Hit NameLength (aa)HSP LengthHSP ScoreHSP Significance
YIR035C25425013030.0
CAGL0F06897g25824710281e-143
Scas_685.82522499441e-130
ACR171C2512507581e-102
Scas_628.62522487451e-100
CAGL0F06919g2502497152e-95
YIR036C2632586791e-89
ABR249W2502484894e-61
ABR247W2502494731e-58
ABR248W2612494732e-58
ABR246W2502504382e-53
Sklu_2380.41601404276e-53
KLLA0E08063g1861393862e-46
KLLA0E08052g1171033253e-38
KLLA0E09834g2681871821e-15
AER373C3002321671e-13
Scas_594.122671941573e-12
AFR561W2672001493e-11
Kwal_14.24442882211494e-11
YMR226C2671941484e-11
Kwal_47.171022851871432e-10
KLLA0D15521g2561961423e-10
KLLA0B08371g2681941414e-10
Kwal_26.91602671951396e-10
CAGL0M11242g2681951389e-10
KLLA0E13860g8891831401e-09
Sklu_2348.52892371326e-09
Sklu_1578.32681961301e-08
KLLA0F04455g3051891273e-08
KLLA0E24046g2802051255e-08
CAGL0H10450g3112341248e-08
YKL071W2561931211e-07
AGL060W8912171213e-07
Kwal_34.160242922031193e-07
Sklu_2420.53261671194e-07
Kwal_55.195692882061184e-07
YNL202W (SPS19)2951881169e-07
Scas_666.17*2831901151e-06
CAGL0G08690g2942321151e-06
Kwal_26.88383232191151e-06
KLLA0D18909g2902501113e-06
YIL124W (AYR1)2971881114e-06
KLLA0D02596g3472481081e-05
Sklu_2219.33632201081e-05
Scas_478.29201431062e-05
ABL163W2921881043e-05
CAGL0H08063g2901271043e-05
Scas_613.182862121016e-05
KLLA0C12694g2592191016e-05
Sklu_2267.53501871018e-05
Scas_662.43071981008e-05
CAGL0L02167g9011841019e-05
Sklu_268.1244196981e-04
Kwal_23.4572300130981e-04
AAL089W328221982e-04
Kwal_14.1511277211962e-04
CAGL0J04774g338188972e-04
Kwal_26.7950897145964e-04
YDL114W308194945e-04
YKL055C (OAR1)278236928e-04
Kwal_23.3107248191900.001
ADL292C329221890.002
Scas_650.8326223890.002
YBR265W (TSC10)320212870.004
YOR246C330145860.006
AER111W327195850.007
YLR426W326189850.008
Kwal_55.21822283199840.010
Scas_655.19297131830.011
Sklu_1570.1756146840.012
Scas_721.47344182820.017
Kwal_26.8282298234820.018
Scas_652.19d341222780.050
CAGL0K09152g327218720.30
Scas_652.19d134445710.44
YGR194C (XKS1)600143700.62
CAGL0J05852g34338671.2
Sklu_1624.3316199652.1
AEL164C30745652.2
Scas_454.2125147652.5
YML131W36591643.1
Kwal_27.1215528091624.6
Kwal_27.1176719060624.6
YBR159W34765625.8
ADR059C35146616.6
Kwal_23.348568835619.1
AGR014W219113609.1
Scas_717.603259104619.5
BLASTP 2.2.26 [Sep-21-2011]

Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, 
Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), 
"Gapped BLAST and PSI-BLAST: a new generation of protein database search
programs",  Nucleic Acids Res. 25:3389-3402.

Reference for compositional score matrix adjustment: Altschul, Stephen F., 
John C. Wootton, E. Michael Gertz, Richa Agarwala, Aleksandr Morgulis,
Alejandro A. Schaffer, and Yi-Kuo Yu (2005) "Protein database searches
using compositionally adjusted substitution matrices", FEBS J. 272:5101-5109.

