TDLQQAKLRES 304
            + +Q +++ ++ E  + QV+K+  ++   L +  A             TDLQ+++ + +
Sbjct: 653 STHDQNVKQTEQLEAQVLQVNKENETLAQQLAVSEANYHAAESKLNELTTDLQESQTKNA 712

Query: 305 EISQKLTNVNVKIKDVQQQ--------------IESNEEQRNLDSATLKEIKSIIEQRKQ 350
           E+ +++TN+N     +Q Q              ++ N +Q  L+  T+  ++  I+   +
Sbjct: 713 ELKEQITNLNSMTASLQSQLNEKQQQVKQERSMVDVNSKQLELNQVTVANLQKEIDGLGE 772

Query: 351 KLSKILPRYQELTKEEAMYKLQLASLQQKQRDL 383
           K+S  L + +EL   +   + Q A LQ K +DL
Sbjct: 773 KISVYLTKQKELNDYQKTVEEQHAQLQAKYQDL 805

>KLLA0E05247g complement(472583..475879) similar to sp|Q12749
           Saccharomyces cerevisiae YLR383w RHC18 recombination
           repair protein, start by similarity
          Length = 1098

 Score = 37.4 bits (85), Expect = 0.093,   Method: Compositional matrix adjust.
 Identities = 32/109 (29%), Positives = 48/109 (44%), Gaps = 11/109 (10%)

Query: 2   YIKRVIIKGFKTYRNETIIDNFSPHQNVIIGSNGSGKSNFFAAIRFVLSDDYSNLKR-EE 60
           +IK + +  F  + N ++     P  N I+G+NGSGKS    AI   L    +   R   
Sbjct: 63  FIKEIKLTNFMCHSNFSL--RLGPRLNFIVGNNGSGKSAILTAITIGLGAKATTTNRGTS 120

Query: 61  RQGLIHQGSGGSVMSASVEIVFHDPDHSMILPSGVLSRGDDEVTIRRTV 109
            + LI QG   S     + IV  +   +   P GV  +   E+ I RT+
Sbjct: 121 LKDLIKQGCNTS----KIVIVLCNEGLNSFEP-GVYGK---EIRIERTI 161

 Score = 37.0 bits (84), Expect = 0.13,   Method: Compositional matrix adjust.
 Identities = 25/85 (29%), Positives = 41/85 (48%), Gaps = 7/85 (8%)

Query: 1123 VEQLSGGQKTVCAIALILAIQMVDPASFYLFDEIDAALDKQYRTAVATLL-----KELSK 1177
            V+ LSGG+K+   IAL+LA  +   +     DE D  +D+  R     L+     K++  
Sbjct: 999  VDTLSGGEKSFSQIALLLATWLTMRSRIIALDEFDVFMDQVNRKIGTNLIIRRLGKDVKS 1058

Query: 1178 NAQFICTTFR--TDMLQVADKFFRV 1200
            + Q I  T +    M  + DK+F +
Sbjct: 1059 DTQTIIITPQDIGKMANIDDKYFNI 1083

>YLR383W (RHC18) [3762] chr12 (885288..888632) Protein involved in
           recombination repair, homologous to S. pombe rad18 [3345
           bp, 1114 aa]
          Length = 1114

 Score = 37.4 bits (85), Expect = 0.097,   Method: Compositional matrix adjust.
 Identities = 26/83 (31%), Positives = 38/83 (45%), Gaps = 9/83 (10%)

Query: 2   YIKRVIIKGFKTYRNETIIDNFSPHQNVIIGSNGSGKSNFFAAIRFVLSDDYSNLKREER 61
           YIK+VI++ F  + +  +        N I+G+NGSGKS    AI   L    S   R   
Sbjct: 81  YIKKVILRNFMCHEHFEL--ELGSRLNFIVGNNGSGKSAILTAITIGLGAKASETNRGSS 138

Query: 62  -QGLIHQGSGGSVMSASVEIVFH 83
            + LI +G        S +I+ H
Sbjct: 139 LKDLIREG------CYSAKIILH 155

 Score = 34.7 bits (78), Expect = 0.54,   Method: Compositional matrix adjust.
 Identities = 24/78 (30%), Positives = 40/78 (51%), Gaps = 6/78 (7%)

