Hit NameLength (aa)HSP LengthHSP ScoreHSP Significance
YIR036C26325913720.0
CAGL0F06919g2502586877e-91
ACR171C2512596815e-90
YIR035C2542586791e-89
Scas_628.62522576651e-87
CAGL0F06897g2582566461e-84
Scas_685.82522586122e-79
ABR247W2502614522e-55
ABR249W2502574434e-54
ABR246W2502604192e-50
ABR248W2612614168e-50
Sklu_2380.41601523679e-44
KLLA0E08052g1171063533e-42
KLLA0E08063g1861513221e-36
AER373C3001951831e-15
AFR561W2671971742e-14
KLLA0D15521g2562041713e-14
YMR226C2671981714e-14
KLLA0E09834g2681921681e-13
Sklu_1578.32682041619e-13
Kwal_14.24442881941565e-12
Kwal_26.91602672011531e-11
Scas_594.122671981531e-11
KLLA0B08371g2681971521e-11
KLLA0F04455g3052341522e-11
Kwal_34.160242922301478e-11
Scas_613.182862571423e-10
Sklu_2348.52892431406e-10
CAGL0M11242g2682021371e-09
KLLA0E13860g8891971392e-09
CAGL0G08690g2942511353e-09
YIL124W (AYR1)2971951353e-09
KLLA0E24046g2802081326e-09
KLLA0D02596g3472221302e-08
Scas_662.43072561273e-08
AGL060W8912311285e-08
KLLA0E22495g2921851193e-07
CAGL0J05852g3432701194e-07
Kwal_47.171022852001184e-07
YKL055C (OAR1)2782781176e-07
Kwal_55.195692881981176e-07
Kwal_26.79508971971161e-06
Kwal_55.218222832201088e-06
CAGL0L02167g9012261091e-05
CAGL0H10450g3112031071e-05
YDL114W3082081062e-05
ABR076C2712721062e-05
YNL202W (SPS19)2951361062e-05
Scas_652.19d13442311044e-05
Scas_652.19d3411541025e-05
KLLA0A11352g3142301018e-05
Sklu_268.12441981009e-05
AEL164C307197991e-04
YKL071W256262982e-04
CAGL0J04774g338203972e-04
KLLA0C12694g259244954e-04
Sklu_2267.5350139954e-04
YBR159W347229946e-04
Scas_478.2920197949e-04
KLLA0B09812g346224920.001
Kwal_23.4572300138910.001
YKR009C (FOX2)900223920.001
Scas_641.31287155890.002
Kwal_14.2598311210890.002
KLLA0D06127g330223890.003
Sklu_2219.3363256880.003
YBR265W (TSC10)320216880.003
Kwal_26.8282298232870.004
Sklu_1624.3316209870.004
Kwal_34.16139315260850.008
Kwal_14.1511277120830.011
KLLA0D18909g290135830.014
Kwal_26.8838323219820.016
AAL089W328225810.026
Sklu_1570.1756128820.027
Kwal_27.12155280121790.036
CAGL0H08063g290142780.050
Sklu_2404.1330149780.057
KLLA0F01749g313208780.059
Kwal_23.3107248207770.061
Sklu_2420.5326227780.065
Scas_721.47344215750.14
CAGL0M13013g270238690.80
CAGL0D03718g40582680.99
Scas_655.19297201671.2
KLLA0F19756g346185671.3
Scas_718.32100192681.4
YBR019C (GAL10)69992671.4
Kwal_33.14694340101671.5
ABL163W292135652.0
YLR426W326121652.1
YPL033C281189642.7
Scas_680.6367224643.0
YDR393W (SHE9)45633643.2
Kwal_56.2386334488634.0
Kwal_27.1191018460624.3
YLR100W (ERG27)347101625.3
AGL351W55557635.3
Scas_650.8326110617.8
ADR059C35160609.5
BLASTP 2.2.26 [Sep-21-2011]

Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, 
Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), 
"Gapped BLAST and PSI-BLAST: a new generation of protein database search
programs",  Nucleic Acids Res. 25:3389-3402.

Reference for compositional score matrix adjustment: Altschul, Stephen F., 
John C. Wootton, E. Michael Gertz, Richa Agarwala, Aleksandr Morgulis,
Alejandro A. Schaffer, and Yi-Kuo Yu (2005) "Protein database searches
using compositionally adjusted substitution matrices", FEBS J. 272:5101-5109.

Query= YIR036C
         (259 letters)

Database: blastdb 
           34,618 sequences; 16,596,109 total letters

Searching..................................................done

                                                                 Score    E
Sequences producing significant alignments:                      (bits) Value

YIR036C (YIR036C) [2700] chr9 complement(422071..422862) Reducta...   533   0.0  
CAGL0F06919g complement(677473..678225) similar to sp|P40579 Sac...   269   7e-91
ACR171C [1218] [Homologous to ScYIR035C - SH; ScYIR036C - SH] (6...   266   5e-90
YIR035C (YIR035C) [2699] chr9 complement(421023..421787) Member ...   266   1e-89
Scas_628.6                                                            260   1e-87
CAGL0F06897g complement(675416..676192) highly similar to sp|P40...   253   1e-84
Scas_685.8                                                            240   2e-79
ABR247W [841] [Homologous to ScYIR035C - NSH; ScYIR036C - NSH] c...   178   2e-55
ABR249W [843] [Homologous to ScYIR035C - NSH; ScYIR036C - NSH] c...   175   4e-54
ABR246W [840] [Homologous to ScYIR035C - NSH; ScYIR036C - NSH] c...   166   2e-50
ABR248W [842] [Homologous to ScYIR035C - NSH; ScYIR036C - NSH] c...   164   8e-50
Sklu_2380.4 YIR035C, Contig c2380 9858-10340                          145   9e-44
KLLA0E08052g complement(725895..726248) similar to sp|P40580 Sac...   140   3e-42
KLLA0E08063g complement(726232..726792) some similarities with s...   128   1e-36
AER373C [2874] [Homologous to ScYIL124W (AYR1) - SH] (1327314..1...    75   1e-15
AFR561W [3753] [Homologous to ScYMR226C - SH] complement(1438981...    72   2e-14
KLLA0D15521g 1311601..1312371 similar to sp|Q8TTF8 Methanosarcin...    70   3e-14
YMR226C (YMR226C) [4182] chr13 complement(721592..722395) NADP+-...    70   4e-14
KLLA0E09834g complement(872888..873694) similar to sp|Q9ALU7 Ent...    69   1e-13
Sklu_1578.3 YMR226C, Contig c1578 1774-2580                            67   9e-13
Kwal_14.2444                                                           65   5e-12
Kwal_26.9160                                                           64   1e-11
Scas_594.12                                                            64   1e-11
KLLA0B08371g complement(747517..748323) highly similar to sp|Q05...    63   1e-11
KLLA0F04455g complement(428010..428927) similar to sp|P40471 Sac...    63   2e-11
Kwal_34.16024                                                          61   8e-11
Scas_613.18                                                            59   3e-10
Sklu_2348.5 YIL124W, Contig c2348 10212-11081 reverse complement       59   6e-10
CAGL0M11242g complement(1105723..1106529) highly similar to sp|Q...    57   1e-09
KLLA0E13860g 1219430..1222099 similar to sp|Q02207 Saccharomyces...    58   2e-09
CAGL0G08690g complement(822798..823682) similar to sp|P40471 Sac...    57   3e-09
YIL124W (AYR1) [2552] chr9 (126204..127097) 1-Acyl dihydroxyacet...    57   3e-09
KLLA0E24046g complement(2136583..2137425) similar to ca|CA3771|C...    55   6e-09
KLLA0D02596g join(complement(219682..219797),complement(218659.....    55   2e-08
Scas_662.4                                                             54   3e-08
AGL060W [4251] [Homologous to ScYKR009C (FOX2) - SH] complement(...    54   5e-08
KLLA0E22495g 1996893..1997771 similar to ca|CA3677|CaSOU3 Candid...    50   3e-07
CAGL0J05852g complement(554403..555434) weakly similar to sp|P40...    50   4e-07
Kwal_47.17102                                                          50   4e-07
YKL055C (OAR1) [3204] chr11 complement(334966..335802) 3-Oxoacyl...    50   6e-07
Kwal_55.19569                                                          50   6e-07
Kwal_26.7950                                                           49   1e-06
Kwal_55.21822                                                          46   8e-06
CAGL0L02167g 253055..255760 highly similar to sp|Q02207 Saccharo...    47   1e-05
CAGL0H10450g complement(1018805..1019740) similar to tr|Q07530 S...    46   1e-05
YDL114W (YDL114W) [755] chr4 (255604..256530) Member of the shor...    45   2e-05
ABR076C [667] [Homologous to ScYKL055C (OAR1) - SH] (527756..528...    45   2e-05
YNL202W (SPS19) [4400] chr14 (259568..260455) Peroxisomal 2,4-di...    45   2e-05
Scas_652.19d1                                                          45   4e-05
Scas_652.19d                                                           44   5e-05
KLLA0A11352g complement(983428..984372) similar to sp|P50167 Pic...    44   8e-05
Sklu_268.1 , Contig c268 57-791 reverse complement                     43   9e-05
AEL164C [2342] [Homologous to ScYBR265W (TSC10) - SH] (326834..3...    43   1e-04
YKL071W (YKL071W) [3189] chr11 (304759..305529) Protein with sim...    42   2e-04
CAGL0J04774g join(452094..452179,452259..453189) similar to tr|Q...    42   2e-04
KLLA0C12694g 1077786..1078565 similar to sp|P35731 Saccharomyces...    41   4e-04
Sklu_2267.5 YNL202W, Contig c2267 5903-6955                            41   4e-04
YBR159W (YBR159W) [344] chr2 (558641..559684) Major 3-ketoreduct...    41   6e-04
Scas_478.2                                                             41   9e-04
KLLA0B09812g complement(856799..857839) similar to sp|P38286 Sac...    40   0.001
Kwal_23.4572                                                           40   0.001
YKR009C (FOX2) [3265] chr11 complement(453995..456697) Multifunc...    40   0.001
Scas_641.31                                                            39   0.002
Kwal_14.2598                                                           39   0.002
KLLA0D06127g complement(526164..527156) similar to sgd|S0005772 ...    39   0.003
Sklu_2219.3 YDL114W, Contig c2219 6060-7151 reverse complement         39   0.003
YBR265W (TSC10) [445] chr2 (738539..739501) 3-Ketosphinganine re...    39   0.003
Kwal_26.8282                                                           38   0.004
Sklu_1624.3 YBR265W, Contig c1624 1338-2288                            38   0.004
Kwal_34.16139                                                          37   0.008
Kwal_14.1511                                                           37   0.011
KLLA0D18909g complement(1592628..1593500) similar to sp|P32573 S...    37   0.014
Kwal_26.8838                                                           36   0.016
AAL089W [98] [Homologous to ScYOR246C - SH] complement(184564..1...    36   0.026
Sklu_1570.1 YKR009C, Contig c1570 100-2370                             36   0.027
Kwal_27.12155                                                          35   0.036
CAGL0H08063g 785331..786203 highly similar to sp|P32573 Saccharo...    35   0.050
Sklu_2404.13 YKL055C, Contig c2404 24100-25005                         35   0.057
KLLA0F01749g complement(163821..164762) similar to sp|P38342 Sac...    35   0.059
Kwal_23.3107                                                           34   0.061
Sklu_2420.5 YOR246C, Contig c2420 9342-10322 reverse complement        35   0.065
Scas_721.47                                                            33   0.14 
CAGL0M13013g complement(1281291..1282103) similar to sp|P35731 S...    31   0.80 
CAGL0D03718g complement(375335..376552) highly similar to sp|P38...    31   0.99 
Scas_655.19                                                            30   1.2  
KLLA0F19756g 1830489..1831529 similar to sgd|S0004094 Saccharomy...    30   1.3  
Scas_718.32                                                            31   1.4  
YBR019C (GAL10) [212] chr2 complement(276215..278314) UDP-glucos...    30   1.4  
Kwal_33.14694                                                          30   1.5  
ABL163W [429] [Homologous to ScYNL202W (SPS19) - SH] complement(...    30   2.0  
YLR426W (YLR426W) [3802] chr12 (987058..987137,987209..988109) M...    30   2.1  
YPL033C (YPL033C) [5405] chr16 complement(487358..488203) Protei...    29   2.7  
Scas_680.6                                                             29   3.0  
YDR393W (SHE9) [1221] chr4 (1259889..1261259) Protein essential ...    29   3.2  
Kwal_56.23863                                                          29   4.0  
Kwal_27.11910                                                          28   4.3  
YLR100W (ERG27) [3516] chr12 (341811..342854) 3-Keto sterol redu...    28   5.3  
AGL351W [3961] [Homologous to ScYMR307W (GAS1) - SH] complement(...    29   5.3  
Scas_650.8                                                             28   7.8  
ADR059C [1800] [Homologous to ScYBR159W - SH] (811943..812998) [...    28   9.5  

>YIR036C (YIR036C) [2700] chr9 complement(422071..422862) Reductase
           in the short-chain dehydrogenase/reductase (SDR) family
           of proteins [792 bp, 263 aa]
          Length = 263

 Score =  533 bits (1372), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 259/259 (100%), Positives = 259/259 (100%)

Query: 1   MGKVILITGASRGIGLQLVKTVIEEDDECIVYGVARTEAGLQSLQREYGADKFVYRVLDI 60
           MGKVILITGASRGIGLQLVKTVIEEDDECIVYGVARTEAGLQSLQREYGADKFVYRVLDI
Sbjct: 1   MGKVILITGASRGIGLQLVKTVIEEDDECIVYGVARTEAGLQSLQREYGADKFVYRVLDI 60

Query: 61  TDRSRMEALVEEIRQKHGKLDGIVANAGMLEPVKSISQSNSEHDIKQWERLFDVNFFSIV 120
           TDRSRMEALVEEIRQKHGKLDGIVANAGMLEPVKSISQSNSEHDIKQWERLFDVNFFSIV
Sbjct: 61  TDRSRMEALVEEIRQKHGKLDGIVANAGMLEPVKSISQSNSEHDIKQWERLFDVNFFSIV 120

Query: 121 SLVALCLPLLKSSPFVGNIVFVSSGASVKPYNGWSAYGCSKAALNHFAMDIASEEPSDKV 180
           SLVALCLPLLKSSPFVGNIVFVSSGASVKPYNGWSAYGCSKAALNHFAMDIASEEPSDKV
Sbjct: 121 SLVALCLPLLKSSPFVGNIVFVSSGASVKPYNGWSAYGCSKAALNHFAMDIASEEPSDKV 180

Query: 181 RAVCIAPGVVDTQMQKDIRETLGPQGMTPKALERFTQLYKTSSLLDPKVPAAVLAQLVLK 240
           RAVCIAPGVVDTQMQKDIRETLGPQGMTPKALERFTQLYKTSSLLDPKVPAAVLAQLVLK
Sbjct: 181 RAVCIAPGVVDTQMQKDIRETLGPQGMTPKALERFTQLYKTSSLLDPKVPAAVLAQLVLK 240

Query: 241 GIPDSLNGQYLRYNDERLG 259
           GIPDSLNGQYLRYNDERLG
Sbjct: 241 GIPDSLNGQYLRYNDERLG 259

>CAGL0F06919g complement(677473..678225) similar to sp|P40579
           Saccharomyces cerevisiae YIR035c or sp|P40580
           Saccharomyces cerevisiae YIR036c, start by similarity
          Length = 250

 Score =  269 bits (687), Expect = 7e-91,   Method: Compositional matrix adjust.
 Identities = 130/258 (50%), Positives = 177/258 (68%), Gaps = 9/258 (3%)

Query: 1   MGKVILITGASRGIGLQLVKTVIEEDDECIVYGVARTEAGLQSLQREYGADKFVYRVLDI 60
           M KV+L+TGASRGIG  +VK ++  D   +VYG+AR E  L+SL+   GA +F Y   DI
Sbjct: 1   MKKVVLVTGASRGIGEAIVKNILALDSNAVVYGIARNEDALKSLKDTVGA-RFQYLAGDI 59

Query: 61  TDRSRMEALVEEIRQKHGKLDGIVANAGMLEPVKSISQSNSEHDIKQWERLFDVNFFSIV 120
           TD  ++  +VE++  + G++D IVANAG+LEPV  +  S+    + +W++L+D+NFFSI+
Sbjct: 60  TDEDKINEIVEKVVLEQGRIDSIVANAGVLEPVAKVGSSS----VAEWKKLYDINFFSII 115

Query: 121 SLVALCLPLLKSSPFVGNIVFVSSGASVKPYNGWSAYGCSKAALNHFAMDIASEEPSDKV 180
            L+   LP L+ S   GN +FVSSGAS KPY GW AYG SKAA+NH  M +A+E  +  +
Sbjct: 116 HLINKTLPHLEKSE--GNAIFVSSGASTKPYYGWCAYGSSKAAVNHLTMSLAAENKA--I 171

Query: 181 RAVCIAPGVVDTQMQKDIRETLGPQGMTPKALERFTQLYKTSSLLDPKVPAAVLAQLVLK 240
           + + +APGVVDT+MQ DIR+  GP GMT  AL+RFT L K   LLD  VP  + A+L + 
Sbjct: 172 KTIAVAPGVVDTKMQDDIRDKFGPSGMTADALKRFTDLKKNGELLDADVPGKIYARLAVS 231

Query: 241 GIPDSLNGQYLRYNDERL 258
           GIP  LNG+Y+RYND RL
Sbjct: 232 GIPAELNGEYVRYNDSRL 249

>ACR171C [1218] [Homologous to ScYIR035C - SH; ScYIR036C - SH]
           (654580..654909,654959..655384) [756 bp, 251 aa]
          Length = 251

 Score =  266 bits (681), Expect = 5e-90,   Method: Compositional matrix adjust.
 Identities = 138/259 (53%), Positives = 182/259 (70%), Gaps = 12/259 (4%)

Query: 1   MGKVILITGASRGIGLQLVKTVIEEDDECIVYGVARTEAGLQSLQREYGADKFVYRVLDI 60
           M ++I++TG SRGIG  +V+ V  + D  +V GVAR+EA LQ L+  YG ++F Y V D+
Sbjct: 1   MPRLIIVTGVSRGIGRSVVEKVCRQPD-TVVLGVARSEAALQELRATYG-EQFEYVVGDV 58

Query: 61  TDRSRMEALVEEIRQKHGKLDGIVANAGMLEPVKSISQSNSEHDIKQWERLFDVNFFSIV 120
                 +ALV      +G++D +VANAG+LEPV+ ++      D+  W RL++VNFFS+V
Sbjct: 59  ASEDAQDALVARA-TAYGRIDAVVANAGVLEPVQDVNHI----DVAAWRRLYEVNFFSVV 113

Query: 121 SLVALCLPLLKSSPFVGNIVFVSSGASVKPYNGWSAYGCSKAALNHFAMDIASEEPSDKV 180
            LV   LPLLK +   G++VFVSSGAS K Y+ W AYG SKAALNHFAM +A+EEP+  V
Sbjct: 114 GLVGRALPLLKKAG--GSVVFVSSGASTKAYSAWGAYGSSKAALNHFAMTLAAEEPA--V 169

Query: 181 RAVCIAPGVVDTQMQKDIRETLGPQGMTPKALERFTQLYKTSSLLDPKVPAAVLAQLVLK 240
           RAV +APGVVDTQMQ DIR+  G + M P+AL RFT+L K S LLDP++PA + A L L+
Sbjct: 170 RAVAVAPGVVDTQMQNDIRDKFGHR-MAPEALRRFTELKKNSELLDPQIPATIFANLALR 228

Query: 241 GIPDSLNGQYLRYNDERLG 259
           GIPD  NG+YLRYND+ L 
Sbjct: 229 GIPDCANGKYLRYNDDILA 247

>YIR035C (YIR035C) [2699] chr9 complement(421023..421787) Member of
           the short-chain alcohol dehydrogenase family [765 bp,
           254 aa]
          Length = 254

 Score =  266 bits (679), Expect = 1e-89,   Method: Compositional matrix adjust.
 Identities = 135/258 (52%), Positives = 182/258 (70%), Gaps = 9/258 (3%)

Query: 1   MGKVILITGASRGIGLQLVKTVIEEDDECIVYGVARTEAGLQSLQREYGADKFVYRVLDI 60
           MGKVIL+TG SRGIG  +V  +   D + +VYGVAR+EA L+ L+ +YG D+F Y V DI
Sbjct: 1   MGKVILVTGVSRGIGKSIVDVLFSLDKDTVVYGVARSEAPLKKLKEKYG-DRFFYVVGDI 59

Query: 61  TDRSRMEALVEEIRQKHGKLDGIVANAGMLEPVKSISQSNSEHDIKQWERLFDVNFFSIV 120
           T+ S ++ LV    + HGK+D +VANAG+LEPV++++    E D+  W++L+D+NFFSIV
Sbjct: 60  TEDSVLKQLVNAAVKGHGKIDSLVANAGVLEPVQNVN----EIDVNAWKKLYDINFFSIV 115

Query: 121 SLVALCLPLLKSSPFVGNIVFVSSGASVKPYNGWSAYGCSKAALNHFAMDIASEEPSDKV 180
           SLV + LP LK +   GN+VFVSS A    ++ W AYG SKAALNHFAM +A+EE   +V
Sbjct: 116 SLVGIALPELKKTN--GNVVFVSSDACNMYFSSWGAYGSSKAALNHFAMTLANEE--RQV 171

Query: 181 RAVCIAPGVVDTQMQKDIRETLGPQGMTPKALERFTQLYKTSSLLDPKVPAAVLAQLVLK 240
           +A+ +APG+VDT MQ +IRE +GP  M+ + L+ F  L + + LLD  VPA V A+L L 
Sbjct: 172 KAIAVAPGIVDTDMQVNIRENVGPSSMSAEQLKMFRGLKENNQLLDSSVPATVYAKLALH 231

Query: 241 GIPDSLNGQYLRYNDERL 258
           GIPD +NGQYL YND  L
Sbjct: 232 GIPDGVNGQYLSYNDPAL 249

>Scas_628.6
          Length = 252

 Score =  260 bits (665), Expect = 1e-87,   Method: Compositional matrix adjust.
 Identities = 133/257 (51%), Positives = 180/257 (70%), Gaps = 10/257 (3%)

Query: 3   KVILITGASRGIGLQLVKTVIEEDDECIVYGVARTEAGLQSLQREYGADKFVYRVLDITD 62
           KVI++TG SRGIG  +V  +I  +   +V+G+ART A L+ L+ ++G +KF Y V D+T+
Sbjct: 4   KVIIVTGVSRGIGRAIVNKIIGLNSNAVVFGIARTSAPLKELKSKHG-EKFFYIVGDVTN 62

Query: 63  RSRMEALVEEIRQKHGKLDGIVANAGMLEPVKSISQSNSEHDIKQWERLFDVNFFSIVSL 122
           +S ++ L+     K G+LD +VANAG+LEPV  + + + E     W+RLFD+NFFSIVSL
Sbjct: 63  KSDVKKLITAAIDKFGRLDSVVANAGVLEPVAEVGKVDEE----AWKRLFDINFFSIVSL 118

Query: 123 VALCLPLLKSSPFVGNIVFVSSGASVKPYNGWSAYGCSKAALNHFAMDIASEEPSDKVRA 182
           V   LP ++++    N VFVSSGASVK Y GW+AY  SKAALN FAM +A+E+P  KV+ 
Sbjct: 119 VQSTLPFMENTN--RNYVFVSSGASVKAYFGWAAYSASKAALNSFAMSVANEKP--KVKT 174