Query= YIR035C
         (250 letters)

Database: blastdb 
           34,618 sequences; 16,596,109 total letters

Searching..................................................done

                                                                 Score    E
Sequences producing significant alignments:                      (bits) Value

YIR035C (YIR035C) [2699] chr9 complement(421023..421787) Member ...   506   0.0  
CAGL0F06897g complement(675416..676192) highly similar to sp|P40...   400   e-143
Scas_685.8                                                            368   e-130
ACR171C [1218] [Homologous to ScYIR035C - SH; ScYIR036C - SH] (6...   296   e-102
Scas_628.6                                                            291   e-100
CAGL0F06919g complement(677473..678225) similar to sp|P40579 Sac...   280   2e-95
YIR036C (YIR036C) [2700] chr9 complement(422071..422862) Reducta...   266   1e-89
ABR249W [843] [Homologous to ScYIR035C - NSH; ScYIR036C - NSH] c...   192   4e-61
ABR247W [841] [Homologous to ScYIR035C - NSH; ScYIR036C - NSH] c...   186   1e-58
ABR248W [842] [Homologous to ScYIR035C - NSH; ScYIR036C - NSH] c...   186   2e-58
ABR246W [840] [Homologous to ScYIR035C - NSH; ScYIR036C - NSH] c...   173   2e-53
Sklu_2380.4 YIR035C, Contig c2380 9858-10340                          169   6e-53
KLLA0E08063g complement(726232..726792) some similarities with s...   153   2e-46
KLLA0E08052g complement(725895..726248) similar to sp|P40580 Sac...   129   3e-38
KLLA0E09834g complement(872888..873694) similar to sp|Q9ALU7 Ent...    75   1e-15
AER373C [2874] [Homologous to ScYIL124W (AYR1) - SH] (1327314..1...    69   1e-13
Scas_594.12                                                            65   3e-12
AFR561W [3753] [Homologous to ScYMR226C - SH] complement(1438981...    62   3e-11
Kwal_14.2444                                                           62   4e-11
YMR226C (YMR226C) [4182] chr13 complement(721592..722395) NADP+-...    62   4e-11
Kwal_47.17102                                                          60   2e-10
KLLA0D15521g 1311601..1312371 similar to sp|Q8TTF8 Methanosarcin...    59   3e-10
KLLA0B08371g complement(747517..748323) highly similar to sp|Q05...    59   4e-10
Kwal_26.9160                                                           58   6e-10
CAGL0M11242g complement(1105723..1106529) highly similar to sp|Q...    58   9e-10
KLLA0E13860g 1219430..1222099 similar to sp|Q02207 Saccharomyces...    59   1e-09
Sklu_2348.5 YIL124W, Contig c2348 10212-11081 reverse complement       55   6e-09
Sklu_1578.3 YMR226C, Contig c1578 1774-2580                            55   1e-08
KLLA0F04455g complement(428010..428927) similar to sp|P40471 Sac...    54   3e-08
KLLA0E24046g complement(2136583..2137425) similar to ca|CA3771|C...    53   5e-08
CAGL0H10450g complement(1018805..1019740) similar to tr|Q07530 S...    52   8e-08
YKL071W (YKL071W) [3189] chr11 (304759..305529) Protein with sim...    51   1e-07
AGL060W [4251] [Homologous to ScYKR009C (FOX2) - SH] complement(...    51   3e-07
Kwal_34.16024                                                          50   3e-07
Sklu_2420.5 YOR246C, Contig c2420 9342-10322 reverse complement        50   4e-07
Kwal_55.19569                                                          50   4e-07
YNL202W (SPS19) [4400] chr14 (259568..260455) Peroxisomal 2,4-di...    49   9e-07
Scas_666.17*                                                           49   1e-06
CAGL0G08690g complement(822798..823682) similar to sp|P40471 Sac...    49   1e-06
Kwal_26.8838                                                           49   1e-06
KLLA0D18909g complement(1592628..1593500) similar to sp|P32573 S...    47   3e-06
YIL124W (AYR1) [2552] chr9 (126204..127097) 1-Acyl dihydroxyacet...    47   4e-06
KLLA0D02596g join(complement(219682..219797),complement(218659.....    46   1e-05