Query: 1122 HVEQLSGGQKTVCAIALILAIQMVDPASFYLFDEIDAALDKQYRTAVATL----LKELSK 1177
            +V+ LSGG+K+   +AL+LA      +     DE D  +D+  R    TL    LK++++
Sbjct: 1015 NVDTLSGGEKSFSQMALLLATWKPMRSRIIALDEFDVFMDQVNRKIGTTLIVKKLKDIAR 1074

Query: 1178 NAQFICTTFRTDMLQVAD 1195
                I T    D+ ++AD
Sbjct: 1075 TQTIIITP--QDIGKIAD 1090

>CAGL0G02937g complement(268985..270679) highly similar to sp|P06169
           Saccharomyces cerevisiae YLR044c PDC1 or sp|P16467
           Saccharomyces cerevisiae YLR134w PDC5 or sp|P26263
           Saccharomyces cerevisiae YGR087c PDC6, start by
           similarity
          Length = 564

 Score = 37.0 bits (84), Expect = 0.10,   Method: Compositional matrix adjust.
 Identities = 24/74 (32%), Positives = 38/74 (51%), Gaps = 4/74 (5%)

Query: 86  DHSMILPSGVLSRGDDEVTIRRTVGLKKDDYQLNDRNVTKGDIVRMLETAGFSMNNPYNI 145
           DHS+ILP+     G      +R     + +  +ND+   K D +RM+E    +M+ P N+
Sbjct: 495 DHSLILPA----FGAKNYENKRVATYGEWNDMVNDKQFNKNDKLRMIEVMLPTMDGPENL 550

Query: 146 VPQGKIVALTNAKD 159
             Q K+ A  NAK+
Sbjct: 551 KKQAKLTASINAKN 564

>YDL058W (USO1) [807] chr4 (345665..351037) Coiled-coil protein with
            similarity to mammalian integrin, required for protein
            transport from ER to Golgi [5373 bp, 1790 aa]
          Length = 1790

 Score = 36.2 bits (82), Expect = 0.20,   Method: Compositional matrix adjust.
 Identities = 51/180 (28%), Positives = 94/180 (52%), Gaps = 37/180 (20%)

Query: 175  FEVKLKAS---LKKMEETEQ----KKIQINKEMGELNSKLSEMEQERKELEKYNE-LERN 226
             E KL+ S   LK+++E E+    +KIQ+ KE  E   +L+ +    + LEK +E L   
Sbjct: 1101 LETKLETSEKALKEVKENEEHLKEEKIQLEKEATETKQQLNSLRANLESLEKEHEDLAAQ 1160

Query: 227  RKIY--QFTLYDRELNEVINQMERLDGDYNNTVYSSEQYIQELDKREDMIDQVSKKLSSI 284
             K Y  Q    +R+ NE I+Q+       N+ + S++Q  + + K+ D           +
Sbjct: 1161 LKKYEEQIANKERQYNEEISQL-------NDEITSTQQENESIKKKND----------EL 1203

Query: 285  EASLKIKNATDLQQAKLRESEISQKLTNVNVKIKDVQQQIESNEEQRNLDSATLKEIKSI 344
            E  +K   +T  +Q+ L++SEI      +N++IK+++++ E+NE      ++ L+ IKS+
Sbjct: 1204 EGEVKAMKSTSEEQSNLKKSEIDA----LNLQIKELKKKNETNE------ASLLESIKSV 1253

>KLLA0B14256g 1248654..1252469 similar to sp|P12866 Saccharomyces
            cerevisiae YKL209c STE6 ATP-binding cassette transporter
            protein, hypothetical start
          Length = 1271

 Score = 36.2 bits (82), Expect = 0.20,   Method: Compositional matrix adjust.
 Identities = 25/84 (29%), Positives = 40/84 (47%), Gaps = 4/84 (4%)

Query: 1118 NEQLHVEQLSGGQKTVCAIALILAIQMVDPASFYLFDEIDAALDKQYRTAVATLLKELSK 1177
            N ++H   +SGGQ    +IA  L  Q        + DE  +ALD     A+A L++ + K
Sbjct: 1163 NTRVHDGLMSGGQAQRLSIARTLLRQ----PKIIILDECTSALDAANSFAIAELIRTVLK 1218

Query: 1178 NAQFICTTFRTDMLQVADKFFRVK 1201
            N   I  T    ++Q+ D+   +K
Sbjct: 1219 NVTVIVITHSEQLMQICDRVLVLK 1242

>Kwal_26.9380
          Length = 1102

 Score = 36.2 bits (82), Expect = 0.21,   Method: Compositional matrix adjust.
 Identities = 23/75 (30%), Positives = 37/75 (49%), Gaps = 3/75 (4%)