Query: 183 VCIAPGVVDTQMQKDIRETLGPQGMTPKALERFTQLYKTSSLLDPKVPAAVLAQLVLKGI 242
           + +APGVVDTQMQ DIRE  G + MT ++L+RF  L+K   LLD  VP  V A+L + GI
Sbjct: 175 ISVAPGVVDTQMQVDIREKYGNE-MTTESLKRFIDLHKNGELLDSDVPGEVYAKLAVNGI 233

Query: 243 PDSLNGQYLRYNDERLG 259
           PD LNG+Y RYND+RL 
Sbjct: 234 PDELNGKYSRYNDDRLA 250

>CAGL0F06897g complement(675416..676192) highly similar to sp|P40579
           Saccharomyces cerevisiae YIR035c, hypothetical start
          Length = 258

 Score =  253 bits (646), Expect = 1e-84,   Method: Compositional matrix adjust.
 Identities = 128/256 (50%), Positives = 178/256 (69%), Gaps = 9/256 (3%)

Query: 3   KVILITGASRGIGLQLVKTVIEEDDECIVYGVARTEAGLQSLQREYGADKFVYRVLDITD 62
           KVIL+TG SRGIG  +V T+   D   IVYG+AR+EA L++L+  YG D+F Y V DIT+
Sbjct: 7   KVILVTGVSRGIGKSIVDTLFSLDKNVIVYGIARSEAPLKALKDTYG-DRFFYTVGDITN 65

Query: 63  RSRMEALVEEIRQKHGKLDGIVANAGMLEPVKSISQSNSEHDIKQWERLFDVNFFSIVSL 122
              ++  V    + HGK++ ++ANAG+LEPV++I+      D+  W++L+++NFFSIVSL
Sbjct: 66  DDTLKKYVNSAIEGHGKINSLIANAGVLEPVQNINNI----DVNAWKQLYNINFFSIVSL 121

Query: 123 VALCLPLLKSSPFVGNIVFVSSGASVKPYNGWSAYGCSKAALNHFAMDIASEEPSDKVRA 182
           V + LP LK +   G+ +FVSS AS   ++ W AYG SKAALNHFAM +A+EE +  VRA
Sbjct: 122 VDIALPHLKKTH--GSALFVSSDASDTYFSSWGAYGSSKAALNHFAMTLANEEKA--VRA 177

Query: 183 VCIAPGVVDTQMQKDIRETLGPQGMTPKALERFTQLYKTSSLLDPKVPAAVLAQLVLKGI 242
           + +APG+VDT MQ +IRE LGPQGM+ + LE F  L K + LL   +PA V ++L L GI
Sbjct: 178 LAVAPGIVDTDMQVNIRENLGPQGMSQEHLEMFRDLKKDNKLLHSSIPATVYSKLALNGI 237

Query: 243 PDSLNGQYLRYNDERL 258
           P+ +NGQYL ++ E L
Sbjct: 238 PEEINGQYLSFDAEVL 253

>Scas_685.8
          Length = 252

 Score =  240 bits (612), Expect = 2e-79,   Method: Compositional matrix adjust.
 Identities = 123/258 (47%), Positives = 177/258 (68%), Gaps = 10/258 (3%)

Query: 1   MGKVILITGASRGIGLQLVKTVIEEDDECIVYGVARTEAGLQSLQREYGADKFVYRVLDI 60
           MGKVI++TG SRGIG  +V+ + +   + IVYG+AR+EA L++L+  YG D+F Y   DI
Sbjct: 1   MGKVIIVTGVSRGIGKSIVERIFKLSSDAIVYGIARSEAPLKALKETYG-DRFFYVTGDI 59

Query: 61  TDRSRMEALVEEIRQKHGKLDGIVANAGMLEPVKSISQSNSEHDIKQWERLFDVNFFSIV 120
           TD+  ++ LV+   ++ GK+D +VANAG+LEPV+ ++      DI  W++LFD+NFFS+V
Sbjct: 60  TDQVALQKLVDGAAKEQGKIDSVVANAGVLEPVQDVNHI----DIDAWKKLFDINFFSVV 115

Query: 121 SLVALCLPLLKSSPFVGNIVFVSSGASVKPYNGWSAYGCSKAALNHFAMDIASEEPSDKV 180
           SL ++ LP LK +   GNIVFVSS AS   ++ W AY  SKA LN FAM +A+EEP+  V
Sbjct: 116 SLTSITLPYLKKTN--GNIVFVSSDASDMHFSSWGAYSASKACLNRFAMTVANEEPA--V 171

Query: 181 RAVCIAPGVVDTQMQKDIRETLGPQGMTPKALERFTQLYKTSSLLDPKVPAAVLAQLVLK 240
           + + +APG+VDT MQ +IRE +G + MT +    F  L +++ LLD  VPA V ++L L 
Sbjct: 172 KCLSVAPGIVDTSMQVNIRENVG-KDMTSEDHAMFKDLKESNKLLDSNVPATVYSKLALN 230

Query: 241 GIPDSLNGQYLRYNDERL 258
           GIP  +NG+YL ++D  L
Sbjct: 231 GIPVDVNGKYLSFDDPIL 248

>ABR247W [841] [Homologous to ScYIR035C - NSH; ScYIR036C - NSH]
           complement(858589..859341) [753 bp, 250 aa]
          Length = 250

 Score =  178 bits (452), Expect = 2e-55,   Method: Compositional matrix adjust.
 Identities = 104/261 (39%), Positives = 156/261 (59%), Gaps = 21/261 (8%)

Query: 3   KVILITGASRGIGLQLVKTVIEEDDECIVYGVARTEAGLQSLQREYGADKFVYRVLDITD 62
           +V+++TGASRGIG   V+ +    D  +V GVAR E  LQ L+  +G  KF Y V D+TD
Sbjct: 2   RVVIVTGASRGIGEATVEKLCPTAD-VVVVGVARAETKLQKLKARHG-KKFDYVVGDVTD 59

Query: 63  RSRMEALVEEIRQKHGKLDGIVANAGMLEPVKSISQSNSEHDIKQWERLFDVNFFSIVSL 122
              ++A+++++  ++G+LD +VANAG+     S  +  +  DIK+W RLF++N FS+V+L
Sbjct: 60  ERVVQAVIDKVSSEYGRLDAVVANAGV-----SRHERIATADIKEWRRLFEINLFSVVNL 114

Query: 123 VALCLPLLKSSPFVGNIVFVSSGASVKPYNGWSAYGCSKAALNHFAMDIASEEPSDKVRA 182
           V+  LPLL+ S   G ++ VSSG S   +   +AY  SK ALNHFA+ +A EEP  ++R 
Sbjct: 115 VSKALPLLRESQ--GTVIVVSSGLSQMGHPALAAYASSKIALNHFALILAMEEP--EIRT 170

Query: 183 VCIAPGVVDTQMQKD----IRETLGPQGMTPKALERFTQLYKTSSLLDPKVPAAVLAQLV 238
           + + PG V T M  +      E  G Q    +      +L K   +  P+ P AVLA L 
Sbjct: 171 IALDPGAVQTDMLAEGINAADEAAGSQDNAVR------ELLKQVRVATPEEPGAVLAALA 224

Query: 239 LKGIPDSLNGQYLRYNDERLG 259
            +GIP+ LNG+Y+R + E+L 
Sbjct: 225 ARGIPEELNGKYVRADSEKLA 245

>ABR249W [843] [Homologous to ScYIR035C - NSH; ScYIR036C - NSH]
           complement(861237..861989) [753 bp, 250 aa]
          Length = 250

 Score =  175 bits (443), Expect = 4e-54,   Method: Compositional matrix adjust.
 Identities = 103/257 (40%), Positives = 152/257 (59%), Gaps = 13/257 (5%)

Query: 3   KVILITGASRGIGLQLVKTVIEEDDECIVYGVARTEAGLQSLQREYGADKFVYRVLDITD 62
           KVI++TGASRGIG   V  +    D  +V GVAR E  LQ L+  +G  KF Y V D+TD
Sbjct: 2   KVIIVTGASRGIGAATVDRLCSTPD-VVVVGVARAETKLQELKARHG-KKFDYVVGDVTD 59

Query: 63  RSRMEALVEEIRQKHGKLDGIVANAGMLEPVKSISQSNSEHDIKQWERLFDVNFFSIVSL 122
              ++A+++++  ++G+LD +VANAG+     S  Q  +E DIK+W RLF++N FS+V+L
Sbjct: 60  ERVVQAVIDKVSSEYGRLDAVVANAGV-----SYQQRIAEADIKEWRRLFEINLFSVVNL 114

Query: 123 VALCLPLLKSSPFVGNIVFVSSGASVKPYNGWSAYGCSKAALNHFAMDIASEEPSDKVRA 182
            +  LPLL+ S   G  + V+SG S   +   +AY  SK ALNHFA+ +A EE   ++R+
Sbjct: 115 ASKALPLLRKSQ--GAFIAVTSGLSQMGHPALAAYASSKIALNHFALILAMEET--EIRS 170

Query: 183 VCIAPGVVDTQMQKDIRETLGPQGMTPKALERFTQLYKTSSLLDPKVPAAVLAQLVLKGI 242
           + + PG+V T M             T     R  +L K   ++ P+ P  VLA L  KGI
Sbjct: 171 LALDPGLVQTDMTAAALVAADKAAGTQDNSVR--ELTKQIRMVSPEEPGTVLAALAAKGI 228

Query: 243 PDSLNGQYLRYNDERLG 259
           P+ LNG+Y+ ++ E+L 
Sbjct: 229 PEELNGKYVTFDSEKLA 245

>ABR246W [840] [Homologous to ScYIR035C - NSH; ScYIR036C - NSH]
           complement(857415..858167) [753 bp, 250 aa]
          Length = 250

 Score =  166 bits (419), Expect = 2e-50,   Method: Compositional matrix adjust.
 Identities = 105/260 (40%), Positives = 158/260 (60%), Gaps = 16/260 (6%)

Query: 1   MGKVILITGASRGIGLQLVKTVIEEDDECIVYGVARTEAGLQSLQREYGADKFVYRVLDI 60
           M +VI++TGASRGIG   V+ +    D  +V GVAR E  L+ L+  YG+ KF Y   D+
Sbjct: 1   MVRVIIVTGASRGIGEATVEKLCTAPD-VVVVGVARAEKTLKVLKERYGS-KFDYVAGDV 58

Query: 61  TDRSRMEALVEEIRQKHGKLDGIVANAGMLEPVKSISQSNSEHDIKQWERLFDVNFFSIV 120
           TD S ++A+++++   +G+LD I+ANAG+     S  +  +E DI+QW+R F++   S V
Sbjct: 59  TDESVVQAVLDKVSSDYGRLDAIIANAGV-----SRFERIAEADIQQWKRTFEI-IVSAV 112

Query: 121 SLVALCLPLLKSSPFVGNIVFVSSGASVKPYNGWSAYGCSKAALNHFAMDIASEEPSDKV 180
           SLV+  LP+L+ S   G ++ V+SG S   Y   ++   SK ALNHF   +A+EEP+  +
Sbjct: 113 SLVSKALPMLRKSQ--GTVIVVTSGLSKVGYRASASSASSKIALNHFIRILAAEEPA--L 168

Query: 181 RAVCIAPGVVDTQMQKDIRETLGPQGMTPKALERFTQ-LYKTSSLLDPKVPAAVLAQLVL 239
           RAV +APGVV T M     E L      P A + F + + K   ++ P  P AVLA L +
Sbjct: 169 RAVAVAPGVVRTDMTV---EALDASEDAPGARDNFFKAVLKQGRVVLPDAPGAVLAALAV 225

Query: 240 KGIPDSLNGQYLRYNDERLG 259
           KGIP  LNG++++++ E+L 
Sbjct: 226 KGIPQELNGRFVQFDSEKLA 245

>ABR248W [842] [Homologous to ScYIR035C - NSH; ScYIR036C - NSH]
           complement(859663..860448) [786 bp, 261 aa]
          Length = 261

 Score =  164 bits (416), Expect = 8e-50,   Method: Compositional matrix adjust.
 Identities = 101/261 (38%), Positives = 146/261 (55%), Gaps = 21/261 (8%)

Query: 3   KVILITGASRGIGLQLVKTVIEEDDECIVYGVARTEAGLQSLQREYGADKFVYRVLDITD 62
           KVI++TGASRGIG   V  +     E +V GVAR E  LQ L+  +G  KF Y V D+TD
Sbjct: 13  KVIIVTGASRGIGAATVDRLCSTP-EVVVVGVARAETKLQELKARHG-KKFDYVVGDVTD 70

Query: 63  RSRMEALVEEIRQKHGKLDGIVANAGMLEPVKSISQSNSEHDIKQWERLFDVNFFSIVSL 122
              ++A+++++   +G+LD +VANAG+     +  +   + DIK+W RLF++N FS+V+L
Sbjct: 71  ERVVQAVIDKVSSGYGRLDAVVANAGV-----AGHERIEDADIKEWRRLFEINLFSVVNL 125

Query: 123 VALCLPLLKSSPFVGNIVFVSSGASVKPYNGWSAYGCSKAALNHFAMDIASEEPSDKVRA 182
            +  LPLL+ S   G  + VSS  S       + Y  SK ALNHFAM +A EEP  ++R 
Sbjct: 126 ASKALPLLRKSQ--GAFLVVSSMLSQMGVPAVATYASSKIALNHFAMILAMEEP--EIRT 181

Query: 183 VCIAPGVVDTQMQKD----IRETLGPQGMTPKALERFTQLYKTSSLLDPKVPAAVLAQLV 238
           + + PGV  T M  D      +  G Q    + + R  ++        P  P  VLA L 
Sbjct: 182 IALDPGVAQTDMLTDGLNAADQAAGTQDNAAREMMRHVRVAS------PDEPGTVLAALA 235

Query: 239 LKGIPDSLNGQYLRYNDERLG 259
            KGIP+ LNG+++ Y+ E L 
Sbjct: 236 AKGIPEELNGKFVVYDSEELA 256

>Sklu_2380.4 YIR035C, Contig c2380 9858-10340
          Length = 160

 Score =  145 bits (367), Expect = 9e-44,   Method: Compositional matrix adjust.
 Identities = 79/152 (51%), Positives = 107/152 (70%), Gaps = 8/152 (5%)

Query: 1   MGKVILITGASRGIGLQLVKTVIEE-DDECIVYGVARTEAGLQSLQREYGADKFVYRVLD 59
           M KV+L+TGASRGIG  +V  +  + + E +V G+AR+E  L +++  +G DKF Y + D
Sbjct: 1   MAKVVLVTGASRGIGQAIVNNLCNDGNSEVVVVGIARSEGPLSAIKGVHG-DKFEYIIGD 59

Query: 60  ITDRSRMEALVEEIRQKHGKLDGIVANAGMLEPVKSISQSNSEHDIKQWERLFDVNFFSI 119
           I+D   ++  VE   +K G++D +VANAG+LEPV+ ++      D+ QW+RLFDVNFFSI
Sbjct: 60  ISDEEVLKKYVEYAIKKFGRIDAVVANAGVLEPVQDVNNI----DVAQWKRLFDVNFFSI 115

Query: 120 VSLVALCLPLLKSSPFVGNIVFVSSGASVKPY 151
           VSLV+L LP LK   F GNIVFVSSGAS KPY
Sbjct: 116 VSLVSLSLPHLKK--FNGNIVFVSSGASTKPY 145

>KLLA0E08052g complement(725895..726248) similar to sp|P40580
           Saccharomyces cerevisiae YIR036c, hypothetical start
          Length = 117

 Score =  140 bits (353), Expect = 3e-42,   Method: Compositional matrix adjust.
 Identities = 65/106 (61%), Positives = 78/106 (73%), Gaps = 2/106 (1%)

Query: 153 GWSAYGCSKAALNHFAMDIASEEPSDKVRAVCIAPGVVDTQMQKDIRETLGPQGMTPKAL 212
           GW AYG SKAALNHFA  IA+EEP+  V+A+ +APGVV T+MQ+DIRET GP GMT +AL
Sbjct: 9   GWGAYGASKAALNHFAATIAAEEPA--VKAISVAPGVVKTKMQEDIRETFGPSGMTKEAL 66

Query: 213 ERFTQLYKTSSLLDPKVPAAVLAQLVLKGIPDSLNGQYLRYNDERL 258
           +RF  L+    LL P VP  + A L  KGIP  L+G YLRYNDE+L
Sbjct: 67  QRFVDLHDNDQLLPPSVPGTIYANLASKGIPSELDGAYLRYNDEKL 112

>KLLA0E08063g complement(726232..726792) some similarities with
           sp|P40579 Saccharomyces cerevisiae YIR035c, hypothetical
           start
          Length = 186

 Score =  128 bits (322), Expect = 1e-36,   Method: Compositional matrix adjust.
 Identities = 73/151 (48%), Positives = 100/151 (66%), Gaps = 7/151 (4%)

Query: 1   MGKVILITGASRGIGLQLVKTVIEEDDECIVYGVARTEAGLQSLQREYGADKFVYRVLDI 60
           M KV L+TG SRGIG  +V+ +   +   IV G+AR++  L+ L+ +Y + KF Y   D+
Sbjct: 1   MSKVFLVTGVSRGIGSSIVEKLCSIETTKIVIGIARSKDKLEELKTQY-SGKFDYICGDV 59

Query: 61  TDRSRMEALVEEIRQKHGKLDGIVANAGMLEPVKSISQSNSEHDIKQWERLFDVNFFSIV 120
           +D   +   V  I  K+ +LDGIVANAG+L+PV+ +   N+ H I +W++LFD+NFFS+V
Sbjct: 60  SDEETITEAVNFIESKYKRLDGIVANAGVLDPVEDV---NNIH-ISKWKQLFDINFFSVV 115

Query: 121 SLVALCLPLLKSSPFVGNIVFVSSGASVKPY 151
           SLV   LPLLK S   GNIV VSSGAS K Y
Sbjct: 116 SLVGHALPLLKQSN--GNIVLVSSGASTKSY 144

>AER373C [2874] [Homologous to ScYIL124W (AYR1) - SH]
           (1327314..1328216) [903 bp, 300 aa]
          Length = 300

 Score = 75.1 bits (183), Expect = 1e-15,   Method: Compositional matrix adjust.
 Identities = 58/195 (29%), Positives = 97/195 (49%), Gaps = 11/195 (5%)

Query: 2   GKVILITGASRGIGLQLVKTVIEEDDECIVYGVARTEAGLQSLQREYGADKFVYRVLDIT 61
            KV+L+TGAS GIG +L K +       +VY  AR+   +++L+ + G +K +   LD+T
Sbjct: 14  AKVVLVTGASSGIGYELTKELANRG--YVVYAAARSIEPIEALRDKCGPEKVIPVQLDVT 71

Query: 62  DRSRMEALVEEIRQK--HGKLDGIVANAGMLEPVKSISQSNSEHDIKQWERLFDVNFFSI 119
           D  ++  L   + ++   GKL  +  NAG     +S +    +   +  E+ F VN F+ 
Sbjct: 72  DEEQVTKLRRRMSKEIPGGKLHALFNNAG-----QSCTMPAVDVTPEMIEKCFRVNVFAP 126

Query: 120 VSLVALCLPLLKSSPFVGNIVFVSSGASVKPYNGWSAYGCSKAALNHFAMDIASEEPSDK 179
           +++     PLL  +   G IVF  S A + P+   S Y  +KAA++ +A  +  E     
Sbjct: 127 MNITREFAPLLIRAH--GTIVFTGSLAGIIPFPFGSVYSATKAAVHQYARVLHLELKPFG 184

Query: 180 VRAVCIAPGVVDTQM 194
           VR +    G V T +
Sbjct: 185 VRVINAVTGGVATNI 199

>AFR561W [3753] [Homologous to ScYMR226C - SH]
           complement(1438981..1439784) [804 bp, 267 aa]
          Length = 267

 Score = 71.6 bits (174), Expect = 2e-14,   Method: Compositional matrix adjust.
 Identities = 61/197 (30%), Positives = 97/197 (49%), Gaps = 10/197 (5%)

Query: 3   KVILITGASRGIGLQLVKTVIEEDDECI-VYGVARTEAGLQSLQRE----YGADKFVYRV 57
           K++L+TGAS GIG        +  D  I +  VAR    L SL++E    Y   K     
Sbjct: 14  KIVLVTGASAGIGRATAINYADATDGAIKLILVARRAEKLTSLKQEIESKYPNAKIHVGQ 73

Query: 58  LDITDRSRMEALVEEIRQKHGKLDGIVANAGMLEPVKSISQSNSEHDIKQWERLFDVNFF 117
           LD+T   ++   +E + ++   +D ++ NAG     + + +  S  DI++   +F+ N  
Sbjct: 74  LDVTQLDQIRPFLEGLPEEFRDIDILINNAGKALGTERVGEI-SMDDIQE---VFNTNVI 129

Query: 118 SIVSLVALCLPLLKSSPFVGNIVFVSSGASVKPYNGWSAYGCSKAALNHFAMDIASEEPS 177
            +V L    LP++K+    G+IV V S A  + Y G S Y  +K A+  F   +  E  S
Sbjct: 130 GLVHLTQEVLPIMKAKN-SGDIVNVGSIAGREAYPGGSIYCATKHAVKAFTRAMRKELIS 188

Query: 178 DKVRAVCIAPGVVDTQM 194
            K+R   IAPG V+T+ 
Sbjct: 189 TKIRVFEIAPGSVETEF 205

>KLLA0D15521g 1311601..1312371 similar to sp|Q8TTF8 Methanosarcina
           acetivorans Cyclohexanol dehydrogenase, start by
           similarity
          Length = 256

 Score = 70.5 bits (171), Expect = 3e-14,   Method: Compositional matrix adjust.
 Identities = 53/204 (25%), Positives = 97/204 (47%), Gaps = 7/204 (3%)

Query: 2   GKVILITGASRGIGLQLVKTVIEEDDECIVYGVARTEAGLQSLQREYGADKFVYRVLDIT 61
           GK+ L+TGAS G+G  + + +       ++     +E    +   +    + + + +D+T
Sbjct: 8   GKIALVTGASTGVGEGIARALFVRGATVVITSRHLSEVQETAGNIDPSGSRVIGKEVDVT 67

Query: 62  DRSRMEALVEEIRQKHGKLDGIVANAGMLEPVKSISQSNSEHDIKQWERLFDVNFFSIVS 121
               +E L++EIR++ G L  +V NAG+  P ++      ++DI  W ++ D N      
Sbjct: 68  VAKAVEDLIQEIREEFGALHYLVNNAGITGPHQT---GIEDYDIDSWRQVIDTNINGTFY 124

Query: 122 LVALCLPLLKSSPFVGN---IVFVSSGASVKPYNGWSAYGCSKAALNHFAMDIASEEPSD 178
            +   LPL++SS    +   +V +S+   +    G S Y  +K A+      +A E    
Sbjct: 125 TLKYALPLMESSSSPDSEAAVVNLSAVNGLVGIPGISPYTATKHAVIGITQSVALEYAER 184

Query: 179 KVRAVCIAPGVVDT-QMQKDIRET 201
            VR   +APG V T ++Q   +ET
Sbjct: 185 NVRVNAVAPGYVSTPKIQALPKET 208

>YMR226C (YMR226C) [4182] chr13 complement(721592..722395)
           NADP+-dependent L-allo-threonine dehydrogenase, member
           of the short-chain dehydrogenase-reductase family, which
           are NAD- or NADP-dependent oxidoreductases [804 bp, 267
           aa]
          Length = 267