Sklu_2219.3 YDL114W, Contig c2219 6060-7151 reverse complement         46   1e-05
Scas_478.2                                                             45   2e-05
ABL163W [429] [Homologous to ScYNL202W (SPS19) - SH] complement(...    45   3e-05
CAGL0H08063g 785331..786203 highly similar to sp|P32573 Saccharo...    45   3e-05
Scas_613.18                                                            44   6e-05
KLLA0C12694g 1077786..1078565 similar to sp|P35731 Saccharomyces...    44   6e-05
Sklu_2267.5 YNL202W, Contig c2267 5903-6955                            44   8e-05
Scas_662.4                                                             43   8e-05
CAGL0L02167g 253055..255760 highly similar to sp|Q02207 Saccharo...    44   9e-05
Sklu_268.1 , Contig c268 57-791 reverse complement                     42   1e-04
Kwal_23.4572                                                           42   1e-04
AAL089W [98] [Homologous to ScYOR246C - SH] complement(184564..1...    42   2e-04
Kwal_14.1511                                                           42   2e-04
CAGL0J04774g join(452094..452179,452259..453189) similar to tr|Q...    42   2e-04
Kwal_26.7950                                                           42   4e-04
YDL114W (YDL114W) [755] chr4 (255604..256530) Member of the shor...    41   5e-04
YKL055C (OAR1) [3204] chr11 complement(334966..335802) 3-Oxoacyl...    40   8e-04
Kwal_23.3107                                                           39   0.001
ADL292C [1449] [Homologous to ScYDL114W - SH] (189102..190091) [...    39   0.002
Scas_650.8                                                             39   0.002
YBR265W (TSC10) [445] chr2 (738539..739501) 3-Ketosphinganine re...    38   0.004
YOR246C (YOR246C) [5035] chr15 complement(795801..796793) Member...    38   0.006
AER111W [2616] [Homologous to ScYLR426W - SH] complement(846805....    37   0.007
YLR426W (YLR426W) [3802] chr12 (987058..987137,987209..988109) M...    37   0.008
Kwal_55.21822                                                          37   0.010
Scas_655.19                                                            37   0.011
Sklu_1570.1 YKR009C, Contig c1570 100-2370                             37   0.012
Scas_721.47                                                            36   0.017
Kwal_26.8282                                                           36   0.018
Scas_652.19d                                                           35   0.050
CAGL0K09152g 909456..910439 highly similar to tr|Q08651 Saccharo...    32   0.30 
Scas_652.19d1                                                          32   0.44 
YGR194C (XKS1) [2144] chr7 complement(886076..887878) Xylulokina...    32   0.62 
CAGL0J05852g complement(554403..555434) weakly similar to sp|P40...    30   1.2  
Sklu_1624.3 YBR265W, Contig c1624 1338-2288                            30   2.1  
AEL164C [2342] [Homologous to ScYBR265W (TSC10) - SH] (326834..3...    30   2.2  
Scas_454.2                                                             30   2.5  
YML131W (YML131W) [3841] chr13 (10199..11296) Putative NAD-depen...    29   3.1  
Kwal_27.12155                                                          28   4.6  
Kwal_27.11767                                                          28   4.6  
YBR159W (YBR159W) [344] chr2 (558641..559684) Major 3-ketoreduct...    28   5.8  
ADR059C [1800] [Homologous to ScYBR159W - SH] (811943..812998) [...    28   6.6  
Kwal_23.3485                                                           28   9.1  
AGR014W [4324] [Homologous to ScYMR077C (VPS20) - NSH] complemen...    28   9.1  
Scas_717.60                                                            28   9.5  

>YIR035C (YIR035C) [2699] chr9 complement(421023..421787) Member of
           the short-chain alcohol dehydrogenase family [765 bp,
           254 aa]
          Length = 254