Query: 2   YIKRVIIKGFKTYRNETIIDNFSPHQNVIIGSNGSGKSNFFAAIRFVLSDDYSNLKREER 61
           +IK+V ++ F  + +  +     P  N I+G+NGSGKS    AI   L    ++  R   
Sbjct: 69  FIKKVQLRNFMCHEHFEL--ELGPRLNFIVGNNGSGKSAVLTAITIGLGAKATDTNRGSS 126

Query: 62  -QGLIHQGSGGSVMS 75
            + LI +G   S +S
Sbjct: 127 LKDLIREGCQSSKIS 141

>Scas_636.14
          Length = 608

 Score = 35.8 bits (81), Expect = 0.24,   Method: Compositional matrix adjust.
 Identities = 20/53 (37%), Positives = 27/53 (50%), Gaps = 4/53 (7%)

Query: 1123 VEQLSGGQKTVCAIALILAIQMVDPASFYLFDEIDAALDKQYRTAVATLLKEL 1175
            V+ LSGG+    AI L L I    PA  YL DE  A LD + R   + +++  
Sbjct: 465  VQHLSGGELQRVAIVLALGI----PADIYLIDEPSAYLDSEQRIICSKVIRRF 513

>YDR091C (YDR091C) [943] chr4 complement(626702..628528) Putative
            ortholog of human Rnase L inhibitor (RLI) of the
            interferon-regulated 2-5A pathway, putative ortholog of
            C. elegans Y39E4B.1, member of the non-transporter group
            in the ATP-binding cassette (ABC) superfamily [1827 bp,
            608 aa]
          Length = 608

 Score = 35.4 bits (80), Expect = 0.28,   Method: Compositional matrix adjust.
 Identities = 23/63 (36%), Positives = 31/63 (49%), Gaps = 7/63 (11%)

Query: 1123 VEQLSGGQKTVCAIALILAIQMVDPASFYLFDEIDAALDKQYRTAVATLLKEL---SKNA 1179
            V+ LSGG+    AI L L I    PA  YL DE  A LD + R   + +++     +K  
Sbjct: 465  VQHLSGGELQRVAIVLALGI----PADIYLIDEPSAYLDSEQRIICSKVIRRFILHNKKT 520

Query: 1180 QFI 1182
             FI
Sbjct: 521  AFI 523

>CAGL0G08041g complement(758811..760634) highly similar to tr|Q03195
            Saccharomyces cerevisiae YDR091c, start by similarity
          Length = 607

 Score = 35.0 bits (79), Expect = 0.45,   Method: Compositional matrix adjust.
 Identities = 28/82 (34%), Positives = 37/82 (45%), Gaps = 13/82 (15%)

Query: 1123 VEQLSGGQKTVCAIALILAIQMVDPASFYLFDEIDAALDKQYRTAVATLLKEL----SKN 1178
            V+ LSGG+    AI L L I    PA  YL DE  A LD + R   + +++       K 
Sbjct: 464  VKHLSGGELQRVAIVLSLGI----PADIYLIDEPSAYLDSEQRIICSKVIRRFILHNKKT 519

Query: 1179 A-----QFICTTFRTDMLQVAD 1195
            A      FI  T+  D + V D
Sbjct: 520  AFIVEHDFIMATYLADKVIVFD 541

>Kwal_56.23429
          Length = 539

 Score = 34.3 bits (77), Expect = 0.73,   Method: Compositional matrix adjust.
 Identities = 19/53 (35%), Positives = 27/53 (50%), Gaps = 4/53 (7%)

Query: 1123 VEQLSGGQKTVCAIALILAIQMVDPASFYLFDEIDAALDKQYRTAVATLLKEL 1175
            V+ LSGG+    AI L L +    PA  YL DE  A LD + R   + +++  
Sbjct: 465  VQHLSGGELQRVAIVLALGL----PADIYLIDEPSAYLDSEQRIICSKVIRRF 513

>AGR125W [4436] [Homologous to ScYDR091C (RLI1) - SH]
            complement(987083..988906) [1824 bp, 607 aa]
          Length = 607

 Score = 34.3 bits (77), Expect = 0.79,   Method: Compositional matrix adjust.
 Identities = 22/63 (34%), Positives = 31/63 (49%), Gaps = 7/63 (11%)