 Score = 70.5 bits (171), Expect = 4e-14,   Method: Compositional matrix adjust.
 Identities = 59/198 (29%), Positives = 97/198 (48%), Gaps = 12/198 (6%)

Query: 3   KVILITGASRGIGLQLVKTVIEED--DECIVYGVARTEAGLQSLQR----EYGADKFVYR 56
           K +LITGAS GIG       +E    D  ++    R E  L+ L++    E+   K    
Sbjct: 14  KTVLITGASAGIGKATALEYLEASNGDMKLILAARRLEK-LEELKKTIDQEFPNAKVHVA 72

Query: 57  VLDITDRSRMEALVEEIRQKHGKLDGIVANAGMLEPVKSISQSNSEHDIKQWERLFDVNF 116
            LDIT   +++  +E + Q+   +D +V NAG       + Q  +E DI+    +FD N 
Sbjct: 73  QLDITQAEKIKPFIENLPQEFKDIDILVNNAGKALGSDRVGQIATE-DIQD---VFDTNV 128

Query: 117 FSIVSLVALCLPLLKSSPFVGNIVFVSSGASVKPYNGWSAYGCSKAALNHFAMDIASEEP 176
            +++++    LP+ ++    G+IV + S A    Y   S Y  SK A+  F   +  E  
Sbjct: 129 TALINITQAVLPIFQAKN-SGDIVNLGSIAGRDAYPTGSIYCASKFAVGAFTDSLRKELI 187

Query: 177 SDKVRAVCIAPGVVDTQM 194
           + K+R + IAPG+V+T+ 
Sbjct: 188 NTKIRVILIAPGLVETEF 205

>KLLA0E09834g complement(872888..873694) similar to sp|Q9ALU7
           Enterobacter cloacae Putative oxidoreductase, start by
           similarity
          Length = 268

 Score = 69.3 bits (168), Expect = 1e-13,   Method: Compositional matrix adjust.
 Identities = 56/192 (29%), Positives = 95/192 (49%), Gaps = 13/192 (6%)

Query: 3   KVILITGASRGIGLQLVKTVIEEDDECIVYGVARTEAGLQSLQREYGADKFVYRVLDITD 62
           +VILITGAS GIGL + +T+     E  V+G +R  +      +EY    F    LDITD
Sbjct: 4   QVILITGASTGIGLSIAETLRSAGYE--VFGTSRKGS---IPGKEYS---FKMIKLDITD 55

Query: 63  RSRMEALVEEIRQKHGKLDGIVANAGMLEPVKSISQSNSEHDIKQWERLFDVNFFSIVSL 122
              +++ V E+ +K G++D +V NAG+     ++ + ++  D+ +   +F+ NFF +  +
Sbjct: 56  EESVKSAVNEVIEKAGRIDVLVNNAGIAFKWAAVEECST--DLAK--TIFETNFFGVHRM 111

Query: 123 VALCLPLLKSSPFVGNIVFVSSGASVKPYNGWSAYGCSKAALNHFAMDIASEEPSDKVRA 182
               LP ++     G I+ +SS   + P    + Y  SK AL  +   +  E     +  
Sbjct: 112 TRAVLPHMREQRH-GKIINISSMGGIMPIPYGALYCSSKHALEGYTESLDYEVKKFGIHV 170

Query: 183 VCIAPGVVDTQM 194
             I P ++ T M
Sbjct: 171 STIDPHIIKTGM 182

>Sklu_1578.3 YMR226C, Contig c1578 1774-2580
          Length = 268

 Score = 66.6 bits (161), Expect = 9e-13,   Method: Compositional matrix adjust.
 Identities = 57/204 (27%), Positives = 97/204 (47%), Gaps = 24/204 (11%)

Query: 3   KVILITGASRGIGLQLVKTVIEEDDEC-----IVYGVARTEAGLQSLQ----REYGADKF 53
           K + ITGAS GIG     T +E  D       +V    R E  LQ L+    +EY   K 
Sbjct: 14  KTVFITGASAGIGQA---TALEYCDASNGKINLVLSARRLEK-LQELKDKITKEYPEAKV 69

Query: 54  VYRVLDITDRSRMEALVEEIRQKHGKLDGIVANAGML---EPVKSISQSNSEHDIKQWER 110
              VLD+T+  +++  ++ + ++   +D ++ NAG     +PV +I   +        E 
Sbjct: 70  YIGVLDVTETEKIKPFLDGLPEEFKDIDILINNAGKALGSDPVGTIKTED-------IEG 122

Query: 111 LFDVNFFSIVSLVALCLPLLKSSPFVGNIVFVSSGASVKPYNGWSAYGCSKAALNHFAMD 170
           + + N  +++++    LP+ K+  F G+IV + S A    Y   + Y  SK A+  F   
Sbjct: 123 MINTNVLALINITQAVLPIFKAKNF-GDIVNLGSVAGRDAYPTGAIYCASKHAVRAFTQS 181

Query: 171 IASEEPSDKVRAVCIAPGVVDTQM 194
           +  E  +  +R + IAPG V+T+ 
Sbjct: 182 LRKELVNTNIRVIEIAPGNVETEF 205

>Kwal_14.2444
          Length = 288

 Score = 64.7 bits (156), Expect = 5e-12,   Method: Compositional matrix adjust.
 Identities = 56/194 (28%), Positives = 98/194 (50%), Gaps = 12/194 (6%)

Query: 3   KVILITGASRGIGLQLVKTVIEEDDECIVYGVARTEAGLQSLQREYGADKFVYRVLDITD 62
           KV ++TGAS GIG +L + +  +  +  VY  AR E  L++L +E+  +  V   LD+++
Sbjct: 5   KVAVVTGASSGIGYELTRQLASKGYK--VYAAARREQRLETLAKEF-PELVVPVKLDVSE 61

Query: 63  RSRMEALVEEIRQK--HGKLDGIVANAGMLEPVKSISQSNSEHDIKQWERLFDVNFFSIV 120
             ++  L E + ++    KLD +  NAG      +   S+  +D+   E+ F VN F  V
Sbjct: 62  PEQIIHLRERLAKELPSQKLDVLYNNAGQ---SCTFPASDVTNDV--LEQAFKVNVFGPV 116

Query: 121 SLVALCLPLLKSSPFVGNIVFVSSGASVKPYNGWSAYGCSKAALNHFAMDIASEEPSDKV 180
           +L    LP +  +   G ++F  S A + P+   S Y  +K A++ +A  + +E     V
Sbjct: 117 NLCKELLPFVIKAK--GTVLFTGSVAGLMPFPFGSIYSATKGAIHSYARCLHTEMKPFGV 174

Query: 181 RAVCIAPGVVDTQM 194
           R + +  G V T +
Sbjct: 175 RVLNVVTGGVKTDI 188

>Kwal_26.9160
          Length = 267

 Score = 63.5 bits (153), Expect = 1e-11,   Method: Compositional matrix adjust.
 Identities = 52/201 (25%), Positives = 95/201 (47%), Gaps = 16/201 (7%)

Query: 2   GKVILITGASRGIGLQLVKTVIEEDDECI-VYGVARTEAGLQSLQREYGAD----KFVYR 56
           GK +LITGAS GIG       ++  +  I +   AR    L+ ++ ++  D    K    
Sbjct: 13  GKTVLITGASAGIGQATALEYLDASNGNIKLILAARRLEKLKEIKSQFEKDFPEAKVYIG 72

Query: 57  VLDITDRSRMEALVEEIRQKHGKLDGIVANAGML---EPVKSISQSNSEHDIKQWERLFD 113
            LD+T    ++  ++ + ++   +D ++ NAG     +PV +I  S+        E +  
Sbjct: 73  QLDVTHTDEIKPFIDNLPEEFKDIDILINNAGKALGSDPVGTIDASD-------IEGMIQ 125

Query: 114 VNFFSIVSLVALCLPLLKSSPFVGNIVFVSSGASVKPYNGWSAYGCSKAALNHFAMDIAS 173
            N  +++++    LP+ K+    G+IV + S A  + Y   S Y  +K A+  F   +  
Sbjct: 126 TNVVALINMTQAVLPIFKAKN-AGDIVNLGSVAGREAYPTGSIYCATKHAVRAFTQSLRK 184

Query: 174 EEPSDKVRAVCIAPGVVDTQM 194
           E  +  +R + IAPG V+T+ 
Sbjct: 185 ELINTNIRVIEIAPGNVETEF 205

>Scas_594.12
          Length = 267

 Score = 63.5 bits (153), Expect = 1e-11,   Method: Compositional matrix adjust.
 Identities = 53/198 (26%), Positives = 95/198 (47%), Gaps = 12/198 (6%)

Query: 3   KVILITGASRGIGLQLVKTVIEEDDECI-VYGVARTEAGLQSLQR----EYGADKFVYRV 57
           K++ ITGAS GIG       ++  +  + +  VAR    LQ L+     +Y   K     
Sbjct: 14  KIVFITGASAGIGQATALEYMDASNGTVKLVLVARRLEKLQQLKEVIEAKYPKSKVYIGK 73

Query: 58  LDITDRSRMEALVEEIRQKHGKLDGIVANAGMLEPVKSI-SQSNSEHDIKQWERLFDVNF 116
           LD+T+   ++  ++ + ++   +D ++ NAG     K++ S    + DIK  + + D N 
Sbjct: 74  LDVTELETIQPFLDNLPEEFKDIDILINNAG-----KALGSDRVGDIDIKDVKGMMDTNV 128

Query: 117 FSIVSLVALCLPLLKSSPFVGNIVFVSSGASVKPYNGWSAYGCSKAALNHFAMDIASEEP 176
             ++++    L + +     G+IV + S A    Y   S Y  SK A+  F   +  E  
Sbjct: 129 LGLINVTQAVLHIFQKKN-SGDIVNLGSVAGRDAYPTGSIYCASKFAVRAFTESLRRELI 187

Query: 177 SDKVRAVCIAPGVVDTQM 194
           + K+R + IAPG+V+T+ 
Sbjct: 188 NTKIRVILIAPGIVETEF 205

>KLLA0B08371g complement(747517..748323) highly similar to sp|Q05016
           Saccharomyces cerevisiae YMR226c, start by similarity
          Length = 268

 Score = 63.2 bits (152), Expect = 1e-11,   Method: Compositional matrix adjust.
 Identities = 55/197 (27%), Positives = 94/197 (47%), Gaps = 10/197 (5%)

Query: 3   KVILITGASRGIGLQLVKTVIEEDDECI-VYGVARTEAGLQSLQR----EYGADKFVYRV 57
           K I ITGAS GIG       ++  +  + +   AR  A L+ L+     EY   K     
Sbjct: 14  KTIFITGASAGIGQATALEYLDAANGNVKLILAARRLAKLEELKEKINAEYPQAKVYIGQ 73

Query: 58  LDITDRSRMEALVEEIRQKHGKLDGIVANAGMLEPVKSISQSNSEHDIKQWERLFDVNFF 117
           LD+T+  +++  ++ + ++   +D ++ NAG       +   +SE DIK    + D N  
Sbjct: 74  LDVTETEKIQPFIDNLPEEFKDIDILINNAGKALGSDVVGTISSE-DIKG---MIDTNVV 129

Query: 118 SIVSLVALCLPLLKSSPFVGNIVFVSSGASVKPYNGWSAYGCSKAALNHFAMDIASEEPS 177
           +++++    LP+ K+    G+IV + S A    Y   S Y  SK A+  F   +  E  +
Sbjct: 130 ALINVTQAVLPIFKAKN-SGDIVNLGSVAGRDAYPTGSIYCASKHAVRAFTQSLRKELIN 188

Query: 178 DKVRAVCIAPGVVDTQM 194
             +R + IAPG V+T+ 
Sbjct: 189 TGIRVIEIAPGNVETEF 205

>KLLA0F04455g complement(428010..428927) similar to sp|P40471
           Saccharomyces cerevisiae YIL124w AYR1
           1-Acyldihydroxyacetone-phosphate reductase, hypothetical
           start
          Length = 305

 Score = 63.2 bits (152), Expect = 2e-11,   Method: Compositional matrix adjust.
 Identities = 65/234 (27%), Positives = 110/234 (47%), Gaps = 18/234 (7%)

Query: 3   KVILITGASRGIGLQLVKTVIEEDDECIVYGVARTEAGLQSLQREYGADKFVYRVLDITD 62
           K  L+TGAS GIG ++ K ++       VY  AR    ++ L+ E+G D+ + R LD+++
Sbjct: 5   KYALVTGASSGIGYEVTKELLRRG--WYVYACARRTHPMEELRAEFG-DRCIPRKLDVSN 61

Query: 63  RSRMEALVEEIRQK--HGKLDGIVANAGMLEPVKSISQSNSEHDIKQWERLFDVNFFSIV 120
           ++ +  L  ++ Q+    KL  +  NAG    + +I  S    D       F VN +  +
Sbjct: 62  QNDITQLKLKLEQELPDQKLHLLYNNAGQSCSLPAIDVSEEIID-----NTFRVNVYGPI 116

Query: 121 SLVALCLPLLKSSPFVGNIVFVSSGASVKPYNGWSAYGCSKAALNHFAMDIASEEPSDKV 180
           +      PL+ ++   G IVF  S A + P+   + Y  SKAA++ +A  +  E     V
Sbjct: 117 NSCREFAPLIINAK--GTIVFTGSLAGICPFPFGAVYSASKAAIHQYARVLHGELGPLGV 174

Query: 181 RAVCIAPGVVDTQMQKDIRETLGPQGMT---PKALERFTQLYKTSSLLDPKVPA 231
           R + +  G V T +    ++TL P+G     P+ ++      K S    P  PA
Sbjct: 175 RVINMITGGVATDIAD--KKTL-PEGSIFNFPEGIKAVETRKKMSEKNQPMSPA 225

>Kwal_34.16024
          Length = 292

 Score = 61.2 bits (147), Expect = 8e-11,   Method: Compositional matrix adjust.
 Identities = 62/230 (26%), Positives = 103/230 (44%), Gaps = 21/230 (9%)

Query: 2   GKVILITGASRGIGLQLVKTVIEED-DECIVYGVARTEAGLQSL-QREYGADKFVYRVLD 59
           GK++++TGA+  IG  + +       D C+V    + +A L +L  ++YG +   Y+V D
Sbjct: 39  GKLVIVTGAAGVIGRAICEGFASAGADVCVV--DYKYDADLATLLAQKYGVEARAYQV-D 95

Query: 60  ITDRSRMEALVEEIRQKHGK--LDGIVANAGMLEPVKSISQSNSEHDIKQWERLFDVNF- 116
           IT+   + A ++ +++      +D  +ANAG+     S+   N     + W R+ DVN  
Sbjct: 96  ITNDEDVRACIQAVQKDFPSRDIDTFIANAGVAWTHGSVL--NESATPEAWRRVMDVNVQ 153

Query: 117 --FSIVSLVALCLPLLKSSPFVGNIVFVSSGASVKPYNGWSAYGCSKAALNHFAMDIASE 174
             F     VA           +      S  A+V  Y   + Y  SKAA+ H A   A E
Sbjct: 154 GTFHCAQEVAHVFKRQGHGCLILTASMSSHIANVPNYQ--TCYNASKAAVRHMARGFAVE 211

Query: 175 -----EPSDKVRAVCIAPGVVDTQMQKDIRETLGPQ--GMTPKALERFTQ 217
                EP+ ++R   ++PG  DT +   +      Q  G+TP+  E   Q
Sbjct: 212 FAHLTEPAGRIRCNSVSPGYTDTILSSFVPTEQRAQWWGLTPQGREAIPQ 261

>Scas_613.18
          Length = 286

 Score = 59.3 bits (142), Expect = 3e-10,   Method: Compositional matrix adjust.
 Identities = 59/257 (22%), Positives = 112/257 (43%), Gaps = 45/257 (17%)

Query: 2   GKVILITGASRGIGLQLVKTVIEEDDECIVYGVARTEAGLQSLQREYGADK-FVYRVLDI 60
           G V L+TG S G+GL++VK ++ +    I+  +            ++GADK   Y   D+
Sbjct: 35  GSVALVTGGSSGLGLEIVKQLLSKRCTVIILDIYPPNI-------QFGADKALTYYKCDV 87

Query: 61  TDRSRMEALVEEIRQKHGKLDGIVANAGM--LEPVKSISQSNSEHDIKQWERLFDVNFFS 118
             +  +E   + I + H  +  ++ NAG+  L+P+   S+       ++  ++ +VN+  
Sbjct: 88  GSQEEIEKTYKRISKDHASIHILINNAGITCLKPITEFSK-------EEVNKVINVNYLG 140

Query: 119 IVSLVALCLPLLKSSPFVGNIVFVSSGASVKPYNGWSAYGCSKAALNHFAMD---IASEE 175
              L+ L L    S+   G IV ++S   +      +AYG SK  L  F      +  + 
Sbjct: 141 ACKLMHLWL----SANNEGFIVNIASVLGLITPARLAAYGASKGGLISFHQSLNLLLKKR 196

Query: 176 PSDKVRAVCIAPGVVDTQMQKDIRETLGPQGMTPKALERFTQLYKTSSLLDPKVPAAVLA 235
            ++K++ + +  G + T+M                    F  +   S+L  P +   +LA
Sbjct: 197 TTNKIKMLLVCTGKIRTKM--------------------FQSVDSPSTLFAPDIKPDILA 236

Query: 236 QLVLKGIPDSLNGQYLR 252
           + ++K I    N Q +R
Sbjct: 237 RRIVKSIERG-NCQTIR 252

>Sklu_2348.5 YIL124W, Contig c2348 10212-11081 reverse complement
          Length = 289

 Score = 58.5 bits (140), Expect = 6e-10,   Method: Compositional matrix adjust.
 Identities = 67/243 (27%), Positives = 105/243 (43%), Gaps = 22/243 (9%)

Query: 3   KVILITGASRGIGLQLVKTVIEEDDECIVYGVARTEAGLQSLQREYGADKFVYRVLDITD 62
           KV L+TGAS GIG ++ K +  +     VY  AR    ++ L+ E+  +K +   LD++D
Sbjct: 5   KVALVTGASSGIGYEITKLLASKG--YTVYAAARRTTPIKPLEEEF-PEKVIAVSLDVSD 61

Query: 63  RSRMEALVEEIRQK--HGKLDGIVANAGMLEPVKSISQSNSEHDIKQWERLFDVNFFSIV 120
             +++ L     +     KL  +  NAG      ++   N      + E+ F VN F  +
Sbjct: 62  LQQIQDLKARFSRDLPDSKLHILYNNAGQSCTFPAVDVGND-----KIEQCFKVNVFGPM 116

Query: 121 SLVALCLPLLKSSPFV----GNIVFVSSGASVKPYNGWSAYGCSKAALNHFAMDIASEEP 176
           +L   C  +   S FV    G IVF  S A + P+   S Y  +KAA++ +A  +  E  
Sbjct: 117 NL---CREM---SDFVINARGTIVFTGSLAGIVPFPFGSIYSSTKAAIHQYARVLHVEMK 170

Query: 177 SDKVRAVCIAPGVVDTQMQKDIRETLGPQGM-TPKALERFTQLYKTSSLLDPKVPAAVLA 235
              V+ +    G V T +  D R  L      TP+    F      +    P  PA    
Sbjct: 171 PFGVKVINAITGGVATNIA-DTRPLLEDSVFNTPEGRHAFETRQNMAKNNKPMSPAVYAK 229

Query: 236 QLV 238
           +LV
Sbjct: 230 KLV 232

>CAGL0M11242g complement(1105723..1106529) highly similar to
           sp|Q05016 Saccharomyces cerevisiae YMR226c, start by
           similarity
          Length = 268

 Score = 57.4 bits (137), Expect = 1e-09,   Method: Compositional matrix adjust.
 Identities = 56/202 (27%), Positives = 94/202 (46%), Gaps = 18/202 (8%)

Query: 2   GKVILITGASRGIGLQLVKTVIEEDDEC-----IVYGVARTEAGLQSLQR---EYGADKF 53
           GK+  ITGAS GIG     T IE  D       +V G  R E   +  +    +Y   K 
Sbjct: 13  GKIAFITGASAGIGKA---TAIEYLDASNGSVKLVLGARRMEKLEELKKELLAQYPDAKI 69

Query: 54  VYRVLDITDRSRMEALVEEIRQKHGKLDGIVANAGMLEPVKSI-SQSNSEHDIKQWERLF 112
               LD+TD   ++  + ++ ++   +D ++ NAG     K++ S    + D +    + 
Sbjct: 70  HIGKLDVTDFENVKQFLADLPEEFKDIDILINNAG-----KALGSDKVGDIDPEDIAGMV 124

Query: 113 DVNFFSIVSLVALCLPLLKSSPFVGNIVFVSSGASVKPYNGWSAYGCSKAALNHFAMDIA 172
           + N  ++++L  L LPL K     G+IV + S A    Y   + Y  +K A+  F   + 
Sbjct: 125 NTNVLALINLTQLLLPLFKKKN-SGDIVNLGSIAGRDAYPTGAIYCATKHAVRAFTQSLR 183

Query: 173 SEEPSDKVRAVCIAPGVVDTQM 194
            E  +  +R + IAPG+V+T+ 
Sbjct: 184 KELINTDIRVIEIAPGMVETEF 205

>KLLA0E13860g 1219430..1222099 similar to sp|Q02207 Saccharomyces
           cerevisiae YKR009c FOX2
           hydratase-dehydrogenase-epimerase, peroxisomal
           singleton, start by similarity
          Length = 889

 Score = 58.2 bits (139), Expect = 2e-09,   Method: Compositional matrix adjust.
 Identities = 48/197 (24%), Positives = 89/197 (45%), Gaps = 9/197 (4%)

Query: 2   GKVILITGASRGIGLQLVKTVIEEDDECIVYGVARTEAGLQSLQREYGADKFVYRVLDIT 61
           GKV++ITG+  G+G    +       + ++  +    A +  + ++YG+   V    DI 
Sbjct: 313 GKVVIITGSGSGLGKSHAQWFARYGAKVVINDIRDPSAVVDEINKKYGSGSAVADTHDIV 372

Query: 62  DRSRMEALVEEIRQKHGKLDGIVANAGMLEPVKSISQSNSEHDIKQWERLFDVNFFSIVS 121
             ++   +V+    K G++D +V NAG+L       +S ++    +W  + +V+ FS  +
Sbjct: 373 KEAQQ--VVQTAVDKFGRVDILVNNAGILR-----DRSFAKMTEDEWNAVINVHLFSTFA 425

Query: 122 LVALCLPLLKSSPFVGNIVFVSSGASVKPYNGWSAYGCSKAALNHFAMDIASEEPSDKVR 181
           L     P+       G I+  +S + +    G   Y  +KAA+  F+  +A E     + 
Sbjct: 426 LSKAVWPIFLKQK-SGYIINTTSTSGIYGNFGQCNYAAAKAAILGFSRTLALEGTKRGIT 484

Query: 182 AVCIAPGVVDTQMQKDI 198
              IAP   +T M K I
Sbjct: 485 VNVIAPH-AETAMTKTI 500

 Score = 53.1 bits (126), Expect = 8e-08,   Method: Compositional matrix adjust.
 Identities = 50/213 (23%), Positives = 93/213 (43%), Gaps = 14/213 (6%)

Query: 3   KVILITGASRGIGLQLVKTVIEEDDECIVYGVARTEAG--LQSLQREYGADKFVYRVLDI 60
           +V++ITGA  G+G        +   + +V  + R+ A   +Q +++  G    V     +
Sbjct: 8   RVVIITGAGGGLGRVYALEYAKRGGKVVVNDLGRSAADSVVQEIKKLGGEGDAVANYDSV 67