Query: 1123 VEQLSGGQKTVCAIALILAIQMVDPASFYLFDEIDAALDKQYRTAVATLLKEL---SKNA 1179
            V+ LSGG+    AI L L +    PA  YL DE  A LD + R   + +++     +K  
Sbjct: 464  VQHLSGGELQRVAIVLALGL----PADIYLIDEPSAYLDSEQRIICSKVIRRFILHNKKT 519

Query: 1180 QFI 1182
             FI
Sbjct: 520  AFI 522

>YPR049C (ATG11) [5481] chr16 complement(661132..664668) Peripheral
           oligomeric membrane protein required for cytoplasmic to
           vacuole targeting (cvt) pathway and pexophagy [3537 bp,
           1178 aa]
          Length = 1178

 Score = 33.9 bits (76), Expect = 1.0,   Method: Compositional matrix adjust.
 Identities = 31/100 (31%), Positives = 56/100 (56%), Gaps = 22/100 (22%)

Query: 187 EETEQKKIQINKEMGELNSKLSEMEQER-----------KELEKYNELERNRKIYQFTL- 234
           EE  +K +QI+ EMG+   K+S++E E+           +EL +    E++ +   FTL 
Sbjct: 722 EENNRKSMQIS-EMGK---KISDLEVEKTAYRETLTNLNQELARLTNEEQSHRTEIFTLN 777

Query: 235 --YDRELNEVINQ----MERLDGDYNNTVYSSEQYIQELD 268
             + ++LN++I+Q    +E+L GDY++   S E+   +LD
Sbjct: 778 ASFKKQLNDIISQDNEKIEKLTGDYDDVSKSRERLQMDLD 817

>CAGL0L01221g 137742..140726 similar to sp|P32618 Saccharomyces
           cerevisiae YEL043w, hypothetical start
          Length = 994

 Score = 32.7 bits (73), Expect = 2.2,   Method: Compositional matrix adjust.
 Identities = 20/49 (40%), Positives = 31/49 (63%), Gaps = 4/49 (8%)

Query: 179 LKASLKKMEE----TEQKKIQINKEMGELNSKLSEMEQERKELEKYNEL 223
           LK+S+K +E     T+ K  ++ K++ EL  K+S ME++ KE EK N L
Sbjct: 288 LKSSIKSLENSKLLTDTKSEKVKKKINELRFKISRMEKDMKEWEKENSL 336

>KLLA0C13926g 1195709..1198063 similar to sp|P40850 Saccharomyces
           cerevisiae YNL085w MKT1 required for propagation of M2
           dsRNA satellite of L-A virus singleton, start by
           similarity
          Length = 784

 Score = 31.6 bits (70), Expect = 4.4,   Method: Compositional matrix adjust.
 Identities = 23/79 (29%), Positives = 38/79 (48%), Gaps = 11/79 (13%)

Query: 154 LTNAKDKERLQLLEDVVGAKSFEVKLKASLKKMEETEQKKIQINKEMGELNSKLSEMEQE 213
           L N  DKE      D +   S       S+ K+EE   K  ++ ++ G + ++++E+   
Sbjct: 710 LHNGHDKE------DAMNLISVTFSAYKSVPKLEEEFNKSFELTEQFGTVCARMAEL--- 760

Query: 214 RKELEKYNELERNRKIYQF 232
             EL + NELE   K Y+F
Sbjct: 761 --ELLQQNELEIYEKAYRF 777

>KLLA0C01991g 160778..162898 similar to sp|P33310 Saccharomyces
            cerevisiae YLR188w MDL1 ATP-binding cassette transporter
            family member, hypothetical start
          Length = 706

 Score = 31.2 bits (69), Expect = 6.6,   Method: Compositional matrix adjust.
 Identities = 22/56 (39%), Positives = 30/56 (53%), Gaps = 4/56 (7%)

Query: 1125 QLSGGQKTVCAIALILAIQMVDPASFYLFDEIDAALDKQYRTAVATLLKELSKNAQ 1180
            QLSGGQK   A+A      ++DP S  + DE  +ALD Q    VA  L++ S   +
Sbjct: 569  QLSGGQKQRIALARAF---LLDP-SILILDEATSALDSQSEEVVAQSLQQRSARGK 620

>CAGL0J07788g complement(757051..760968) similar to sp|P12753
          Saccharomyces cerevisiae YNL250w RAD50 DNA repair
          protein, start by similarity
          Length = 1305