Query: 61  TDRSRMEALVEEIRQKHGKLDGIVANAGMLEPVKSISQSNSEHDIKQWERLFDVNFFSIV 120
           +D     A+VE      G++D ++ NAG+L        S ++   KQ++++ DV+     
Sbjct: 68  SDNG--AAIVETAISNFGRVDILINNAGILR-----DSSFAKMSEKQFQQVIDVHLNGAF 120

Query: 121 SLVALCLPLLKSSPFVGNIVFVSSGASVKPYNGWSAYGCSKAALNHFAMDIASEEPSDKV 180
            L     P ++   F G I+   S A +    G + Y  +K  L  F   +A E     +
Sbjct: 121 KLTRAAWPHMRKQKF-GRIINTCSPAGLYGNFGQANYSAAKLGLLGFGESLAKEGYKYNI 179

Query: 181 RAVCIAP----GVVDTQMQKDIRETLGPQGMTP 209
               IAP     + +  +  +I + LGP+ + P
Sbjct: 180 NVNSIAPLARSAMTENVIPANILKELGPEKIAP 212

>CAGL0G08690g complement(822798..823682) similar to sp|P40471
           Saccharomyces cerevisiae YIL124w AYR1
           1-Acyldihydroxyacetone-phosphate reductase, hypothetical
           start
          Length = 294

 Score = 56.6 bits (135), Expect = 3e-09,   Method: Compositional matrix adjust.
 Identities = 69/251 (27%), Positives = 122/251 (48%), Gaps = 24/251 (9%)

Query: 3   KVILITGASRGIGLQLVKTVIEEDDECIVYGVARTEAGLQSLQREYGADKFVYRVLDITD 62
           KV ++TGAS GIG ++ K +  +  +  V+  AR  A ++ L   +G +  V   LDI++
Sbjct: 8   KVAVVTGASSGIGYEVTKELARKGFK--VFACARRTAPIEPLVNSFGKELIVPHHLDISE 65

Query: 63  RSRM----EALVEEIRQKHGKLDGIVANAGMLEPVKSISQSNSEHDIKQWERLFDVNFFS 118
              +    E L  E+ ++  KLD +  NAG      ++  SN   D+   E+ F VN F 
Sbjct: 66  LDEVLKFKEFLASELPEQ--KLDILYNNAGQSCTFPALDVSN---DV--MEQCFKVNVFG 118

Query: 119 IVSLVALCLPLLKSSPFVGNIVFVSS--GASVKPYNGWSAYGCSKAALNHFAMDIASEEP 176
            +++       L ++   G ++F  S  G S  P+   S Y  +KAA++ +A  +  E  
Sbjct: 119 HINMTRELAQYLINAK--GTVIFTGSIAGFSTLPFG--SIYAATKAAIHEYARTLHLELK 174

Query: 177 SDKVRAV-CIAPGVV-DTQMQKDIRETLGPQGMTPKALERFTQLYKTSSLLDPKVPAAVL 234
              VR +  I  GV+ D   ++D+ E  G     P+ ++ F +  +T +  +  +PA V 
Sbjct: 175 PFGVRVINAITGGVLTDIADKRDLPE--GSIYKFPQGIDAF-RTRQTMAKDNHPMPADVY 231

Query: 235 AQLVLKGIPDS 245
           A+ V++ +  S
Sbjct: 232 AKKVVEDLLSS 242

>YIL124W (AYR1) [2552] chr9 (126204..127097) 1-Acyl dihydroxyacetone
           phosphate reductase [894 bp, 297 aa]
          Length = 297

 Score = 56.6 bits (135), Expect = 3e-09,   Method: Compositional matrix adjust.
 Identities = 55/195 (28%), Positives = 88/195 (45%), Gaps = 13/195 (6%)

Query: 3   KVILITGASRGIGLQLVKTVIEEDDECIVYGVARTEAGLQSLQREYGADKFVYRVLDITD 62
           K+ ++TGAS GIG ++ K +    +  +VY  AR    +  L  ++G D      LDI+ 
Sbjct: 10  KIAVVTGASGGIGYEVTKELAR--NGYLVYACARRLEPMAQLAIQFGNDSIKPYKLDISK 67

Query: 63  RSRMEALVEEIRQK--HGKLDGIVANAGMLEPVKSISQSNSEHDIKQWERLFDVNFFSIV 120
              +      +R     GKLD +  NAG      ++  +++       E+ F VN F  +
Sbjct: 68  PEEIVTFSGFLRANLPDGKLDLLYNNAGQSCTFPALDATDA-----AVEQCFKVNVFGHI 122

Query: 121 SLV-ALCLPLLKSSPFVGNIVFVSSGASVKPYNGWSAYGCSKAALNHFAMDIASEEPSDK 179
           ++   L   L+K+    G IVF  S A V  +   S Y  SKAA++ +A  +  E     
Sbjct: 123 NMCRELSEFLIKAK---GTIVFTGSLAGVVSFPFGSIYSASKAAIHQYARGLHLEMKPFN 179

Query: 180 VRAVCIAPGVVDTQM 194
           VR +    G V T +
Sbjct: 180 VRVINAITGGVATDI 194

>KLLA0E24046g complement(2136583..2137425) similar to
           ca|CA3771|CaSOU1 Candida albicans Sorbitol utilization
           protein Sou1p [Candida albicans], hypothetical start
          Length = 280

 Score = 55.5 bits (132), Expect = 6e-09,   Method: Compositional matrix adjust.
 Identities = 50/208 (24%), Positives = 96/208 (46%), Gaps = 12/208 (5%)

Query: 2   GKVILITGASRGIGLQLVKTVIEEDDECIVY---GVARTEAGLQSLQREYGADKFVYRVL 58
           GKV ++TGAS GIG  + + + +      V+     A  E  ++ L  +Y      Y+  
Sbjct: 30  GKVAVVTGASSGIGYAVAEGLAQAGASLAVWYNSNAALVERAVE-LSAKYNVKVVAYQC- 87

Query: 59  DITDRSRMEALVEEIRQKHGKLDGIVANAGMLE---PVKSISQSNSEHDIKQWERLFDVN 115
            +T+ ++++  +E++ Q+ GK+D  +ANAG+     P+   ++S ++ D  +W ++   +
Sbjct: 88  PVTEEAKVKKTIEDVIQEFGKIDVFIANAGVPWTKGPLVEAAESGTDTD--EWNKVIHTD 145

Query: 116 FFSIVSLVALCLPLLKSSPFVGNIVFVS-SGASVKPYNGWSAYGCSKAALNHFAMDIASE 174
           F  +           K       ++  S SG  V      + Y  +KA + HFA  +A E
Sbjct: 146 FNGVYYCAKYVGAQFKRQGSGSMVITASMSGHIVNIPQLQACYNAAKAGVIHFAKSLAVE 205

Query: 175 EPSDKVRAVCIAPGVVDTQMQKDIRETL 202
             +   R   ++PG + T +   + E L
Sbjct: 206 W-AGFARVNTVSPGYIATPISNFVDEDL 232

>KLLA0D02596g
           join(complement(219682..219797),
           complement(218659..219586)) similar to sgd|S0004418
           Saccharomyces cerevisiae YLR426w, start by similarity
          Length = 347

 Score = 54.7 bits (130), Expect = 2e-08,   Method: Compositional matrix adjust.
 Identities = 52/222 (23%), Positives = 99/222 (44%), Gaps = 17/222 (7%)

Query: 4   VILITGASRGIGLQLVKTVIEE--DDECIVYGVARTEAGLQSLQREYGADKFVYRVLDIT 61
           V +ITG S G+G +LVK+++ +  D + ++  V   +  L   +     D+  +   D++
Sbjct: 85  VCVITGGSLGLGNELVKSLMSDIPDIKIVILDVVDPKLDLSITK-----DRIEFLRCDLS 139

Query: 62  DRSRMEALVEEIRQKHGKLDGIVANAGMLEPVKSISQSNSEHDIKQWERLFDVNFFSIVS 121
               +E  ++ I+ K  K+D ++ NA     ++      ++    +  ++F  N  S + 
Sbjct: 140 SDEEVENAIKTIKNKFPKVDLLINNAA----IRGRFSRLADMPCVEMNKIFHANVLSTIR 195

Query: 122 LVALCLPLLKSSPFVGNIVFVSSGASVKPYNGWSAYGCSKAALNHFAMDIASEEPSD--- 178
           L+    P   ++     +V ++S   +      S Y  SKAAL  +      E  +D   
Sbjct: 196 LIQAFHPKKSANNDFYYVVNIASALGIMSPARASTYAASKAALISYHESWTYELLNDNAM 255

Query: 179 KVRAVCIAPGVVDTQMQKDI---RETLGPQGMTPKALERFTQ 217
            VR + + PG +DTQM +     R+ L P    P+  +  TQ
Sbjct: 256 NVRTLLVLPGQMDTQMFQGFEPPRQFLAPVIKAPELAKEITQ 297

>Scas_662.4
          Length = 307

 Score = 53.5 bits (127), Expect = 3e-08,   Method: Compositional matrix adjust.
 Identities = 71/256 (27%), Positives = 113/256 (44%), Gaps = 32/256 (12%)

Query: 3   KVILITGASRGIGLQLVKTVIEEDDECIVYGVARTEAGLQSLQREYGAD------KFVYR 56
           K  ++TGAS GIG ++ K +    +  IVY  AR    +  L  +   +      K V +
Sbjct: 10  KTAIVTGASSGIGYEITKELAR--NGFIVYACARRLGPIDDLINDLAPELTTELAKAVIK 67

Query: 57  V--LDIT--DRSRMEALVEEIRQKHGKLDGIVANAGMLEPVKSISQSNSEHDIKQWERLF 112
              LDI+  D  +   +  E    +GKLD +  NAG      ++  +N   D+   E+ F
Sbjct: 68  PYQLDISKEDEVKQFRVFLEKELPNGKLDLLYNNAGQSCTFPALDVTN---DV--MEQCF 122

Query: 113 DVNFFSIVSLV-ALCLPLLKSSPFVGNIVFVSSGASVKPYNGWSAYGCSKAALNHFAMDI 171
            VN F  V++   L   L+++    G IVF  S A + P+   S Y  +KAA++ +A  +
Sbjct: 123 KVNVFGHVNMCRELASYLIQAR---GTIVFTGSLAGITPFPFGSIYSATKAAIHEYARVL 179

Query: 172 ASEEPSDKVRAVCIAPG-----VVDTQMQKDIRETLGPQGMTPKALERFTQLYKTSSLLD 226
             E     VR + +  G     + DT+   D      P+G   KA E    + K      
Sbjct: 180 HLEMKPFGVRVINVVTGGVATNIADTRPLPDDSVYNFPEGR--KAFEYRQSMAKNHH--- 234

Query: 227 PKVPAAVLAQLVLKGI 242
             +PA V A+ ++K I
Sbjct: 235 -PMPADVYAKELIKDI 249

>AGL060W [4251] [Homologous to ScYKR009C (FOX2) - SH]
           complement(595270..597945) [2676 bp, 891 aa]
          Length = 891

 Score = 53.9 bits (128), Expect = 5e-08,   Method: Compositional matrix adjust.
 Identities = 56/231 (24%), Positives = 99/231 (42%), Gaps = 21/231 (9%)

Query: 3   KVILITGASRGIGLQLVKTVIEEDDECIVYGVARTEAGLQSLQREYGADKFVYRVLDI-T 61
           KV++ITGA  G+G        +     +V  +   +  +  +  +YG  + V    +I T
Sbjct: 320 KVVIITGAGAGLGRSHALWFAKYGARVVVNDLKGADGVVAEINSQYGEGRAVADSHNIVT 379

Query: 62  DRSRMEALVEEIRQKHGKLDGIVANAGMLEPVKSISQSNSEHDIKQWERLFDVNFFSIVS 121
           D +   A+VE   +   ++D +V NAG+L     +  ++ E     W  +  V+  S+ +
Sbjct: 380 DAA---AVVETAMKAFERVDVLVNNAGILRDRSFVKMTDDE-----WNSVLQVHLLSVFA 431

Query: 122 LVALCLPLLKSSPFVGNIVFVSSGASVKPYNGWSAYGCSKAALNHFAMDIASEEPSDKVR 181
           L     P+       G IV  +S + +    G + Y  +KAA+  F+  +A E     +R
Sbjct: 432 LSKAVWPIFMQQR-SGVIVNTTSTSGIYGNFGQANYSAAKAAVLGFSKSLAIEGAKRGIR 490

Query: 182 AVCIAPGVVDTQMQK------DIRETLGPQGMTP----KALERFTQLYKTS 222
              IAP    T M K      +I+ +  P  ++P     A   F + Y+ S
Sbjct: 491 VYVIAPHAF-TNMTKTIFGETEIKSSFEPSQVSPFVVLLASNEFARKYRRS 540

 Score = 38.5 bits (88), Expect = 0.005,   Method: Compositional matrix adjust.
 Identities = 50/223 (22%), Positives = 91/223 (40%), Gaps = 28/223 (12%)

Query: 3   KVILITGASRGIGLQLVKTVIEEDDECIVYGVARTEAGLQSLQREYGADKFVYRVLD--- 59
           +V++ITGA  G+G +      +   + +V  +  T  G     R   ADK V  +     
Sbjct: 8   RVVIITGAGGGLGREYALDYAKRGAKVVVNDLGGTLGGSGHDTR--AADKVVEEIRKAGG 65

Query: 60  --------ITDRSRMEALVEEIRQKHGKLDGIVANAGMLEPVKSISQSNSEHDIKQWERL 111
                   +TD  +   +V+      G++D IV NAG+L        S ++   K +  +
Sbjct: 66  TAVANYDTVTDGDK---IVKTAIDAFGRVDVIVNNAGILR-----DGSFAKMTEKNFSAV 117

Query: 112 FDVNFFSIVSLVALCLPLLKSSPFVGNIVFVSSGASVKPYNGWSAYGCSKAALNHFAMDI 171
            DV+      L     P ++   + G IV  +S A +    G + Y  +K  L   +  +
Sbjct: 118 VDVHLNGSYKLCKAAWPYMRQQKY-GRIVNTASPAGLYGNFGQTNYSAAKLGLVGLSETL 176

Query: 172 ASEEPSDKVRAVCIAPGVVDTQMQK-----DIRETLGPQGMTP 209
           A E     ++   IAP +  ++M +      +   +GP+ + P
Sbjct: 177 AKEGHKYNIKVNVIAP-IARSRMTEGLLPDHVIRVMGPEKVVP 218

>KLLA0E22495g 1996893..1997771 similar to ca|CA3677|CaSOU3 Candida
           albicans putative sorbitol utilization protein (by
           homology), start by similarity
          Length = 292

 Score = 50.4 bits (119), Expect = 3e-07,   Method: Compositional matrix adjust.
 Identities = 50/185 (27%), Positives = 82/185 (44%), Gaps = 15/185 (8%)

Query: 44  LQREYGADKFVYRVLDITDRSRMEALVEEIRQKH-GK-LDGIVANAGMLEPVKSISQSNS 101
           L + YG +   Y+V DIT+   ++ + E I +   G+ ++  +ANAG+     SI    S
Sbjct: 81  LSKTYGIESKSYQV-DITNADDVKFVFERILEDFPGRAINTFIANAGIAWTNGSILNDGS 139

Query: 102 EHDIKQWERLFDVNFFSIVSLVALCLPLLKSSPFVGNIVFVSSGASV--KPYNGWSAYGC 159
             ++  W R+ DVN             + K+    GN++  +S +S      N  + Y  
Sbjct: 140 TPEM--WRRVMDVNVQGTYHCSRYAAEVFKNQGH-GNLILTASMSSYISNVPNYQTCYNA 196

Query: 160 SKAALNHFAMDIASE-----EPSDKVRAVCIAPGVVDTQMQKDI--RETLGPQGMTPKAL 212
           SKAA+ H A   A E      P+ K+R   ++PG  DT +   +   +     G+TP   
Sbjct: 197 SKAAVRHMAKGFAVEFSGLTSPAGKIRCNSVSPGYTDTLLSSFVPTEQRAHWWGLTPVGR 256

Query: 213 ERFTQ 217
           E   Q
Sbjct: 257 EALPQ 261

>CAGL0J05852g complement(554403..555434) weakly similar to sp|P40580
           Saccharomyces cerevisiae YIR036, hypothetical start
          Length = 343

 Score = 50.4 bits (119), Expect = 4e-07,   Method: Compositional matrix adjust.
 Identities = 75/270 (27%), Positives = 120/270 (44%), Gaps = 56/270 (20%)

Query: 2   GKVILITGASRGIGLQLVKTVIEEDDECIVYGVARTEA-GL---QSLQREYGADKFVYRV 57
           GK  ++TG + G+G +  K + +++  C V GV RTE+ GL   +S+++E G  K    V
Sbjct: 41  GKTAVVTGCNTGVGKEAAKLLYQKN--CNVIGVCRTESKGLEAAESIKQEIGNSKGSISV 98

Query: 58  ------LDITDRSRMEALVEEIRQKHGK-LDGIVANAGMLEPVKSISQSNSEHDIKQWER 110
                 LD T   +    ++EI    GK L+ I+ NAG++      S SN+    +  E 
Sbjct: 99  VSGCDFLDFTTVPQAGKRIQEILA--GKPLNIIIHNAGLM------SSSNAGTSKQGLEA 150

Query: 111 LFDVNFFSIVSLVALCLPLL--KSSPFVGNIVFVSSGASV-------------------- 148
           +F  N      L     P+   +    +  IV+VSSGA +                    
Sbjct: 151 MFQTNVMGPQLLQHYLDPVFLKEDDTSLKRIVWVSSGAHLLGPSQYGIFWENPGFDGVAI 210

Query: 149 -KPYNGWSAYGCSKAA--LNHFAMDIASEEPSDKVRAVCIA--PGVVDTQMQKD----IR 199
            K     + YG +KAA  L   A    ++E  DK+  V ++  PG + T +Q+D     R
Sbjct: 211 EKRPAATTLYGATKAANILQAKAWATRNKEMVDKIGCVSVSCYPGNLRTDLQRDWHPWTR 270

Query: 200 ETLGPQGMTPKALERFTQLYKTSSLLDPKV 229
            T+G +   P     +T+LY   S+L P +
Sbjct: 271 ATVG-RLFYPAEYGAYTELY---SVLSPSL 296

>Kwal_47.17102
          Length = 285

 Score = 50.1 bits (118), Expect = 4e-07,   Method: Compositional matrix adjust.
 Identities = 52/200 (26%), Positives = 95/200 (47%), Gaps = 29/200 (14%)

Query: 4   VILITGASRGIGLQLVKTVIEEDDECIVYGVARTEAGLQSLQREYGADKF--VYR-VLDI 60
           V ++TG S G+G    + +++E      + +      L SL  E     F  VY    D+
Sbjct: 34  VCVVTGGSNGLG----RAIVQE------FLLKLPNVTLISLDIEPPKKSFPNVYHYTCDL 83

Query: 61  TDRSRMEALVEEIRQKHGKLDGIVANAGMLEPVKSISQSNSEHDIKQWERLFDVNFFSIV 120
           ++ S ++  ++ +++ HG +  ++ NAG    +++  Q+  E   +  +++F VN F+ +
Sbjct: 84  SNSSDVDQTLKIVKRNHGDVTVLINNAG----IRAKYQNFRELSKEVADKVFQVNVFTPM 139

Query: 121 SLVALCLPLLKSSPFVGNI-----VFVSSGASVKPYNGWSAYGCSKAALNHFAMDIASE- 174
            LV       + SP  G++     V V+S   V      S YG SKAA   F    A E 
Sbjct: 140 RLVQ------ELSPKAGDLRQFYAVTVASALGVCAPARGSCYGASKAAAIAFHEAWAQEL 193

Query: 175 EPSDKVRAVCIAPGVVDTQM 194
           + + ++R + + PG +DT M
Sbjct: 194 DETSRIRTLLVTPGQLDTTM 213

>YKL055C (OAR1) [3204] chr11 complement(334966..335802)
           3-Oxoacyl-[acyl-carrier-protein] reductase [837 bp, 278
           aa]
          Length = 278

 Score = 49.7 bits (117), Expect = 6e-07,   Method: Compositional matrix adjust.
 Identities = 65/278 (23%), Positives = 115/278 (41%), Gaps = 64/278 (23%)

Query: 4   VILITGASRGIGLQLVKTVIEEDDECIVYG-----VART-------EAGLQSLQREYGAD 51
           V ++TGA+RGIG  + + + ++   CI+ G     + RT       ++GL S QR+    
Sbjct: 6   VAIVTGATRGIGKAICQKLFQKGLSCIILGSTKESIERTAIDRGQLQSGL-SYQRQCAIA 64

Query: 52  ---KFVYRVLDITDRSRMEALVEE--IRQKHGKL----------------DGIVANAGML 90
              K     LD      +E   +   ++QK+  L                + ++  AG+ 
Sbjct: 65  IDFKKWPHWLDYESYDGIEYFKDRPPLKQKYSTLFDPCNKWSNNERRYYVNLLINCAGLT 124

Query: 91  EPVKSISQSNSEHDIKQWERLFDVNFFSIVSLVALCLPLLKSS-------------PFVG 137
           +   S+  + S     Q + + +VNF S V++  +C+  +  S             P + 
Sbjct: 125 QESLSVRTTAS-----QIQDIMNVNFMSPVTMTNICIKYMMKSQRRWPELSGQSARPTIV 179

Query: 138 NIVFVSSGASVKPYNGWSAYGCSKAALNHFAMDIASEEPSDKVRAVCIAPGVVD------ 191
           NI  +     +K   G S Y  SKAAL+ F   +A+E     +R   I+PG+V       
Sbjct: 180 NISSILHSGKMK-VPGTSVYSASKAALSRFTEVLAAEMEPRNIRCFTISPGLVKGTDMIQ 238

Query: 192 ---TQMQKDIRETLGPQGMTPKA--LERFTQLYKTSSL 224
               + ++ +  T+G  G +  A   E    LY  ++L
Sbjct: 239 NLPVEAKEMLERTIGASGTSAPAEIAEEVWSLYSRTAL 276

>Kwal_55.19569
          Length = 288

 Score = 49.7 bits (117), Expect = 6e-07,   Method: Compositional matrix adjust.
 Identities = 47/198 (23%), Positives = 90/198 (45%), Gaps = 8/198 (4%)

Query: 2   GKVILITGASRGIGLQLVKTVIEEDDECIVYGVARTE--AGLQSLQREYGADKFVYRVLD 59
           GKV  I+GAS GIG  +     +   +  V+  +  +     + L   YG     Y+   
Sbjct: 38  GKVACISGASSGIGGAVAVAFAQAGADIAVWYNSNDKLIQTAKELSETYGVRAKAYKC-P 96

Query: 60  ITDRSRMEALVEEIRQKHGKLDGIVANAGMLEPVKSISQSNSEH-DIKQWERLFDVNFFS 118
           +TD ++++  + ++ +   K+D  VANAG+      + ++       K+WE++F+ +F  
Sbjct: 97  VTDEAKVKETILQVEKDFSKIDIFVANAGVPWSEGPLIEAEERGVATKEWEKVFNTDFQG 156

Query: 119 IVSLVALCLPLLKSSPFVGNIVFVS--SGASVKPYNGWSAYGCSKAALNHFAMDIASEEP 176
           +     +   + K     G++V  +  SG  V      + Y  +KA + H +  +A E  
Sbjct: 157 VYYCSKVIGAIFKKQG-RGSLVITASMSGHVVNVPQLQACYNAAKAGVIHLSRSLAVEW- 214

Query: 177 SDKVRAVCIAPGVVDTQM 194
           +   R   I+PG +DT +
Sbjct: 215 AGFARVNSISPGYIDTPI 232

>Kwal_26.7950
          Length = 897

 Score = 49.3 bits (116), Expect = 1e-06,   Method: Compositional matrix adjust.
 Identities = 51/197 (25%), Positives = 90/197 (45%), Gaps = 9/197 (4%)

Query: 2   GKVILITGASRGIGLQLVKTVIEEDDECIVYGVARTEAGLQSLQREYGADKFVYRVLDIT 61
           GKV++ITGA  G+G     T  +   + +V  +      +  +++ YG +  V    D+ 
Sbjct: 324 GKVVIITGAGAGLGRSHALTFAKYGAKVVVNDIKDPHTVVSEIEKLYGRNSAVADKHDVV 383

Query: 62  DRSRMEALVEEIRQKHGKLDGIVANAGMLEPVKSISQSNSEHDIKQWERLFDVNFFSIVS 121
                  +V+   Q  G++D +V NAG+L   +S ++ + E    +WE +  V+ FS   
Sbjct: 384 KDP--GEIVKSAFQTFGRVDILVNNAGVLRD-RSFAKMSDE----EWEIVLKVHLFSTFG 436

Query: 122 LVALCLPLLKSSPFVGNIVFVSSGASVKPYNGWSAYGCSKAALNHFAMDIASEEPSDKVR 181
           L     P+       G I+  +S + +    G + Y  +KAA+  F+  +A E     +R
Sbjct: 437 LCKAVWPIFVKQK-SGYIINTTSTSGIYGNFGQANYAAAKAAVLGFSKTLALEGSKHNIR 495

Query: 182 AVCIAPGVVDTQMQKDI 198
              +AP   +T M K I
Sbjct: 496 VNIVAPH-AETAMTKTI 511

 Score = 38.1 bits (87), Expect = 0.006,   Method: Compositional matrix adjust.
 Identities = 51/226 (22%), Positives = 90/226 (39%), Gaps = 26/226 (11%)

Query: 3   KVILITGASRGIGLQLVKTVIEEDDECIVYGVARTEAGLQSLQREYGADKFVYRVLD--- 59
           +V++ITGA  G+G        +   + +V  +  +  G     R   AD  V  + +   
Sbjct: 11  RVVVITGAGGGLGKVYALEFAKRGAKVVVNDLGGSLGGEGHNSR--AADVVVSEIREKYK 68

Query: 60  ---------ITDRSRMEALVEEIRQKHGKLDGIVANAGMLEPVKSISQSNSEHDIKQWER 110
                    +T+ +   A+V+      G++D I+ NAG+L      + S+S      +  
Sbjct: 69  TQAAANYDSVTENA--AAIVQTAVDNFGRVDIIINNAGILRDSSFANMSDSA-----FAS 121

Query: 111 LFDVNFFSIVSLVALCLPLLKSSPFVGNIVFVSSGASVKPYNGWSAYGCSKAALNHFAMD 170
           + DV+     +L     P +K+  F G IV   S A +    G + Y  +K  L  F+  
Sbjct: 122 VVDVHLTGAYNLTRAAWPHMKNQKF-GRIVNTCSPAGLYGNFGQANYSAAKMGLVGFSET 180

Query: 171 IASEEPSDKVRAVCIAPGVVDTQMQK----DIRETLGPQGMTPKAL 212
           +A E     +   CI P       ++     I + L P+ + P  L
Sbjct: 181 LAQEGFKYNIYVNCIVPLARSRMTERVVPPPILKQLAPEKIAPLVL 226

>Kwal_55.21822
          Length = 283

 Score = 46.2 bits (108), Expect = 8e-06,   Method: Compositional matrix adjust.
 Identities = 52/220 (23%), Positives = 96/220 (43%), Gaps = 18/220 (8%)

Query: 2   GKVILITGASRGIGLQLVKTVIEEDDECIVYGVAR---TEAGLQSLQREYGADKFVYRVL 58
           GKV  +TGAS GIG  +     +   +  ++  +    TE  +  +  +YG     Y+  
Sbjct: 30  GKVAAVTGASSGIGYDVAVAFAQAGADVAMWYNSNPHITEL-VGEISEKYGVKVKAYK-C 87

Query: 59  DITDRSRMEALVEEIRQKH-GKLDGIVANAGMLE---PVKSISQSNSEHDIKQWERLFDV 114
            +T    + + +++I++   GK+D +V NAG+     P+  + + + E    +W ++ DV
Sbjct: 88  SVTSSKDVASTIDQIKKDFGGKIDIMVGNAGVAWSEGPLIDLVEKDEEKCDAEWNKVIDV 147

Query: 115 NFFSIVSLVALCLPLLKSSPFVGNIVFVS-SGASVKPYNGWSAYGCSKAALNHFAMDIAS 173
           +   I  +      + K       I+  S SG  V      +AY  +KA + H +  +A 
Sbjct: 148 DLNGIYRVAKNIGRVFKEQGHGSFIITASMSGHVVNVPQMQTAYNAAKAGVLHMSKSLAV 207

Query: 174 EEPSDKVRAVCIAPGVVDTQMQ-------KDIRETLGPQG 206
           E  +   R   ++PG + T++        KD    L P G
Sbjct: 208 EW-AGFARVNTVSPGYIATEITNFAEDELKDKWHKLTPMG 246

>CAGL0L02167g 253055..255760 highly similar to sp|Q02207
           Saccharomyces cerevisiae YKR009c FOX2
           hydratase-dehydrogenase-epimerase peroxisomal, start by
           similarity
          Length = 901

 Score = 46.6 bits (109), Expect = 1e-05,   Method: Compositional matrix adjust.
 Identities = 54/226 (23%), Positives = 93/226 (41%), Gaps = 25/226 (11%)

Query: 2   GKVILITGASRGIGLQLVKTVIEEDDECIVYGVARTEAGLQSLQREYGADKFVYRVL--- 58
           G+V++ITGA  G+G        +   + +V  +  T  G  S      AD  V  ++   
Sbjct: 9   GRVVVITGAGGGLGKVYALEYAKRGAKVVVNDLGGTLGG--SGHDSKAADVVVDEIVKSG 66

Query: 59  --------DITDRSRMEALVEEIRQKHGKLDGIVANAGMLEPVKSISQSNSEHDIKQWER 110
                    + D    E +VE   +  G++D ++ NAG+L  V     S ++   K++  
Sbjct: 67  GTAVANYDSVNDNG--EQIVETAIKAFGRIDILINNAGILRDV-----SFAKMTEKEFSA 119

Query: 111 LFDVNFFSIVSLVALCLPLLKSSPFVGNIVFVSSGASVKPYNGWSAYGCSKAALNHFAMD 170
           + DV+      L     P ++   F G I+  +S A +    G + Y  +K  L  FA  
Sbjct: 120 VLDVHLTGAYRLTKAAWPYMRQQKF-GRIINTASPAGLFGNFGQANYSAAKLGLVGFAET 178

Query: 171 IASEEPSDKVRAVCIAP----GVVDTQMQKDIRETLGPQGMTPKAL 212
           +A E     +    IAP     + +  +   I + LGP+ + P  L
Sbjct: 179 LAKEGYKYNINVNSIAPLARSRMTENVLPPHILKQLGPEKIAPLVL 224

 Score = 41.2 bits (95), Expect = 6e-04,   Method: Compositional matrix adjust.
 Identities = 47/197 (23%), Positives = 87/197 (44%), Gaps = 11/197 (5%)

Query: 3   KVILITGASRGIGLQLVKTVIEEDDECIVYGVARTEAGLQSLQREYGADKFVYRVLDITD 62
           KV++ITGA  G+G        +     +V  +      +  +  +YG  + +    ++  
Sbjct: 324 KVVIITGAGGGLGKSHALWFAKYGARVVVNDIKDPNTVVNEINSKYGEGRAIPDTHNVVT 383

Query: 63  RSRMEALVEEIRQKHGKLDGIVANAGMLEPVKSISQSNSEHDIKQWERLFDVNFFSIVSL 122
            +    ++E   + +G++D +V NAG+L     +  ++ E     W  +  V+ +S   L
Sbjct: 384 EANQ--VIETAMKAYGRVDVLVNNAGILRDRSFLKMTDQE-----WFAVVQVHLYSTFLL 436

Query: 123 VALCLPL-LKSSPFVGNIVFVSSGASVKPYNGWSAYGCSKAALNHFAMDIASEEPSDKVR 181
                P+ LK     G+I+  +S + +    G + Y  +KAA+  F+  IA E     +R
Sbjct: 437 SKAVWPIFLKQKG--GHIINTTSTSGIYGNFGQANYAAAKAAILGFSRTIAVEGAKRGIR 494

Query: 182 AVCIAPGVVDTQMQKDI 198
              IAP   +T M K I
Sbjct: 495 VNIIAPH-AETAMTKTI 510

>CAGL0H10450g complement(1018805..1019740) similar to tr|Q07530
           Saccharomyces cerevisiae YDL114w, hypothetical start
          Length = 311

 Score = 45.8 bits (107), Expect = 1e-05,   Method: Compositional matrix adjust.
 Identities = 45/203 (22%), Positives = 94/203 (46%), Gaps = 17/203 (8%)

Query: 4   VILITGASRGIGLQLVKTVIEEDDECIVYGVARTEAGLQSLQREYGADKFVYRVLDITDR 63
           V LITG S G+GL++   +++     IV  +       + L ++Y     ++   DITD 
Sbjct: 46  VALITGGSGGLGLEIAIALVQRYKSVIV-AIVDVVPPKKQLVKQY--PNIIHYRCDITDS 102

Query: 64  SRMEALVEEIRQKHGKLDGIVANAGMLEPVKSISQSNSEHDIKQWERLFDVNFFSIVSLV 123
            ++  + +++    GK++ +V NA +     +I +  ++    + +R+ +VN  +   LV
Sbjct: 103 FQVAHMKKKVLLDFGKVNILVNNAAI-----TIIKQLTDMTEAEIQRVINVNLIASYHLV 157

Query: 124 ALCLPLLKSSPFVGNIVFVSSGASVKPYNGWSAYGCSKAAL----NHFAMDIASEEP--- 176
           ++ +P +  +   G I+ ++S       +    YG +K  L    N+    I +      
Sbjct: 158 SMFVPEMLYTKN-GCIINIASVLGELTPSRLIVYGATKGGLIELHNYLNQQINAHNSYAY 216

Query: 177 -SDKVRAVCIAPGVVDTQMQKDI 198
               ++A+ + PG + T M KD+
Sbjct: 217 NRRGLKAILVCPGKISTTMFKDV 239

>YDL114W (YDL114W) [755] chr4 (255604..256530) Member of the
           short-chain dehydrogenase-reductase family, which are
           NAD- or NADP-dependent oxidoreductases, has low
           similarity to S. cerevisiae Ylr426p [927 bp, 308 aa]
          Length = 308

 Score = 45.4 bits (106), Expect = 2e-05,   Method: Compositional matrix adjust.
 Identities = 57/208 (27%), Positives = 94/208 (45%), Gaps = 34/208 (16%)

Query: 6   LITGASRGIGLQLVKTVIEEDDECIVYGVARTEAGLQSL----QREYGADKFVYRVLDIT 61
           LITG S G+G +L K +    ++ IV       A +QS     Q EY  +   Y   DIT
Sbjct: 42  LITGGSSGLGFELAKELSRRINKVIV-------ADIQSFPTFAQVEY--NNIFYYQCDIT 92

Query: 62  DRSRMEALVEEIRQKHGKLDGIVANAGMLEPVKSISQSNSEHDIKQWERLFDVNF---FS 118
               ++ L + I + HG ++ I+ NAG+    K    +N     K+ E+L D+N    + 
Sbjct: 93  SLDEIKNLKKAIERDHGNINIIINNAGVAHIKKLEHMTN-----KEVEQLIDINLIGAYR 147

Query: 119 IVSLVALCLPLLKSSPFVGNIVFVSSGASVKPYNGWSAYGCSKAAL--------NHFAMD 170
           I+S  A  + +     F+ NI  V     + P    ++YG SK A+         HF   
Sbjct: 148 IISTFAEDM-IDNREGFIINIASVL--GELTPAR-LTSYGASKGAMIGFHKCMSRHFR-S 202

Query: 171 IASEEPSDKVRAVCIAPGVVDTQMQKDI 198
           +++E     ++ + + PG + T M  D+
Sbjct: 203 LSTECNKTGIKTLLVCPGKIKTNMFIDV 230

>ABR076C [667] [Homologous to ScYKL055C (OAR1) - SH]
           (527756..528571) [816 bp, 271 aa]
          Length = 271

 Score = 45.4 bits (106), Expect = 2e-05,   Method: Compositional matrix adjust.
 Identities = 68/272 (25%), Positives = 111/272 (40%), Gaps = 61/272 (22%)

Query: 8   TGASRGIGLQLVKTVIEEDDECIVYGVARTEAGLQSLQREYGADKFVYR------VLDIT 61
           TG +RGIG Q+V+  + E   C+  G   +EA + +   + G   F          LD+ 
Sbjct: 10  TGGTRGIGYQVVQRTLAEGLSCVFVG--SSEASVATAFDQLGCTPFREHQFVRGVALDLA 67

Query: 62  --------------DRSRMEALVEEI----------RQKHGKLDGIVANAGMLEPVKSIS 97
                         +RS   +               R+     D +V  AG       +S
Sbjct: 68  TWPAWPAQASFPCWERSAAGSAQRAAALLDLAPGGPRRARYHYDLLVNCAG-------VS 120

Query: 98  QSN--SEHDIKQWERLFDVNFFSIVSLVALCL-PLLKSS------PFVGNIVFVSSGASV 148
           Q++  +        RL  VN  S+VSL  L + P+L++       P + N+  V   A  
Sbjct: 121 QASLAAHTSADAAARLLHVNLGSLVSLCQLSVRPMLRARRVAHARPTIVNVASVLGCAHA 180

Query: 149 KPYNGWSAYGCSKAALNHFAMDIASEEPSDKVRAVCIAPGVV-DTQM----QKDIRETLG 203
           +P  G + Y  SK+A+  ++  +A+E     +    +APG+V DT M      D R  L 
Sbjct: 181 QPPPGTAVYAASKSAVIQYSRALAAELERTGIACHAVAPGLVPDTDMIAALPPDARARLA 240

Query: 204 ---PQG-MTPKAL-ERFTQLYKTSSLLDPKVP 230
              P+   TP+A+ +   +LY+  S   P+ P
Sbjct: 241 AAFPEAPTTPRAVCDHIWRLYRQPS---PRAP 269

>YNL202W (SPS19) [4400] chr14 (259568..260455) Peroxisomal
           2,4-dienoyl-CoA reductase [888 bp, 295 aa]
          Length = 295

 Score = 45.4 bits (106), Expect = 2e-05,   Method: Compositional matrix adjust.
 Identities = 35/136 (25%), Positives = 66/136 (48%), Gaps = 11/136 (8%)

Query: 58  LDITDRSRMEALVEEIRQKHGKLDGIVANAGMLEPVKSISQSNSEHDIKQWERLFDVNFF 117
           +D+ +  ++E  V++  +K GK+D ++A A       +     +      ++ + D++  
Sbjct: 87  VDVRNFEQVENAVKKTVEKFGKIDFVIAGA-----AGNFVCDFANLSPNAFKSVVDIDLL 141

Query: 118 SIVSLVALCLPLLKSSPFVGNIVFVSSGASVK--PYNGWSAYGCSKAALNHFAMDIASEE 175
              +    CL  LK S   G+I+FVS+       P+ G    G +KA ++  A ++A E 
Sbjct: 142 GSFNTAKACLKELKKSK--GSILFVSATFHYYGVPFQGH--VGAAKAGIDALAKNLAVEL 197

Query: 176 PSDKVRAVCIAPGVVD 191
               +R+ CIAPG +D
Sbjct: 198 GPLGIRSNCIAPGAID 213

>Scas_652.19d1
          Length = 344

 Score = 44.7 bits (104), Expect = 4e-05,   Method: Compositional matrix adjust.
 Identities = 58/231 (25%), Positives = 100/231 (43%), Gaps = 46/231 (19%)

Query: 3   KVILITGASRGIGLQLVKTVIEEDDECIVYGVARTEAGLQSLQREYGADK-------FVY 55
           K  ++TG + GIG  +V+ + +++  C V GV RT+A  +  ++E  A+         + 
Sbjct: 42  KTAVVTGCNTGIGKHVVELLYQKN--CNVIGVVRTDAKGEEAKKEIIANNPKSKGNITII 99

Query: 56  RVLDITDRSRMEALVEEIRQKHGK--LDGIVANAGMLEPVKSISQSNSEHDIKQWERLFD 113
              D  D  ++ A+  +I++  G   L+ I+ NAG++ P       N    ++ +E +F 
Sbjct: 100 GGCDYLDLEKVPAVGGKIKEALGDKPLNIIIHNAGLMAP------DNKGTSVQGYEAMFQ 153

Query: 114 VNFFSIVSLVALCLPLLKSSPFVG--NIVFVSSGASV---KPYN-GW------------- 154
            N      L     PL      +    IV+VSSGA      P+   W             
Sbjct: 154 TNVLGSQLLQHFLDPLFLKEDDISLKRIVWVSSGAHFLAPHPFGINWEDPLYESVPIAER 213

Query: 155 ----SAYGCSKAALNHFAMDIASE---EPSDKVRAVCIA--PGVVDTQMQK 196
               + YG SKA  N +   I  E   E ++K+  V ++  PG + T +Q+
Sbjct: 214 PSQMTLYGQSKAG-NIYQAKIWFEKNKEIAEKINCVSVSCYPGNLKTDLQR 263

>Scas_652.19d
          Length = 341

 Score = 43.9 bits (102), Expect = 5e-05,   Method: Compositional matrix adjust.
 Identities = 46/154 (29%), Positives = 71/154 (46%), Gaps = 18/154 (11%)

Query: 3   KVILITGASRGIGLQLVKTVIEEDDECIVYGVART----EAGLQSLQREYGADKFVYRVL 58
           K  LITG + GIG +++K +  ++  C +  V R+    EA  +    +Y   K    V+
Sbjct: 42  KTALITGTNTGIGFEVMKLLYSKN--CNIIAVVRSAEKGEAAKKEAIEKYPNSKGSISVV 99

Query: 59  ---DITDRSRMEALVEEIRQKHGK--LDGIVANAGMLEPVKSISQSNSEHDIKQWERLFD 113
              D  D + ++   EEI+   G   L+ I+ NAG++ PV      N+    +  E +F 
Sbjct: 100 GGNDFLDLTTVKPASEEIKLVLGDKPLNIIIHNAGLMAPV------NTGTSKQGLEAMFS 153

Query: 114 VNFFSIVSLVALCLPL-LKSSPFVGNIVFVSSGA 146
            N      L     PL LK    +  IV+VSSGA
Sbjct: 154 TNVLGPQLLQHFLDPLFLKKDDDLKRIVWVSSGA 187

>KLLA0A11352g complement(983428..984372) similar to sp|P50167 Pichia
           stipitis D-arabinitol 2-dehydrogenase [ribulose forming]
           (EC 1.1.1.250) (ARDH), start by similarity
          Length = 314

 Score = 43.5 bits (101), Expect = 8e-05,   Method: Compositional matrix adjust.
 Identities = 47/230 (20%), Positives = 89/230 (38%), Gaps = 40/230 (17%)

Query: 2   GKVILITGASRGIGLQLVKTVIEEDDECIVYGVA-------RTEAGLQSLQREYGADKFV 54
           G V ++TGA+ G+   L + ++ +  E  +  ++       +TE  L   Q      K  
Sbjct: 33  GHVTIVTGAAGGLAHTLSQALVSQGSELALMDLSLPSLENVKTELELFQKQNNIPPVKIS 92

Query: 55  YRVLDITDRSRMEALVEEIRQKHGKL--DGIVANAGMLEPVKSISQSNSEHDIKQWERLF 112
               DI++   +E +V+ I   H  +    +V  AG  + + +      E+D ++ ++L 
Sbjct: 93  LWACDISNADEVEMVVKSIPSSHKGIVPQKLVHTAGFCQNINA-----HEYDAEKAQKLV 147

Query: 113 DVNFFSIVSLV------------------------ALCLPLLKSSPFVGNIVFVSSGASV 148
           +VN    + +                            +P    + FV  ++   SG  V
Sbjct: 148 NVNLLGSLYICQSMARQLLARRTRRKSISEHIDESGEAMPQFPEASFV--LIGSMSGLIV 205

Query: 149 KPYNGWSAYGCSKAALNHFAMDIASEEPSDKVRAVCIAPGVVDTQMQKDI 198
                  AY  SKA + H    +A+E     +R   I+PG + T + K +
Sbjct: 206 NTPQPQCAYNMSKAGVIHLVKSLAAEWAKFGIRVNAISPGYIATALTKKV 255

>Sklu_268.1 , Contig c268 57-791 reverse complement
          Length = 244

 Score = 43.1 bits (100), Expect = 9e-05,   Method: Compositional matrix adjust.
 Identities = 50/198 (25%), Positives = 88/198 (44%), Gaps = 12/198 (6%)

Query: 5   ILITGASRGIGLQLVKTVIEEDDECIVYGVARTEAGLQSLQREYGADKFVYRV--LDITD 62
           +++TGA+ GIG  +V   ++E    I   +   E  L  L +E   D  V     +D+  
Sbjct: 7   VIVTGAASGIGKAIVNQCLQEGASVIACDL--NEQALLVL-KESLNDSTVLDTYPMDVRK 63

Query: 63  RSRMEALVEEIRQKHGKLDGIVANAGMLEPVKSISQSNSEHDIKQWERLFDVNFFSIVSL 122
              + A    +  +H  +DG+V NAG+      +++   ++   + +++ D+N    +  
Sbjct: 64  YEEVAAFFAYVETEHSDVDGLVNNAGIY-----LAKHILDYQEDEIDKVLDINVKGYIYF 118

Query: 123 VALCLPLLKSSPFVGNIVFVSSGASVKPYNGWSAYGCSKAALNHFAMDIASEEPSDKVRA 182
             +    L  S   G IV +SS  S +  +  + YG SKAA+       A    S  +R 
Sbjct: 119 SQMFGKKLFHSQRKGVIVNLSS-VSGQEGSSDAIYGSSKAAILGLTKSCAM-NFSPYIRV 176

Query: 183 VCIAPGVVDTQMQKDIRE 200
             +AP +V+T M   I E
Sbjct: 177 NAVAPTMVNTSMMDSIPE 194

>AEL164C [2342] [Homologous to ScYBR265W (TSC10) - SH]
           (326834..327757) [924 bp, 307 aa]
          Length = 307

 Score = 42.7 bits (99), Expect = 1e-04,   Method: Compositional matrix adjust.
 Identities = 52/197 (26%), Positives = 86/197 (43%), Gaps = 23/197 (11%)

Query: 2   GKVILITGASRGIGLQLVKTVIEEDDECIVYGVARTEAGLQ----------SLQREYGAD 51
           G+V+LI+G S+G+G    +  IEE D  +V  V+R+E  L                 GA 
Sbjct: 7   GQVVLISGGSQGLGRAFAQKYIEESDSTVVI-VSRSEEKLTRAGEAICGGARRLGAGGAG 65

Query: 52  KFVYRVLDITDRSRMEALVEEIRQKHGKLDGIVANAGMLEPVKSISQSNSEHDIKQWERL 111
           + +Y   ++ D + +  L   +     ++  ++  AG   P      S++     Q    
Sbjct: 66  RLLYYACNLGDAAAVGGLFATLADAGLQVTQVLFCAGGAVPGLFAELSSA-----QLAAG 120