 Score = 31.2 bits (69), Expect = 7.1,   Method: Compositional matrix adjust.
 Identities = 24/92 (26%), Positives = 43/92 (46%), Gaps = 9/92 (9%)

Query: 8  IKGFKTYRNETIIDNFSPHQNVIIGSNGSGKSNFFAAIRFVLSDDYSNLKREERQGL-IH 66
          I+ F +   ETI   F     +I+G NGSGK+     +++  + D   L    + G+ +H
Sbjct: 12 IRSFDSNDRETI--EFGKPLTLIVGMNGSGKTTIIECLKYATTGD---LPPNSKGGVFVH 66

Query: 67 QG--SGGSVMSASVEIVFHDPDH-SMILPSGV 95
              +G   + A V++ F   +  SMI+   +
Sbjct: 67 DPKITGEKDVRAQVKLAFTSTNGLSMIVTRNI 98

>KLLA0E00891g complement(98423..99586) similar to sp|P39952
            Saccharomyces cerevisiae YER154w OXA1 cytochrome oxidase
            biogenesis protein singleton, start by similarity
          Length = 387

 Score = 30.8 bits (68), Expect = 8.0,   Method: Composition-based stats.
 Identities = 14/42 (33%), Positives = 26/42 (61%)

Query: 996  KRAFENFKKFNERRKDLAERASELDESKDSIQDLIVKLKQQK 1037
            K  FE+F++  ++ KD AE+ + + E  D ++DL  K K+ +
Sbjct: 338  KGVFESFRENIQKAKDQAEKRAMMKEQDDKMKDLAKKEKENQ 379

>AFR637W [3829] [Homologous to ScYNL250W (RAD50) - SH]
          complement(1598692..1602582) [3891 bp, 1296 aa]
          Length = 1296

 Score = 30.8 bits (68), Expect = 8.1,   Method: Compositional matrix adjust.
 Identities = 13/52 (25%), Positives = 29/52 (55%), Gaps = 3/52 (5%)

Query: 3  IKRVIIKGFKTY--RNETIIDNFSPHQNVIIGSNGSGKSNFFAAIRFVLSDD 52
          I  + I+G +++  R++ +I  F     +I+G+NG GK+     +++  + D
Sbjct: 4  IHNLSIQGIRSFDARDKEVI-KFGKPLTLIVGANGCGKTTIIECLKYATTGD 54

>KLLA0C17556g complement(1544404..1546227) highly similar to
            sgd|S0002498 Saccharomyces cerevisiae YDR091c RLI1, start
            by similarity
          Length = 607

 Score = 30.8 bits (68), Expect = 9.2,   Method: Compositional matrix adjust.
 Identities = 26/82 (31%), Positives = 36/82 (43%), Gaps = 13/82 (15%)

Query: 1123 VEQLSGGQKTVCAIALILAIQMVDPASFYLFDEIDAALDKQYRTAVATLLKEL----SKN 1178
            V+ LSGG+    AI L L +     A  YL DE  A LD + R   + +++       K 
Sbjct: 464  VQHLSGGELQRVAIVLSLGMN----ADIYLIDEPSAYLDSEQRIICSKVIRRFILHNKKT 519

Query: 1179 A-----QFICTTFRTDMLQVAD 1195
            A      FI  T+  D + V D
Sbjct: 520  AFIVEHDFIMATYLADKVIVFD 541

  Database: blastdb
    Posted date:  Apr 3, 2006  3:33 PM
  Number of letters in database: 16,596,109
  Number of sequences in database:  34,618
  
Lambda     K      H
   0.312    0.130    0.342 

Gapped
Lambda     K      H
   0.267   0.0410    0.140 

Matrix: BLOSUM62
Gap Penalties: Existence: 11, Extension: 1
Number of Sequences: 34618
Number of Hits to DB: 36,779,049
Number of extensions: 1659013
Number of successful extensions: 11905
Number of sequences better than 10.0: 730
Number of HSP's gapped: 11212
Number of HSP's successfully gapped: 1276
Length of query: 1208
Length of database: 16,596,109
Length adjustment: 113
Effective length of query: 1095
Effective length of database: 12,684,275
Effective search space: 13889281125
Effective search space used: 13889281125
Neighboring words threshold: 11
Window for multiple hits: 40
X1: 16 ( 7.2 bits)
X2: 38 (14.6 bits)
X3: 64 (24.7 bits)
S1: 42 (21.9 bits)
S2: 67 (30.4 bits)