Query: 112 FDVNFFSIVSLVALCLPLLKSSPFVGNIVFVSSGASVKPYNGWSAYGCSKAALNHFAMDI 171
            ++N+ +     AL L          ++VF SS A+V P+ G+S Y   KAAL   A+  
Sbjct: 121 VEMNYGT-----ALHLAHGAVRHGARHLVFFSSAAAVYPFIGYSQYAPLKAALR--ALVA 173

Query: 172 ASEEPSDKVRAVCIAPG 188
              +  D VR  C+ PG
Sbjct: 174 VLRQECDGVRVSCVYPG 190

>YKL071W (YKL071W) [3189] chr11 (304759..305529) Protein with
           similarity to proteins of the short-chain alcohol
           dehydrogenase family, expression is regulated by Yap1p
           transcription factor [771 bp, 256 aa]
          Length = 256

 Score = 42.4 bits (98), Expect = 2e-04,   Method: Compositional matrix adjust.
 Identities = 65/262 (24%), Positives = 116/262 (44%), Gaps = 34/262 (12%)

Query: 6   LITGASRGIGLQLVKTVIEEDDECIVYGVARTEAGLQSLQREYGAD--KFVYRV-LDITD 62
            I G SRGIG  LVK +       ++  +  + +  ++ Q E  A   K ++ V LD+T 
Sbjct: 10  FIIGGSRGIGFNLVKILSASTGNTVITSIRGSPSLPKNKQVEDLAKIRKNIHIVQLDLTK 69

Query: 63  RSRMEALVEEIRQKHGKL--DGIVANAGMLEPVKSISQSNSEHDIKQWERLFDVNFFSIV 120
              +  + +EI++    L  D  +A + +         S+S + + +  +   +N +S  
Sbjct: 70  DESIGNIADEIKKTPFFLGIDIFIACSAV---------SDSYYKVLETPKSVWLNHYSTN 120

Query: 121 SLVALCLPLLKSSPFV-----GNIVFVSSGA-SVKPYN--GWSAYGCSKAALNHFAMDIA 172
           +L  + L L K  P +       I F+SS A S+  +     SAYG SKAALN+    ++
Sbjct: 121 ALGPI-LALQKVYPLLLLKKTRKIFFISSVAGSINAFVPLSVSAYGQSKAALNYAVKTLS 179

Query: 173 SEEPSDKVRAVCIAPGVVDTQMQKDIRETLGPQGMTPKALERFTQLYKTSSLLDPKVPAA 232
            E   +    V   PG+V T M +      G      K ++         +++ P+  A+
Sbjct: 180 FELKPEGFTVVAFHPGMVSTDMGQ-----YGLDHFKEKNID-----ISGVNIITPEESAS 229

Query: 233 VLAQLVLKGIPDSLNGQYLRYN 254
            L  +  K +P+  NG++  Y+
Sbjct: 230 ALIDVFRKILPED-NGKFFNYD 250

>CAGL0J04774g join(452094..452179,452259..453189) similar to
           tr|Q06417 Saccharomyces cerevisiae YLR426w
          Length = 338

 Score = 42.0 bits (97), Expect = 2e-04,   Method: Compositional matrix adjust.
 Identities = 44/203 (21%), Positives = 97/203 (47%), Gaps = 32/203 (15%)

Query: 4   VILITGASRGIGLQLVKTVIEEDDECIVYGVARTEAGLQ----SLQREYGADKFVYRVL- 58
           ++LITG S G+G             CI++ + R+   ++     L  +Y +++   RV+ 
Sbjct: 71  IVLITGGSNGLG------------RCIIHKLLRSYNNIKVINLDLDVQYWSEE--ARVIN 116

Query: 59  ---DITDRSRMEALVEEIRQKH-GKLDGIVANAGMLEPVKSISQSNSEHDIKQWERLFDV 114
              D+ +   +E  +++I+ ++  K++ ++ NAG    V+S      +  I + +R+ ++
Sbjct: 117 IECDLVNADGLELALKKIKLEYEDKINLLICNAG----VRSRFNWFEDTPIDEMQRIMNI 172

Query: 115 NFFSIVSLVALCLPLLKSSPFVGNIVFVSSGASVKPYNGWSAYGCSKAALNHFAMDIASE 174
           N +S   ++   +P  + +     IV +SS   +   +  ++Y  SKAA+      + ++
Sbjct: 173 NTWSTARILQAIIP--RDNQRQLYIVTISSVLGILAPSKVASYAASKAAITALHNSMTND 230

Query: 175 ---EPSDKVRAVCIAPGVVDTQM 194
                   +R + + PG +DTQM
Sbjct: 231 FLVRGIGNIRTLLVLPGQIDTQM 253

>KLLA0C12694g 1077786..1078565 similar to sp|P35731 Saccharomyces
           cerevisiae YKL055c OAR1 putative 3-oxoacyl-(acyl carrier
           protein) reductase singleton, start by similarity
          Length = 259

 Score = 41.2 bits (95), Expect = 4e-04,   Method: Compositional matrix adjust.
 Identities = 57/244 (23%), Positives = 102/244 (41%), Gaps = 49/244 (20%)

Query: 4   VILITGASRGIGLQLVKTV---------IEEDDECIVYGVARTEAGLQSLQREYGAD--- 51
           V +++GA+RGIG ++   +         I  +D+ +V    R +       +    +   
Sbjct: 6   VSIVSGATRGIGSKIRDELLLSGYSVIYIGSNDDSVVKNQPRIKLNHGQFAKGISINFKG 65

Query: 52  ----------KFVYRVLDITDRSRMEALVEEIRQKHGKLDGIVANAGMLEPVKSISQSNS 101
                     +F+ R   I  +     L+    +K  +LD +V  AG+ +   +I  + +
Sbjct: 66  WPTWVDTTWSQFICRNGKIETKIESNDLMAGFDKKQYRLDLLVNCAGITQTTAAIKANTN 125

Query: 102 EHDIKQWERLFDVNFFSIVSLVALCLP-LLKSSPFVG------NIVFV---SSGASVKPY 151
           E        + +VNF S VSL  L L  +++++   G      NI  V   SS   + P 
Sbjct: 126 EM-----ADIMNVNFMSSVSLTQLALKQMIRNTKLHGHRGKIVNIASVLGDSSSNIIVP- 179

Query: 152 NGWSAYGCSKAALNHFAMDIASEEPSDKVRAVCIAPGVV---------DTQMQKDIRETL 202
            G + Y  SKAA+  +   ++ E     +    I+PG+V         D ++Q+ +RE L
Sbjct: 180 -GTAMYSASKAAMIQYNRVLSEELKRLSIDVQTISPGLVESTDMIKTLDPEIQQKLREKL 238

Query: 203 GPQG 206
            P G
Sbjct: 239 -PNG 241

>Sklu_2267.5 YNL202W, Contig c2267 5903-6955
          Length = 350

 Score = 41.2 bits (95), Expect = 4e-04,   Method: Compositional matrix adjust.
 Identities = 36/139 (25%), Positives = 66/139 (47%), Gaps = 12/139 (8%)

Query: 54  VYRVLDITDRSRMEALVEEIRQKHGKLDGIVANAG--MLEPVKSISQSNSEHDIKQWERL 111
           VY V D+ D  ++E  V +   + G++D ++A A    +    ++S SN+      ++ +
Sbjct: 139 VYGV-DVRDIKQLEDAVSQTVNEFGRIDFVIAGAAGNFISDFTNLS-SNA------FKSV 190

Query: 112 FDVNFFSIVSLVALCLPLLKSSPFVGNIVFVSSGASVKPYNGWSAYGCSKAALNHFAMDI 171
             ++     + V  C P LK +   G I+FVS+          S  G +KA ++  +  +
Sbjct: 191 VSIDLLGSFNTVKACFPQLKKNK--GAIIFVSATFHYYGVPFQSHVGAAKAGIDALSNAL 248

Query: 172 ASEEPSDKVRAVCIAPGVV 190
           A E     +R+ CIAPG +
Sbjct: 249 AVELGVLGIRSNCIAPGAI 267

>YBR159W (YBR159W) [344] chr2 (558641..559684) Major 3-ketoreductase
           of the fatty acid elongase system involved in synthesis
           of very long chain fatty acids [1044 bp, 347 aa]
          Length = 347

 Score = 40.8 bits (94), Expect = 6e-04,   Method: Compositional matrix adjust.
 Identities = 54/229 (23%), Positives = 97/229 (42%), Gaps = 27/229 (11%)

Query: 2   GKVILITGASRGIGLQLVKTVIEEDDECIVYGVARTEAGLQSLQREY-GADKFVYRVLDI 60
           GK   ITGAS GIG +  + + +     ++  ++RT++ L++LQ+E       V ++L I
Sbjct: 62  GKYCAITGASDGIGKEFARQMAKRGFNLVL--ISRTQSKLEALQKELEDQHHVVVKILAI 119

Query: 61  TDRSRMEALVEEIRQKHGKLDGIVANAGMLEPVKSISQSNS------EHDIKQWERLFDV 114
                 E+  E I++   +L   V        V ++ QS+S      E + K+   +  +
Sbjct: 120 DIAEDKESNYESIKELCAQLPITVL-------VNNVGQSHSIPVPFLETEEKELRNIITI 172

Query: 115 NFFSIVSLVALCLPLL--------KSSPFVGNIVFVSSGASVKPYNGWSAYGCSKAALNH 166
           N  + + +  +  P +        K S   G I+ + S   + P    + Y  SK+ L  
Sbjct: 173 NNTATLLITQIIAPKIVETVKAENKKSGTRGLILTMGSFGGLIPTPLLATYSGSKSFLQG 232

Query: 167 FAMDIASEEPSDKVRAVCIAPGVVDTQMQKDIRETL---GPQGMTPKAL 212
           ++  +A E   D +    I   +V + M K  R +L    PQ      L
Sbjct: 233 WSNSLAGELSKDAIDVELIISYLVTSSMSKIRRSSLMIPNPQQFVKSTL 281

>Scas_478.2
          Length = 920

 Score = 40.8 bits (94), Expect = 9e-04,   Method: Compositional matrix adjust.
 Identities = 49/197 (24%), Positives = 85/197 (43%), Gaps = 9/197 (4%)

Query: 2   GKVILITGASRGIGLQLVKTVIEEDDECIVYGVARTEAGLQSLQREYGADKFVYRVLDIT 61
           GKV++ITGA+ G+G        +   + I+  +   E  +  +  ++GAD       +I 
Sbjct: 325 GKVVIITGANGGLGKSHAMWFAKYGAKVIINDITNPETTVNEINSKFGADTAFPDSHNII 384

Query: 62  DRSRMEALVEEIRQKHGKLDGIVANAGMLEPVKSISQSNSEHDIKQWERLFDVNFFSIVS 121
             S  E +V+      G +D +V NAG+L     +  +      K+W  +  V+  +  +
Sbjct: 385 TES--ELVVKTAIDHFGHVDILVNNAGILRDKSFLKMTE-----KEWYPVLQVHLQATFA 437

Query: 122 LVALCLPLLKSSPFVGNIVFVSSGASVKPYNGWSAYGCSKAALNHFAMDIASEEPSDKVR 181
           +     P   S    G I+  +S + +    G + Y  +KAA+  F+  IA E     + 
Sbjct: 438 MCKAVWPHF-SKQNSGFIINTTSTSGIYGNFGQANYAAAKAAILGFSRTIAIEGAKKGII 496

Query: 182 AVCIAPGVVDTQMQKDI 198
              IAP   +T M K I
Sbjct: 497 VNIIAPH-AETAMTKTI 512

 Score = 38.9 bits (89), Expect = 0.004,   Method: Compositional matrix adjust.
 Identities = 36/139 (25%), Positives = 62/139 (44%), Gaps = 10/139 (7%)

Query: 78  GKLDGIVANAGMLEPVKSISQSNSEHDIKQWERLFDVNFFSIVSLVALCLPLLKSSPFVG 137
           GK+D ++ NAG+L  V     S ++   K+++ + DV+      L     P +K+  F G
Sbjct: 94  GKIDILINNAGILRDV-----SFNKMSEKEFQAVIDVHLNGAFQLTHAAWPYMKAQKF-G 147

Query: 138 NIVFVSSGASVKPYNGWSAYGCSKAALNHFAMDIASEEPSDKVRAVCIAP----GVVDTQ 193
            I+  +S A +    G + Y  +K  L   A  +A E     +    IAP     + +  
Sbjct: 148 RIINTASPAGLFGNFGQANYSAAKLGLVGLAETLAKEGFKYNILVNSIAPLARSRMTENV 207

Query: 194 MQKDIRETLGPQGMTPKAL 212
           +   I + LGP+ + P  L
Sbjct: 208 LPPHILKQLGPEKIAPLVL 226

>KLLA0B09812g complement(856799..857839) similar to sp|P38286
           Saccharomyces cerevisiae YBR159w singleton, start by
           similarity
          Length = 346

 Score = 40.0 bits (92), Expect = 0.001,   Method: Compositional matrix adjust.
 Identities = 55/224 (24%), Positives = 98/224 (43%), Gaps = 18/224 (8%)

Query: 2   GKVILITGASRGIGLQLVKTVIEEDDECIVYGVARTEAGLQSLQREYGAD-KFVYRVLDI 60
           G   ++TGAS GIG +  K + +     I+  ++RTE+ L  L++E   + K   ++L I
Sbjct: 65  GAYAVVTGASDGIGKEYAKQLAKRGFNLIL--ISRTESKLVELKKEIETECKIDVKILAI 122

Query: 61  ---TDRSRMEALVEEIRQKHGKLDGIVANAGMLEPVKSISQSNSEHDIKQWERLFDVNFF 117
              +D      L+ E+      +  ++ N G    +        E +++    +  +N  
Sbjct: 123 DVSSDSKENYTLIREVASGL-PVTVLINNVGKSHSIPVPFDQTEESELRD---IITINNT 178

Query: 118 SIVSLVALCLPLLKSSPFV----GNIVFVSSGASVKPYNGWSAYGCSKAALNHFAMDIAS 173
           + + +    LP LK+S       G I+ + S   + P    + Y  SKA L  ++  +A 
Sbjct: 179 ATLMITQTLLPQLKASVKTLKCRGLILTMGSFGGLLPTPFLATYSGSKAFLQSWSNALAG 238

Query: 174 EEPSDKVRAVCIAPGVVDTQMQKDIRET-LGPQGMTPKALERFT 216
           E  SD +    +   +V + M K  R + L P   +PKA  R T
Sbjct: 239 ELSSDSIDVELVLSYLVTSAMSKIRRSSALIP---SPKAFVRST 279

>Kwal_23.4572
          Length = 300

 Score = 39.7 bits (91), Expect = 0.001,   Method: Compositional matrix adjust.
 Identities = 32/138 (23%), Positives = 65/138 (47%), Gaps = 15/138 (10%)

Query: 58  LDITDRSRMEALVEEIRQKHGKLDGIVANAG--MLEPVKSISQSNSEHDIKQWERLFDVN 115
           +D+ +  ++E  V    ++ G++D ++A A    + P   +S +        ++ +  ++
Sbjct: 92  VDVREIEQLEEAVARTVERFGRIDFVIAGAAGNFIAPFSKLSAN-------AFKSVVSID 144

Query: 116 FFSIVSLVALCLPLLKSSPFVGNIVFVSSGASVK--PYNGWSAYGCSKAALNHFAMDIAS 173
                +    CL  L+ +   G+I+FVS+       PY   S  G +KA ++  +  +A 
Sbjct: 145 LLGSFNTAKACLAELQRTK--GSILFVSATFHYYGVPYQ--SHVGAAKAGVDALSNALAV 200

Query: 174 EEPSDKVRAVCIAPGVVD 191
           E     VR+ CIAPG ++
Sbjct: 201 ELGVSGVRSNCIAPGAIE 218

>YKR009C (FOX2) [3265] chr11 complement(453995..456697)
           Multifunctional enzyme of the peroxisomal fatty acid
           beta-oxidation pathway possessing 2-enoyl-CoA hydratase
           2 and D-3-hydroxyacyl-CoA dehydrogenase activities [2703
           bp, 900 aa]
          Length = 900

 Score = 40.0 bits (92), Expect = 0.001,   Method: Compositional matrix adjust.
 Identities = 50/223 (22%), Positives = 93/223 (41%), Gaps = 21/223 (9%)

Query: 3   KVILITGASRGIGLQLVKTVIEEDDECIVYGVARTEAGLQSLQREYGADKFVYRV----- 57
           +V++ITGA  G+G            + +V  +  T  G  S      AD  V  +     
Sbjct: 10  RVVVITGAGGGLGKVYALAYASRGAKVVVNDLGGTLGG--SGHNSKAADLVVDEIKKAGG 67

Query: 58  LDITDRSRM----EALVEEIRQKHGKLDGIVANAGMLEPVKSISQSNSEHDIKQWERLFD 113
           + + +   +    E ++E   ++ G++D ++ NAG+L  V     S ++   +++  + D
Sbjct: 68  IAVANYDSVNENGEKIIETAIKEFGRVDVLINNAGILRDV-----SFAKMTEREFASVVD 122

Query: 114 VNFFSIVSLVALCLPLLKSSPFVGNIVFVSSGASVKPYNGWSAYGCSKAALNHFAMDIAS 173
           V+      L     P ++S  F G I+  +S A +    G + Y  +K  L   A  +A 
Sbjct: 123 VHLTGGYKLSRAAWPYMRSQKF-GRIINTASPAGLFGNFGQANYSAAKMGLVGLAETLAK 181

Query: 174 EEPSDKVRAVCIAP----GVVDTQMQKDIRETLGPQGMTPKAL 212
           E     +    IAP     + +  +   I + LGP+ + P  L
Sbjct: 182 EGAKYNINVNSIAPLARSRMTENVLPPHILKQLGPEKIVPLVL 224

>Scas_641.31
          Length = 287

 Score = 38.9 bits (89), Expect = 0.002,   Method: Compositional matrix adjust.
 Identities = 44/155 (28%), Positives = 71/155 (45%), Gaps = 30/155 (19%)

Query: 69  LVEEIRQKHGK-----LDGIVANAGMLEPVKSISQSNSEHDIKQWERLFDVNFFSIVSLV 123
           L EEI  K+       ++ +V  AG+ +   S+S   S  +I Q   + ++NF S VSL 
Sbjct: 104 LFEEIWDKNASNTNYYVNLLVNCAGITQ--DSLSLRTSTDEISQ---IMNINFLSCVSLS 158

Query: 124 AL-CLPLLKSS----------------PFVGNIVFVSS--GASVKPYNGWSAYGCSKAAL 164
              C  +++S                 P    I+ +SS  G       G S Y  SKAAL
Sbjct: 159 NFVCKKMIRSQNLFKRGEMALDHELPKPPPPCIINISSILGEGTIQVPGTSIYSASKAAL 218

Query: 165 NHFAMDIASEEPSDKVRAVCIAPGVV-DTQMQKDI 198
             +   ++ E  +  +RA+ +APG+V DT M +++
Sbjct: 219 IQYTRTLSQETETWGIRALSMAPGLVTDTDMIQEM 253

>Kwal_14.2598
          Length = 311

 Score = 38.9 bits (89), Expect = 0.002,   Method: Compositional matrix adjust.
 Identities = 42/210 (20%), Positives = 84/210 (40%), Gaps = 32/210 (15%)

Query: 3   KVILITGASRGIGLQLVKTVIEEDDECIVYGVARTEAGLQS-----------------LQ 45
           +V+LI G S+G+G         E     V  V+R+   LQ+                  +
Sbjct: 9   QVVLIAGGSQGLGKAFASKFYNEGSNNKVIVVSRSRTKLQNAVCDVSGLKTAPELLPDTE 68

Query: 46  REYGADKFVYRVLDITDRSRMEALVEEIRQKHGKLDGIVANAGMLEP--VKSISQSNSEH 103
                +   Y   D+ + +++E L E ++    +   ++  AG   P   K +     E 
Sbjct: 69  IPKNGNHIWYSPCDLAEYAQVEKLYESLKACSLEPTQVLLCAGGSTPGLFKDLQGPELEL 128

Query: 104 DIKQWERLFDVNFFSIVSLVALCLPLLKSSPFVGNIVFVSSGASVKPYNGWSAYGCSKAA 163
            ++       VN+ + V+L  + +    +S    ++VF SS  +  P+ G+S Y   K +
Sbjct: 129 GVR-------VNYMTCVNLAHIAVCHWPTS----HLVFFSSEVAFFPFIGYSQYAPLKQS 177

Query: 164 LNHFAMDIASEEPSDKVRAVCIAPGVVDTQ 193
           +      +  E P  ++   C+ PG  +++
Sbjct: 178 IKSLVAILRQECPQQRIS--CVYPGNFNSE 205

>KLLA0D06127g complement(526164..527156) similar to sgd|S0005772
           Saccharomyces cerevisiae YOR246c, start by similarity
          Length = 330

 Score = 38.9 bits (89), Expect = 0.003,   Method: Compositional matrix adjust.
 Identities = 49/223 (21%), Positives = 89/223 (39%), Gaps = 44/223 (19%)

Query: 3   KVILITGASRGIGLQLVKTVIEEDDECIVYG--VARTEAGLQSLQREY------GAD--- 51
           KV L+TG + GIG   V  +     +  + G   +R    ++ +++E       G D   
Sbjct: 20  KVALVTGGNSGIGYYTVLHLYLHGFKVYLGGRNSSRVNHAIKEIKKEAEIRLRKGQDEKP 79

Query: 52  ----------KFVYRVLDITDRSRMEALVEEIRQKHGKLDGIVANAGMLEPVKSISQSNS 101
                     K  Y  +D+TD + +E    +   +   LD ++ NAG++     +++ N 
Sbjct: 80  HDGLMIRKTGKLEYLHIDLTDLNSVEKAATKFTVQEDHLDVLINNAGVMAIPYELTKDNF 139

Query: 102 EHDIKQWERLFDVNFFSIVSLVALCLPLLKS--------SPFVGNIVFVSS--GASVKPY 151
           E  ++        N+ S   L    LPL+K+        S    N++F +   GA    +
Sbjct: 140 EIQMQ-------TNYVSHFLLTMRLLPLIKARKGRVITVSSLGHNLIFFNCNPGAQFNYW 192

Query: 152 NG----WSAYGCSKAALNHFAMDIASEEPSDKVRAVCIAPGVV 190
                 W  Y  +K A   F   +A + P   +  + + PG+V
Sbjct: 193 PSMFFMWCRYALAKTASIQFTKMLAIKNPD--ILCMSLHPGLV 233

>Sklu_2219.3 YDL114W, Contig c2219 6060-7151 reverse complement
          Length = 363

 Score = 38.5 bits (88), Expect = 0.003,   Method: Compositional matrix adjust.
 Identities = 60/256 (23%), Positives = 106/256 (41%), Gaps = 46/256 (17%)

Query: 6   LITGASRGIGLQLVKTVIEEDDECIVYG-VARTEAGLQSLQREYGADKFVYRVLDITDRS 64
           LITG S G+GL++V+     + +  +   V   +    + + +   + F Y   DI++  
Sbjct: 87  LITGGSGGLGLEIVQQFQLLNIKTFILDIVPPPQMVFGNCEIKSNTNVFYYPC-DISNPK 145

Query: 65  RMEALVEEIRQKHGKLDGIVANAGMLEPVKSISQSNSEHDIKQWERLFDVNFFSIVSLVA 124
            +  L ++I+ +HG +  ++ NAG+    +    S+     K  E+   VN+ S    + 
Sbjct: 146 EIAELHKKIKLQHGNVTILINNAGITSGYRLQELSD-----KVIEKTIQVNYVSAFYTIQ 200

Query: 125 LCLPLLKSSPFVGNIVFVSSGASVKPYNGWSAYGCSKAALN--HFAM-----DIASEEPS 177
             LP + S    G IV V+S          +AYG SK  L   H A+      I    P 
Sbjct: 201 EFLPDMVSMS-RGYIVNVASVLGFMSPARLTAYGASKGGLISLHEALVNELYQIKRTRPQ 259

Query: 178 DK-----------VRAVCIAPGVVDTQMQKDIRETLGPQGMTPKALERFTQLYKTSSLLD 226
           D            ++A+ + PG + T + + I+        TP            SS++ 
Sbjct: 260 DSLHNLSPRSKIPIKALLVCPGKIKTPLFQAIQ--------TP------------SSVMA 299

Query: 227 PKVPAAVLAQLVLKGI 242
           P +  + LA  ++K I
Sbjct: 300 PDLDPSYLASEIIKAI 315

>YBR265W (TSC10) [445] chr2 (738539..739501) 3-Ketosphinganine
           reductase, catalyzes the second step in the synthesis of
           phytosphingosine [963 bp, 320 aa]
          Length = 320

 Score = 38.5 bits (88), Expect = 0.003,   Method: Compositional matrix adjust.
 Identities = 49/216 (22%), Positives = 89/216 (41%), Gaps = 34/216 (15%)

Query: 3   KVILITGASRGIGLQLVKTVIEEDDECIVYGVARTEAGL----------QSLQREYGAD- 51
           +V+LITG S+G+G +  K    E +   +  V+R+EA L            L+RE   + 
Sbjct: 8   QVVLITGGSQGLGKEFAKKYYNEAENTKIIIVSRSEARLLDTCNEIRIEAHLRRETTDEG 67

Query: 52  --------------KFVYRVLDITDRSRMEALVEEIRQKHGKLDGIVANAGMLEPVKSIS 97
                         +  Y   D++    +E L   +R         +  AG   P     
Sbjct: 68  QVQHKLAAPLDLEQRLFYYPCDLSCYESVECLFNALRDLDLLPTQTLCCAGGAVPKLFRG 127

Query: 98  QSNSEHDIKQWERLFDVNFFSIVSLVALCLPLLKSSPFVGNIVFVSSGASVKPYNGWSAY 157
            S  E ++       D+N+ + ++ VA  + L + +     I+F SS  ++ P+ G+S Y
Sbjct: 128 LSGHELNLG-----MDINYKTTLN-VAHQIALAEQTKEHHLIIF-SSATALYPFVGYSQY 180

Query: 158 GCSKAALNHFAMDIASEEPSDKVRAVCIAPGVVDTQ 193
             +KAA+      +  E  +   R  C+ PG  +++
Sbjct: 181 APAKAAIKSLVAILRQELTN--FRISCVYPGNFESE 214

>Kwal_26.8282
          Length = 298

 Score = 38.1 bits (87), Expect = 0.004,   Method: Compositional matrix adjust.
 Identities = 50/232 (21%), Positives = 92/232 (39%), Gaps = 36/232 (15%)

Query: 4   VILITGASRGIGLQLVKTVIEEDDECIVYGVARTEAGLQSLQREYGADKFVYRVLDITDR 63
           V L+TGA+RGIG  +V  + ++   C++ G   T       +     +K  +      D 
Sbjct: 37  VALVTGATRGIGRAIVDKLADKGVSCLMIGSQMTSFDRMRKRPPKIRNKHQWHRALAIDL 96

Query: 64  SRMEALVEE--------IRQKHGKLDGIVANA------------GMLEPVKSISQSN--- 100
            +     E+            H +L    AN              +L     I+Q++   
Sbjct: 97  GKWPQWTEQDVYTGVHFNGSMHEQLYAQEANQWSLFDIPDTHDIALLVNCAGITQASPAL 156

Query: 101 --SEHDIKQWERLFDVNFFSIVSLVALCL-------PLLKSSPFVGNIVFVSSGASVKPY 151
             S  DI    R+ ++N+ S V+L +L           L + P + N+  +       P 
Sbjct: 157 RCSPEDIL---RITNINYMSAVTLCSLSAKKMLRSRKHLATPPCIINVSSILGDPKTPPL 213

Query: 152 NGWSAYGCSKAALNHFAMDIASEEPSDKVRAVCIAPGVV-DTQMQKDIRETL 202
            G + Y  SKAAL  ++  ++ E     ++   ++P +V DT M + + +T+
Sbjct: 214 PGTALYSASKAALTQYSRVLSEELARSGIQVHSLSPSLVSDTDMIRTLEDTV 265

>Sklu_1624.3 YBR265W, Contig c1624 1338-2288
          Length = 316

 Score = 38.1 bits (87), Expect = 0.004,   Method: Compositional matrix adjust.
 Identities = 40/209 (19%), Positives = 85/209 (40%), Gaps = 30/209 (14%)

Query: 3   KVILITGASRGIGLQLVKTVIEEDDECIVYGVARTEAGLQS----------------LQR 46
           + +L+ G S+G+G Q       E     V  V+R+ A L +                L+ 
Sbjct: 12  QTLLVAGGSQGLGKQFACKYFAEGTANTVIVVSRSAAKLAAAVKDITGQDAQELTVDLEF 71

Query: 47  EYGADKFVYRVLDITDRSRMEALVEEIRQKHGKLDGIVANAGMLEP--VKSISQSNSEHD 104
           +       Y   D++D    E + E + +++     ++  AG   P   K ++       
Sbjct: 72  DSKERNMFYIPCDLSDYHATEKMYELLLERNLSPTQVMLCAGGSTPKLFKDLTGDELVTG 131

Query: 105 IKQWERLFDVNFFSIVSLVALCLPLLKSSPFVGNIVFVSSGASVKPYNGWSAYGCSKAAL 164
           ++       VN+ + ++L  +   L +    + +++F SS  +  P+ G+S Y   K ++
Sbjct: 132 VQ-------VNYMTCLNLAHV---LARKHSSLPHVIFFSSETAFFPFIGYSQYAPMKQSI 181

Query: 165 NHFAMDIASEEPSDKVRAVCIAPGVVDTQ 193
               M +  E P  ++   C+ PG  +++
Sbjct: 182 KALVMILRQEFPESRIS--CVYPGNFESE 208

>Kwal_34.16139
          Length = 315

 Score = 37.4 bits (85), Expect = 0.008,   Method: Compositional matrix adjust.
 Identities = 55/260 (21%), Positives = 97/260 (37%), Gaps = 43/260 (16%)

Query: 2   GKVILITGASRGIGLQLVKTVIEEDDECIVY--GVARTEAGLQSLQREYGADKFVYRVL- 58
           G V ++TG S G+   L + ++ +  E  +    V R E   + L     A+      + 
Sbjct: 34  GHVTIVTGGSGGLAHTLTQALLAQGSEVALLDLNVERLEYTKRELLEFAKANNLSKANVS 93

Query: 59  ----DITDRSRMEALVEEIRQKHGKL--DGIVANAGMLEPVKSISQSNSEHDIKQWERLF 112
               DI D   ++ +V  I  KH  +  D ++  AG  + V ++     E+D +Q E + 
Sbjct: 94  AWPCDIGDPDIVDEVVRAIPLKHNGIVPDKLIHTAGYCQNVPAL-----EYDARQAEAVV 148

Query: 113 DVNFFSIVSL------------------------VALCLPLLKSSPFVGNIVFVSSGASV 148
            VN    + +                            LP    + +V  ++   SG  V
Sbjct: 149 RVNLMGSLYICQSMSRQLLQKVQRRKSVSSASGEAGEALPQFPHASYV--LIGSMSGCIV 206

Query: 149 KPYNGWSAYGCSKAALNHFAMDIASEEPSDKVRAVCIAPGVVDTQMQKDIRETLGPQGMT 208
                  AY  SKA + H    +A E     +R   I+PG + T + K +     P+G  
Sbjct: 207 NNPQPQVAYNMSKAGVIHMVRSLACEWARYGIRVNSISPGYIATALTKKVISG-SPEGAA 265

Query: 209 PKALERFTQLYKTSSLLDPK 228
            +  + +T       + DP+
Sbjct: 266 LQ--QEWTSRVPMGRMADPR 283

>Kwal_14.1511
          Length = 277

 Score = 36.6 bits (83), Expect = 0.011,   Method: Compositional matrix adjust.
 Identities = 26/120 (21%), Positives = 57/120 (47%), Gaps = 10/120 (8%)

Query: 1   MGKVILITGASRGIGLQLVKTVIEEDDECIVYGVARTEAGLQSLQREY-----GADKFVY 55
           M K ILITGA++GIG  +   +  +  +  +  + +     Q++ +E      G    ++
Sbjct: 1   MPKTILITGAAQGIGKAIAVDLARKGYQLAIADLPQQNEKAQAVLKEIKELQSGVKAPIF 60

Query: 56  RVLDITDRSRMEALVEEIRQKHGKLDGIVANAGMLEPVKSISQSNSEHDIKQWERLFDVN 115
             +D++++  +  +V+++    G  D ++ NAG+    K +  +  E D     R+  +N
Sbjct: 61  LPIDVSNKESVFGVVDKVASHFGAFDVMINNAGIAMVAKILEATPEELD-----RIMKIN 115

>KLLA0D18909g complement(1592628..1593500) similar to sp|P32573
           Saccharomyces cerevisiae YNL202w SPS19 peroxisomal 2,
           4-dienoyl-CoA reductase singleton, start by similarity
          Length = 290

 Score = 36.6 bits (83), Expect = 0.014,   Method: Compositional matrix adjust.
 Identities = 33/135 (24%), Positives = 62/135 (45%), Gaps = 11/135 (8%)

Query: 58  LDITDRSRMEALVEEIRQKHGKLDGIVANAG--MLEPVKSISQSNSEHDIKQWERLFDVN 115
           +D+ +  ++   V+   QK G+LD ++A A    L     +S SN+      ++ +  ++
Sbjct: 82  VDVRNVDQLHEAVKVAIQKFGRLDYVIAGAAGNFLADFTHLS-SNA------FKSVVSID 134

Query: 116 FFSIVSLVALCLPLLKSSPFVGNIVFVSSGASVKPYNGWSAYGCSKAALNHFAMDIASEE 175
                + V  C P L  +   G+++FVSS          S  G +KA ++  +  +A E 
Sbjct: 135 LLGSFNTVKACFPELVKTK--GSVLFVSSTLHYYGVPFQSHVGAAKAGIDALSNALAVEM 192

Query: 176 PSDKVRAVCIAPGVV 190
               +R  C+APG +
Sbjct: 193 GPLGLRFNCVAPGAI 207

>Kwal_26.8838
          Length = 323

 Score = 36.2 bits (82), Expect = 0.016,   Method: Compositional matrix adjust.
 Identities = 48/219 (21%), Positives = 86/219 (39%), Gaps = 42/219 (19%)

Query: 3   KVILITGASRGIGLQLVKTVIEEDDECIVYG--VARTEAGLQSLQRE------------- 47
           KV L+TG + GIG   V  +        V G   +R    ++ +++E             
Sbjct: 19  KVALVTGGNSGIGWYTVLHLYLHGFAVYVAGRNSSRVNRAIKDIKKEARTRIKKEDPESR 78

Query: 48  YGADKFVYRVLDITDRSRMEALVEEIRQKHGKLDGIVANAGMLEPVKSISQSNSEHDIKQ 107
           +   +  +  LD+T+   ++   +  R    +LD ++ NAG++    S+++   E  ++ 
Sbjct: 79  HPVGELYFLSLDLTELKLVDKAAKRFRSLETRLDVLINNAGVMALPYSVTEDGFEIQLQ- 137

Query: 108 WERLFDVNFFSIVSLVALCLPLLKSSPFVGNIVFVSS--------------GASVKP--Y 151
                  N+ +   L    LP +K     G I+ VSS                + KP   
Sbjct: 138 ------TNYIAHFLLTMRLLPSVKRCR--GRIITVSSIGHNLEFSYFSLAQSFNYKPNML 189

Query: 152 NGWSAYGCSKAALNHFAMDIASEEPSDKVRAVCIAPGVV 190
             W  Y  +K A   FA  +A + P   V  + + PG+V
Sbjct: 190 FTWMRYAMAKTASIQFAKMLAIKHPD--VLCMSVHPGLV 226

>AAL089W [98] [Homologous to ScYOR246C - SH]
           complement(184564..185550) [987 bp, 328 aa]
          Length = 328

 Score = 35.8 bits (81), Expect = 0.026,   Method: Compositional matrix adjust.
 Identities = 50/225 (22%), Positives = 85/225 (37%), Gaps = 50/225 (22%)

Query: 3   KVILITGASRGIGLQLVKTVIEEDDECIVYGVARTEAGLQSLQREYGAD----------- 51
           KV L+TG + GIG   V  +       IVY   R  + +    +E   +           
Sbjct: 20  KVALVTGGNSGIGWYTVLHLYMHG--FIVYVGGRNSSRVHKAIKEIKQEAENRLETARQD 77

Query: 52  ----------KFVYRVLDITDRSRMEALVEEIRQKHGKLDGIVANAGMLEPVKSISQSNS 101
                     +  Y  +D+TD   +E   ++ R +   LD ++ NAG++     ++    
Sbjct: 78  PHDELERCLGELRYLPIDLTDLRSVEKAAKKFRAQESTLDVLINNAGVMALPYELTHDGF 137

Query: 102 EHDIKQWERLFDVNFFSIVSLVALCLPLLKSSPFVGNIVFVSS-GASV------------ 148
           E  ++        N+ S   L    LP +K S   G +V +SS G  +            
Sbjct: 138 EVQMQ-------TNYVSHFLLTMRLLPYVKRSG--GRVVTLSSIGHKIQFTYCPLDCHFD 188

Query: 149 -KP--YNGWSAYGCSKAALNHFAMDIASEEPSDKVRAVCIAPGVV 190
            +P  +  W  Y  +K A   F   +A + P   V  + + PG+V
Sbjct: 189 YRPNIFFTWLRYAMAKTAAIQFTKMLAIKHPD--VMCIAVHPGLV 231

>Sklu_1570.1 YKR009C, Contig c1570 100-2370
          Length = 756

 Score = 36.2 bits (82), Expect = 0.027,   Method: Compositional matrix adjust.
 Identities = 26/128 (20%), Positives = 55/128 (42%), Gaps = 7/128 (5%)

Query: 3   KVILITGASRGIGLQLVKTVIEEDDECIVYGVARTEAGLQSLQREYGADKFVYRVLDITD 62
           K++++TGA  G+G        +   + +V  +   E  +  + + YG    +    D+  
Sbjct: 185 KIVIVTGAGGGLGRSHALWFAKYGAKVVVNDIKAPEPVVDEINKIYGGGSAIPDKHDVV- 243

Query: 63  RSRMEALVEEIRQKHGKLDGIVANAGMLEPVKSISQSNSEHDIKQWERLFDVNFFSIVSL 122
            ++   +V+   +  G++D +V NAG+L     +  ++ E     W  +  V+ FS   L
Sbjct: 244 -TQPTEIVKTALEAFGRVDVLVNNAGILRDRSFLKMTDEE-----WYAVLKVHLFSTYGL 297

Query: 123 VALCLPLL 130
                P+ 
Sbjct: 298 SKAVWPVF 305

>Kwal_27.12155
          Length = 280

 Score = 35.0 bits (79), Expect = 0.036,   Method: Compositional matrix adjust.
 Identities = 31/121 (25%), Positives = 58/121 (47%), Gaps = 10/121 (8%)

Query: 2   GKVILITGASRGIGLQLVKTVIEEDDECIVYGVARTEAGLQSLQREYGADKFVYRVL--- 58
           GKV  I+GAS GIG  + +   +   +  V+    +   L    R+  A+ +  RV+   
Sbjct: 30  GKVACISGASSGIGAAVAEAFAQAGADLAVW--YNSHPALVETARDL-ANTYHVRVVAYK 86

Query: 59  -DITDRSRMEALVEEIRQKHGKLDGIVANAGMLEPVKSI--SQSNSEHDIKQWERLFDVN 115
             + D  +++A +  +  + G++D  VANAG+      +  +Q  S  D ++W R+   +
Sbjct: 87  CPVDDEQQVQATIARVITEFGRIDVFVANAGVAWHEGPLLDAQRRSVAD-QEWNRIIQTD 145

Query: 116 F 116
           F
Sbjct: 146 F 146

>CAGL0H08063g 785331..786203 highly similar to sp|P32573
           Saccharomyces cerevisiae YNL202w SPS19, start by
           similarity
          Length = 290

 Score = 34.7 bits (78), Expect = 0.050,   Method: Compositional matrix adjust.
 Identities = 36/142 (25%), Positives = 66/142 (46%), Gaps = 25/142 (17%)

Query: 58  LDITDRSRMEALVEEIRQKHGKLDGIVANAGMLEPVKSISQSNSEHDIKQWERLFDVNFF 117
           +D+ +  ++E+ V+    ++G++D ++A A             + + I  +  L    F 
Sbjct: 82  VDVREVKQLESAVKRTVDRYGRIDYVIAGA-------------AGNFICDFNHLSANAFK 128

Query: 118 SIVSLVAL--------CLP-LLKSSPFVGNIVFVSSGASVKPYNGWSAYGCSKAALNHFA 168
           S+VS+  L         +P L+KS    G+I+FVS+          S  G +KA ++  +
Sbjct: 129 SVVSIDLLGSFNTAKATMPELIKSR---GSILFVSATFHYYGVPFQSHVGAAKAGIDALS 185

Query: 169 MDIASEEPSDKVRAVCIAPGVV 190
             +A E     VR+ CIAPG +
Sbjct: 186 NALAVEMGPFGVRSNCIAPGAI 207

>Sklu_2404.13 YKL055C, Contig c2404 24100-25005
          Length = 301

 Score = 34.7 bits (78), Expect = 0.057,   Method: Compositional matrix adjust.
 Identities = 18/49 (36%), Positives = 28/49 (57%), Gaps = 1/49 (2%)

Query: 153 GWSAYGCSKAALNHFAMDIASEEPSDKVRAVCIAPGVV-DTQMQKDIRE 200
           G S Y  SKAA+  ++M ++ E     VR  C++P +V DT M + + E
Sbjct: 212 GTSIYSASKAAIAQYSMVLSQELARSGVRVNCVSPKLVADTDMIRTLSE 260

>KLLA0F01749g complement(163821..164762) similar to sp|P38342
           Saccharomyces cerevisiae YBR265w TSC10 3-ketosphinganine
           reductase singleton, start by similarity
          Length = 313

 Score = 34.7 bits (78), Expect = 0.059,   Method: Compositional matrix adjust.
 Identities = 43/208 (20%), Positives = 83/208 (39%), Gaps = 33/208 (15%)

Query: 2   GKVILITGASRGIGLQLVKTVIEEDD-----ECIVYGVARTEAGLQSLQREYGAD----- 51
           G+VILI+G S+G+G    K  +++DD        V  V+R+++ L       G D     
Sbjct: 8   GQVILISGGSQGLGESFAKRFVQDDDGPGSNTNKVIIVSRSQSKLVKACERIGVDGVSLD 67

Query: 52  -----------KFVYRVLDITDRSRMEALVEEIRQKHGKLDGIVANAGMLEPVKSISQSN 100
                      K +Y   D +   ++  + + + +       +   AG      SI +  
Sbjct: 68  RYVNDTNRNETKLIYHSCDTSSYDKVALMFKLLVKSELVPSQVYMCAG-----GSIPKLF 122

Query: 101 SEHDIKQWERLFDVNFFSIVSLVALCLPLLKSSPFVGNIVFVSSGASVKPYNGWSAYGCS 160
            +   ++ +     N+ + V+L  + L        V +++F SS  +  P+ G++ Y   
Sbjct: 123 LDLTPEELQNGITTNYSTAVNLAHVSL-----KHDVPHLLFFSSEVAFFPFIGYAQYAPL 177

Query: 161 KAALNHFAMDIASEEPSDKVRAVCIAPG 188
           K ++      +  E  S   R  C+ PG
Sbjct: 178 KQSIRSLVAILRQEHSS--TRITCVYPG 203

>Kwal_23.3107
          Length = 248

 Score = 34.3 bits (77), Expect = 0.061,   Method: Compositional matrix adjust.
 Identities = 45/207 (21%), Positives = 82/207 (39%), Gaps = 37/207 (17%)

Query: 2   GKVILITGASRGIGLQLVKTVIEEDDECIVYGVARTEAGLQSLQREYGADKFVYRVL--- 58
           GKV LITG ++ +G      +       +      T+   + L  E  +   V   L   
Sbjct: 5   GKVALITGGTKNLGRLTAIELASRHKANLFLHYNSTQGDEKKLADELSSKYNVKVELYQG 64

Query: 59  DITDRSRMEALVEEIRQKHGKLDGIVANAG--MLEPVKSISQSN-SEHDIKQWERLFDVN 115
           ++     +E L E  + K G +D  + N G  + +P+  +++    E D+   +    + 
Sbjct: 65  NLGSAKNVEKLFEAAKAKFGSIDIAINNVGKVLKKPMVEVTEEEFDEMDLVNNK----IA 120

Query: 116 FFSIV----------SLVALCLPLLKSSPFVGNIVFVSSGASVKPYNGWSAYGCSKAALN 165
           FF I           S+++L   LL               A+  P+  ++ Y  +K+A+ 
Sbjct: 121 FFFIAQATKHVSSGGSIISLVTSLL---------------AAYTPF--YAVYQGTKSAVE 163

Query: 166 HFAMDIASEEPSDKVRAVCIAPGVVDT 192
            +    + E    +V   CIAPG +DT
Sbjct: 164 FYTKSASKELIEKRVSVNCIAPGPMDT 190

>Sklu_2420.5 YOR246C, Contig c2420 9342-10322 reverse complement
          Length = 326

 Score = 34.7 bits (78), Expect = 0.065,   Method: Compositional matrix adjust.
 Identities = 54/227 (23%), Positives = 89/227 (39%), Gaps = 55/227 (24%)

Query: 3   KVILITGASRGIGLQLVKTVIEEDDECIVYGVAR-----------------------TEA 39
           KV L+TG + GIG   V  +       IVY   R                       T  
Sbjct: 19  KVALVTGGNSGIGWYTVLHLYMHG--FIVYVGGRNSSRVNQAIKAIQNEAKSRQRKSTFK 76

Query: 40  GLQSLQREYGADKFVYRVLDITDRSRMEALVEEIRQKHGKLDGIVANAGMLEPVKSISQS 99
           GL+ L+R +G   F+   LD++D   ++    + +     LD ++ NAG++     I++ 
Sbjct: 77  GLK-LERNFGKLHFL--SLDLSDLRSVDKAAAKFKGLELSLDVLINNAGVMALPYEITKD 133

Query: 100 NSEHDIKQWERLFDVNFFSIVSLVALCLPLLKSSPFVGNIVFVSS-GASV--------KP 150
             E  ++        N+ S   L    LP +K     G ++ VSS G ++        + 
Sbjct: 134 GFEIQLQ-------TNYISHFLLTMRLLPRIKRCN--GRVITVSSIGHNLEFTYFNLNRD 184

Query: 151 YN-------GWSAYGCSKAALNHFAMDIASEEPSDKVRAVCIAPGVV 190
           +N        W  Y  +K AL  F   +A + P   V  + + PG+V
Sbjct: 185 FNYMPNIIFTWMRYAMAKTALIQFTKMLAIKHPD--VLCISVHPGLV 229

>Scas_721.47
          Length = 344

 Score = 33.5 bits (75), Expect = 0.14,   Method: Compositional matrix adjust.
 Identities = 44/215 (20%), Positives = 95/215 (44%), Gaps = 28/215 (13%)

Query: 2   GKVILITGASRGIGLQLVKTVIEEDDECIVYGVARTEAGLQSLQREYGADKFVYRV---- 57
           GK  ++TGAS GIG +    +       ++  ++RT + L++L+ E+   K+  +V    
Sbjct: 62  GKYCVVTGASDGIGKEFANQMAARGFNLVL--ISRTLSKLEALKEEF-EKKYGIKVEILA 118

Query: 58  LDITDRSRMEALVEEIRQKHGKLDGIVANAGMLEPVKSISQSNS------EHDIKQWERL 111
           +DI+  S         +  +  + G+  +  +   + ++ QS+S      E + ++   +
Sbjct: 119 IDISSDS---------QDNYEFIKGLCKDLPITVLINNVGQSHSIPVPFLETEEEELRNI 169

Query: 112 FDVNFFSIVSLVALCLPLL-----KSSPFVGNIVFVSSGASVKPYNGWSAYGCSKAALNH 166
             +N  + + +  +  P++     ++    G I+ + S   + P    + Y  SKA L  
Sbjct: 170 ITINNTATLLITQIIAPIISKTVKETKKSRGLILTMGSFGGLIPTPLLATYSGSKAFLQQ 229

Query: 167 FAMDIASEEPSDKVRAVCIAPGVVDTQMQKDIRET 201
           ++  +A E   D +    +   +V + M K IR T
Sbjct: 230 WSTSLAGELQKDNIDVELVLSYLVTSSMSK-IRRT 263

>CAGL0M13013g complement(1281291..1282103) similar to sp|P35731
           Saccharomyces cerevisiae YKL055c OAR1, hypothetical
           start
          Length = 270

 Score = 31.2 bits (69), Expect = 0.80,   Method: Compositional matrix adjust.
 Identities = 57/238 (23%), Positives = 94/238 (39%), Gaps = 49/238 (20%)

Query: 6   LITGASRGIGLQLVKTVIEEDDECIVYGVARTEAGLQSLQREYGADKFVYRVLDITDRSR 65
           ++TGA+ G+G  +V+ +  E   CI  G + T++  + L+  +G D           R+R
Sbjct: 8   IVTGATGGVGKAIVRKLTREGVNCIAIG-SSTDSITKKLR--FGDDLLF---TGAHHRNR 61

Query: 66  MEALV-----EEIRQKHGKLDGIVANAGMLEPVKSISQSNS----EHDIKQW-------- 108
             AL       E       ++G +A   +    K +  SN+     +D  ++        
Sbjct: 62  AVALDLARWDGEFNHSAATIEGYIAEGNISTSNKELVLSNALAFDNNDSNRYTLRVLVNC 121

Query: 109 -----------------ERLFDVNFFSIVSL--VALCLPLLKSSPFVGNIVFVSS--GAS 147
                              + +VNF S V L   A  L + + S    +I+ VSS  G  
Sbjct: 122 AGITQASVGIRMSPNVISNMINVNFASAVYLSNYAARLQMKQKSRKRLDIINVSSILGGF 181

Query: 148 VKPYN----GWSAYGCSKAALNHFAMDIASEEPSDKVRAVCIAPGVV-DTQMQKDIRE 200
               N    G S Y  +KAAL+ F      E     +    IAPG++ +T M K++ E
Sbjct: 182 ADKRNFMIQGTSIYSATKAALSQFTRVYGKEVERLSINCHDIAPGLIPETDMIKNLPE 239

>CAGL0D03718g complement(375335..376552) highly similar to sp|P38431
           Saccharomyces cerevisiae YPR041w TIF5 translation
           initiation factor eIF5, start by similarity
          Length = 405

 Score = 30.8 bits (68), Expect = 0.99,   Method: Compositional matrix adjust.
 Identities = 22/82 (26%), Positives = 40/82 (48%), Gaps = 8/82 (9%)

Query: 165 NHFAMDIASEEPSDKVRAVCIAPGVVDTQMQK-------DIRETLGPQGMTPKALERFTQ 217
           + +A+D++ E    + + + +A G VDT++ K        I E    +   P  +E + +
Sbjct: 217 DEWAVDMSEEAIRARAKELQVANGAVDTELTKLEEYGEWIINEAGEDKSNLPSDVELYKK 276

Query: 218 LYKTSSLLDPKVPAAVLAQLVL 239
             +   L DPK+ A VLAQ + 
Sbjct: 277 AVELDVLSDPKI-ACVLAQCIF 297

>Scas_655.19
          Length = 297

 Score = 30.4 bits (67), Expect = 1.2,   Method: Compositional matrix adjust.
 Identities = 40/201 (19%), Positives = 87/201 (43%), Gaps = 20/201 (9%)

Query: 2   GKVILITGASRGIG---------LQLVKTVIEEDDECIVYGVARTEAGLQSLQREYGADK 52
           GKV+ +TG +  I          L     ++  +++  +      E+ ++S      AD 
Sbjct: 22  GKVVFVTGGAGTICRVQVEAMVLLGCKAAILGREEKKTIDAAKEIESLVRSPTENDDADP 81

Query: 53  FVYRV--LDITDRSRMEALVEEIRQKHGKLDGIVANAGMLEPVKSISQSNSEHDIKQWER 110
            V  +  +D+ +  +++  V++     G +D ++A A        ++ S +      ++ 
Sbjct: 82  IVLPLGNIDVRNFDQLKNAVKKTVDTFGHIDYLIAGAAGNFICDFMNLSPN-----AFKS 136

Query: 111 LFDVNFFSIVSLVALCLP-LLKSSPFVGNIVFVSSGASVKPYNGWSAYGCSKAALNHFAM 169
           + D++     + V  C   L+K+    G+++FVS+             G +KA ++  + 
Sbjct: 137 VIDIDLLGSFNTVKACASQLIKNK---GSVLFVSATFHYYGVPFQLHVGAAKAGIDALSN 193

Query: 170 DIASEEPSDKVRAVCIAPGVV 190
           ++A E     VR+ CIAPG +
Sbjct: 194 NLAVELGPLGVRSNCIAPGAI 214

>KLLA0F19756g 1830489..1831529 similar to sgd|S0004094 Saccharomyces
           cerevisiae YLR100w ERG27 3-keto sterol reductase,
           hypothetical start
          Length = 346

 Score = 30.4 bits (67), Expect = 1.3,   Method: Compositional matrix adjust.
 Identities = 41/185 (22%), Positives = 76/185 (41%), Gaps = 39/185 (21%)

Query: 3   KVILITGASRGIGLQLVKTVIEE---DDECIVYGVART-----------EAGLQSLQREY 48
           KV ++TG +  +GL +V  +IE    +D   +   +RT           +A + ++ R  
Sbjct: 5   KVAVVTGTNSNLGLNIVYRLIERSEPEDNLTIVVTSRTLPRVRECIDLIKAFVNTINRT- 63

Query: 49  GADKFVYRVLDITDRSRMEALVEEIRQKHGKLDGIVANAG--------MLEPVKSISQS- 99
           G+  + Y ++D T+   +      + +++  ++    NA          L  VK +  S 
Sbjct: 64  GSVDYDYLLVDFTNMISILDAHYSLSKRYDHINYFFVNAAQGVYSGIDWLGAVKEVFSSP 123

Query: 100 -----NSEHDIKQ--------WERLFDVNFFSIVSLVALCLPLLKSSPFVGNIVFVSSGA 146
                N  + I++           +F  N F    L+   LPLL++    G +V+VSS  
Sbjct: 124 LEAVTNPTYKIQRVGVKSKDGMGLVFQANVFGPYYLIQKLLPLLQAGQ--GTVVWVSSIM 181

Query: 147 SVKPY 151
           S   Y
Sbjct: 182 SAPKY 186

>Scas_718.32
          Length = 1001

 Score = 30.8 bits (68), Expect = 1.4,   Method: Compositional matrix adjust.
 Identities = 24/92 (26%), Positives = 45/92 (48%), Gaps = 21/92 (22%)

Query: 48  YGADKFVYRVLDITDRSRMEALVEEIRQKHGKLDGIVANAGMLEPVKSISQSNSEHDIKQ 107
           Y + + +YR+LD+  +   +AL+++I      LD     + M   V        + D+K+
Sbjct: 343 YDSQQRLYRLLDLESKPSRKALIQDI------LD-----SDMFSKV--------DEDVKK 383

Query: 108 WERLFDVNFF--SIVSLVALCLPLLKSSPFVG 137
              L +VN+   +I S ++  LP L+S P+  
Sbjct: 384 LYELIEVNYNADTIKSELSTLLPQLQSKPYFS 415

>YBR019C (GAL10) [212] chr2 complement(276215..278314) UDP-glucose
          4-epimerase, catalyzes a step in galactose metabolism
          [2100 bp, 699 aa]
          Length = 699

 Score = 30.4 bits (67), Expect = 1.4,   Method: Compositional matrix adjust.
 Identities = 23/92 (25%), Positives = 44/92 (47%), Gaps = 14/92 (15%)

Query: 3  KVILITGASRGIGLQLVKTVIEEDDECIV-----YGVARTEAGLQSLQREYGADKFVYRV 57
          K++L+TG +  IG   V  +IE   +C+V          + A L+ L + +      +  
Sbjct: 12 KIVLVTGGAGYIGSHTVVELIENGYDCVVADNLSNSTYDSVARLEVLTKHH----IPFYE 67

Query: 58 LDITDRSRMEALVEEIRQKHGKLDGIVANAGM 89
          +D+ DR  +E + +E      K+D ++  AG+
Sbjct: 68 VDLCDRKGLEKVFKEY-----KIDSVIHFAGL 94

>Kwal_33.14694
          Length = 340

 Score = 30.4 bits (67), Expect = 1.5,   Method: Compositional matrix adjust.
 Identities = 25/101 (24%), Positives = 48/101 (47%), Gaps = 12/101 (11%)

Query: 5   ILITGASRGIGLQLVKTVIEEDDECIVYGVARTEAGLQSLQREYGADK-FVYRVLDITDR 63
           +LI G + G+G  L++     +    +  VA  +   + + ++YGAD+ F Y   D+   
Sbjct: 174 LLIWGGATGVGQWLIQVAKALNAYTKIVVVASRKH--EHILKQYGADELFDYHDADV--- 228

Query: 64  SRMEALVEEIRQKHGKLDGIVANAGMLEPVKSISQSNSEHD 104
                 +E+I+QK+G    +V      E  K ++Q  S+ +
Sbjct: 229 ------LEQIKQKYGGFRYLVDAVSTPETFKQVNQCASDKE 263

>ABL163W [429] [Homologous to ScYNL202W (SPS19) - SH]
           complement(93017..93895) [879 bp, 292 aa]
          Length = 292

 Score = 29.6 bits (65), Expect = 2.0,   Method: Compositional matrix adjust.
 Identities = 28/135 (20%), Positives = 61/135 (45%), Gaps = 11/135 (8%)

Query: 58  LDITDRSRMEALVEEIRQKHGKLDGIVANAG--MLEPVKSISQSNSEHDIKQWERLFDVN 115
           +D+ + + M+  VE+     G++D ++A A    L  + ++S        + ++ + D++
Sbjct: 82  VDVREVADMKRAVEQTVAAFGRIDYVIAGAAGNFLADMTNLSS-------RAFKTVLDID 134

Query: 116 FFSIVSLVALCLPLLKSSPFVGNIVFVSSGASVKPYNGWSAYGCSKAALNHFAMDIASEE 175
                + V   L  L  +   G ++FVS+          +    +KA ++  +  +A E 
Sbjct: 135 LVGSYNTVKATLSELAKNK--GAVLFVSATLHYTGTPLQAHVSAAKAGVDALSNVLAVEL 192

Query: 176 PSDKVRAVCIAPGVV 190
               +R  CIAPG++
Sbjct: 193 GPLGIRCNCIAPGLI 207

>YLR426W (YLR426W) [3802] chr12 (987058..987137,987209..988109)
           Member of the short chain alcohol dehydrogenase/ribitol
           dehydrogenase family [981 bp, 326 aa]
          Length = 326

 Score = 29.6 bits (65), Expect = 2.1,   Method: Compositional matrix adjust.
 Identities = 24/121 (19%), Positives = 59/121 (48%), Gaps = 12/121 (9%)

Query: 4   VILITGASRGIGLQLVKTVIEEDDECIVYGVARTEAGLQSLQREYGADKFVYRVLDITDR 63
           ++LITG S+G+G  +V  ++++     +  V    + +++        +    + D++D 
Sbjct: 72  IVLITGGSKGLGRAIVSQLLQDYSNLTILNVDICPSSVRN-------TRVKDLICDLSDD 124

Query: 64  SRMEALVEEIRQKH-GKLDGIVANAGMLEPVKSISQSNSEHDIKQWERLFDVNFFSIVSL 122
             + AL+  +++K+  ++  IV NAG+         +  E D    +++F +N F+ +  
Sbjct: 125 EEVAALLNLLKRKYKNEIRLIVNNAGVRANFTGF--NGMERD--NLDKIFKINTFAPLQF 180

Query: 123 V 123
           +
Sbjct: 181 I 181

>YPL033C (YPL033C) [5405] chr16 complement(487358..488203) Protein
           of unknown function [846 bp, 281 aa]
          Length = 281

 Score = 29.3 bits (64), Expect = 2.7,   Method: Compositional matrix adjust.
 Identities = 42/189 (22%), Positives = 83/189 (43%), Gaps = 25/189 (13%)

Query: 4   VILITGASRGIGLQLVKTVIEEDDECIVYGVARTEAGLQSLQREYGADKFVYRVLDITDR 63
           V++I G+S  +G++L +T IE+    ++          ++ +R   ++K +Y  +   D 
Sbjct: 29  VLIIGGSSNELGIELCETFIEDYHTKVINIDTIDSINGKNARR---SEK-LYTFISCKDF 84

Query: 64  SRMEALVEEI--RQKHGKLDGIVANAGMLEPVKSISQSN------SEHDIKQWERLFDVN 115
           S ++ L E +   Q    +  ++ N  M E ++S            E  + ++E++   N
Sbjct: 85  SDIKCLEESMLYLQNLEIIPTVLIN-NMQEGIESTLLKEDKFLRLDEESLNEFEKIVRYN 143

Query: 116 FFSIVSLVALCLPLL----------KSSPFVGNIVFVSSGASVKPYNGWSAYGCSKAALN 165
             S++ +   CL  +          K+  F   IV +SS  ++KP    + +  SK  +N
Sbjct: 144 LQSVILITKFCLSNIFPKVQAEAQEKAKGFY--IVNISSVLTLKPCKSGTHFITSKCGIN 201

Query: 166 HFAMDIASE 174
            F   I SE
Sbjct: 202 SFHDGITSE 210

>Scas_680.6
          Length = 367

 Score = 29.3 bits (64), Expect = 3.0,   Method: Compositional matrix adjust.
 Identities = 50/224 (22%), Positives = 95/224 (42%), Gaps = 44/224 (19%)

Query: 5   ILITGASRGIGLQLVKTVIEEDDECIVYGVARTEAGLQSLQREYGADKFVYRVLDITDRS 64
           + ++GAS  I   ++K ++E+D + I  G  R++   + +   +  +  +   + + D +
Sbjct: 25  VFVSGASGFIAQHIIKLLLEQDYKVI--GSVRSQEKAKHVLSNFNHNPNLNLEI-VKDLA 81

Query: 65  RMEALVEEIRQKHGKLDGIVANAGMLEPVKSISQSNSEHDIKQWERLFDVNFFSIVSLVA 124
            + A  +E+ QKHGK   IV     L P   ++      ++   E+  DV   ++  + +
Sbjct: 82  DLTAF-DEVFQKHGKEIKIV-----LHPASPVT-----FEVNDLEK--DVLIPAVNGVKS 128

Query: 125 LCLPLLKSSP-FVGNIVFVSSG-ASVKPY-----------NGW-------------SAYG 158
           +   +LK +P  V  +V+ SS  A   P            N W             +AY 
Sbjct: 129 ILNAILKYAPQTVERVVYTSSAMAQFNPAGKFSKDTLIDENSWNDATWENCQIDAVNAYS 188

Query: 159 CSKAALNHFAMDIASEEPSD-KVRAVCIAPG-VVDTQMQKDIRE 200
            SKA     A D   E  ++ K +   + P  V+  QM+ D+ +
Sbjct: 189 GSKAFAERAAWDFMKEHGNEVKFKLTTVLPTYVLGPQMKIDVSK 232

>YDR393W (SHE9) [1221] chr4 (1259889..1261259) Protein essential for
           maintaining wild-type mitochondrial morphology, has
           similarity to Arabidopsis thaliana CIP1, causes
           lethality when overexpressed [1371 bp, 456 aa]
          Length = 456

 Score = 29.3 bits (64), Expect = 3.2,   Method: Compositional matrix adjust.
 Identities = 15/33 (45%), Positives = 20/33 (60%), Gaps = 1/33 (3%)

Query: 193 QMQKDIRETLGPQ-GMTPKALERFTQLYKTSSL 224
           Q Q+++ E L  Q   +   LERFTQLYK  +L
Sbjct: 215 QSQREVNELLQRQSAWSSSDLERFTQLYKNDAL 247

>Kwal_56.23863
          Length = 344

 Score = 28.9 bits (63), Expect = 4.0,   Method: Compositional matrix adjust.
 Identities = 16/88 (18%), Positives = 39/88 (44%), Gaps = 3/88 (3%)

Query: 1  MGKVILITGASRGIGLQLVKTVIEEDDECIVYGVARTEAGLQSLQREYGADKFVYRVLDI 60
          M + +LITGA+  +   ++  +++  +  ++ G  R+      L   + +D+    V  +
Sbjct: 3  MAETVLITGANNYVAQHIINVLLKNSNYNVI-GTVRSNEKAVKLSENFNSDRLKCEV--V 59

Query: 61 TDRSRMEALVEEIRQKHGKLDGIVANAG 88
          +D     A  E   + + K+  ++  A 
Sbjct: 60 SDMGSQNAFDEVFSKYYTKITHVIHTAS 87

>Kwal_27.11910
          Length = 184

 Score = 28.5 bits (62), Expect = 4.3,   Method: Compositional matrix adjust.
 Identities = 19/60 (31%), Positives = 34/60 (56%), Gaps = 3/60 (5%)

Query: 2   GKVILITGASRGIGLQLVKTVIEEDDECIVYGVARTEAGLQSLQREYGAD-KFVYRVLDI 60
           G   ++TGAS GIG +  + + +     ++  ++RT + L+SLQ E+  + K   R+L I
Sbjct: 62  GNYCVVTGASDGIGKEYARQMAKRGFNLVL--ISRTLSKLESLQSEFEKEYKVQVRILAI 119

>YLR100W (ERG27) [3516] chr12 (341811..342854) 3-Keto sterol
           reductase, required for ergosterol biosynthesis [1044
           bp, 347 aa]
          Length = 347

 Score = 28.5 bits (62), Expect = 5.3,   Method: Compositional matrix adjust.
 Identities = 22/101 (21%), Positives = 42/101 (41%), Gaps = 15/101 (14%)

Query: 3   KVILITGASRGIGLQLVKTVIEEDDECIVYGVARTEAGLQSLQREYGADK---------- 52
           KV ++TG +  +GL +V  +IE +D  +   +  T   L  +Q      K          
Sbjct: 4   KVAIVTGTNSNLGLNIVFRLIETEDTNVRLTIVVTSRTLPRVQEVINQIKDFYNKSGRVE 63

Query: 53  -----FVYRVLDITDRSRMEALVEEIRQKHGKLDGIVANAG 88
                F Y ++D T+   +     +I +K+  ++ +  NA 
Sbjct: 64  DLEIDFDYLLVDFTNMVSVLNAYYDINKKYRAINYLFVNAA 104

>AGL351W [3961] [Homologous to ScYMR307W (GAS1) - SH]
           complement(49757..51424) [1668 bp, 555 aa]
          Length = 555

 Score = 28.9 bits (63), Expect = 5.3,   Method: Compositional matrix adjust.
 Identities = 20/57 (35%), Positives = 27/57 (47%), Gaps = 8/57 (14%)

Query: 54  VYRVLDITDRSRMEALVEEIRQKHGKLDGIVANAGMLEPVKSISQSNSEHDIKQWER 110
           VY V    D SR   L E         +GI   A + EP  SI+++N E  +K +ER
Sbjct: 114 VYAVNSSLDHSRCMELFES--------NGIYIVADLSEPALSINRNNPEWSLKLFER 162

>Scas_650.8
          Length = 326

 Score = 28.1 bits (61), Expect = 7.8,   Method: Compositional matrix adjust.
 Identities = 30/110 (27%), Positives = 48/110 (43%), Gaps = 24/110 (21%)

Query: 3   KVILITGASRGIGLQLVKTVIEEDDECIVYGVART---------------EAGLQSLQRE 47
           KV +ITG + GIG   V  +        VY   RT               EA L  L++E
Sbjct: 17  KVAVITGGNSGIGWYTVLHLYMHG--FTVYLCGRTSHKIKKAINEITIEAEARLGLLEKE 74

Query: 48  ---YGADKFV----YRVLDITDRSRMEALVEEIRQKHGKLDGIVANAGML 90
              +G D  +    Y  +D+TD   +E   +++ +   K+D ++ NA +L
Sbjct: 75  VDDFGKDIHLGSLRYIHMDLTDLKCVEKAAQKLLKLEDKIDVLINNAAIL 124

>ADR059C [1800] [Homologous to ScYBR159W - SH] (811943..812998)
           [1056 bp, 351 aa]
          Length = 351

 Score = 27.7 bits (60), Expect = 9.5,   Method: Compositional matrix adjust.
 Identities = 22/60 (36%), Positives = 32/60 (53%), Gaps = 3/60 (5%)

Query: 2   GKVILITGASRGIGLQLVKTVIEEDDECIVYGVARTEAGLQSLQREYGAD-KFVYRVLDI 60
           G   L+TGAS GIG +    +  +    ++  V+RTEA L  L++E  A  K   RVL +
Sbjct: 68  GAYALVTGASDGIGKEFALQLASKGFNVLL--VSRTEAKLLELKQEIMAKYKVDARVLSV 125

  Database: blastdb
    Posted date:  Apr 3, 2006  3:33 PM
  Number of letters in database: 16,596,109
  Number of sequences in database:  34,618
  
Lambda     K      H
   0.318    0.135    0.387 

Gapped
Lambda     K      H
   0.267   0.0410    0.140 

Matrix: BLOSUM62
Gap Penalties: Existence: 11, Extension: 1
Number of Sequences: 34618
Number of Hits to DB: 7,816,902
Number of extensions: 298307
Number of successful extensions: 1106
Number of sequences better than 10.0: 105
Number of HSP's gapped: 994
Number of HSP's successfully gapped: 116
Length of query: 259
Length of database: 16,596,109
Length adjustment: 99
Effective length of query: 160
Effective length of database: 13,168,927
Effective search space: 2107028320
Effective search space used: 2107028320
Neighboring words threshold: 11
Window for multiple hits: 40
X1: 16 ( 7.3 bits)
X2: 38 (14.6 bits)
X3: 64 (24.7 bits)
S1: 41 (21.7 bits)
S2: 60 (27.7 bits)