 Score =  506 bits (1303), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 250/250 (100%), Positives = 250/250 (100%)

Query: 1   MGKVILVTGVSRGIGKSIVDVLFSLDKDTVVYGVARSEAPLKKLKEKYGDRFFYVVGDIT 60
           MGKVILVTGVSRGIGKSIVDVLFSLDKDTVVYGVARSEAPLKKLKEKYGDRFFYVVGDIT
Sbjct: 1   MGKVILVTGVSRGIGKSIVDVLFSLDKDTVVYGVARSEAPLKKLKEKYGDRFFYVVGDIT 60

Query: 61  EDSVLKQLVNAAVKGHGKIDSLVANAGVLEPVQNVNEIDVNAWKKLYDINFFSIVSLVGI 120
           EDSVLKQLVNAAVKGHGKIDSLVANAGVLEPVQNVNEIDVNAWKKLYDINFFSIVSLVGI
Sbjct: 61  EDSVLKQLVNAAVKGHGKIDSLVANAGVLEPVQNVNEIDVNAWKKLYDINFFSIVSLVGI 120

Query: 121 ALPELKKTNGNVVFVSSDACNMYFSSWGAYGSSKAALNHFAMTLANEERQVKAIAVAPGI 180
           ALPELKKTNGNVVFVSSDACNMYFSSWGAYGSSKAALNHFAMTLANEERQVKAIAVAPGI
Sbjct: 121 ALPELKKTNGNVVFVSSDACNMYFSSWGAYGSSKAALNHFAMTLANEERQVKAIAVAPGI 180

Query: 181 VDTDMQVNIRENVGPSSMSAEQLKMFRGLKENNQLLDSSVPATVYAKLALHGIPDGVNGQ 240
           VDTDMQVNIRENVGPSSMSAEQLKMFRGLKENNQLLDSSVPATVYAKLALHGIPDGVNGQ
Sbjct: 181 VDTDMQVNIRENVGPSSMSAEQLKMFRGLKENNQLLDSSVPATVYAKLALHGIPDGVNGQ 240

Query: 241 YLSYNDPALA 250
           YLSYNDPALA
Sbjct: 241 YLSYNDPALA 250

>CAGL0F06897g complement(675416..676192) highly similar to sp|P40579
           Saccharomyces cerevisiae YIR035c, hypothetical start
          Length = 258

 Score =  400 bits (1028), Expect = e-143,   Method: Compositional matrix adjust.
 Identities = 189/247 (76%), Positives = 221/247 (89%)

Query: 3   KVILVTGVSRGIGKSIVDVLFSLDKDTVVYGVARSEAPLKKLKEKYGDRFFYVVGDITED 62
           KVILVTGVSRGIGKSIVD LFSLDK+ +VYG+ARSEAPLK LK+ YGDRFFY VGDIT D
Sbjct: 7   KVILVTGVSRGIGKSIVDTLFSLDKNVIVYGIARSEAPLKALKDTYGDRFFYTVGDITND 66

Query: 63  SVLKQLVNAAVKGHGKIDSLVANAGVLEPVQNVNEIDVNAWKKLYDINFFSIVSLVGIAL 122
             LK+ VN+A++GHGKI+SL+ANAGVLEPVQN+N IDVNAWK+LY+INFFSIVSLV IAL
Sbjct: 67  DTLKKYVNSAIEGHGKINSLIANAGVLEPVQNINNIDVNAWKQLYNINFFSIVSLVDIAL 126

Query: 123 PELKKTNGNVVFVSSDACNMYFSSWGAYGSSKAALNHFAMTLANEERQVKAIAVAPGIVD 182
           P LKKT+G+ +FVSSDA + YFSSWGAYGSSKAALNHFAMTLANEE+ V+A+AVAPGIVD
Sbjct: 127 PHLKKTHGSALFVSSDASDTYFSSWGAYGSSKAALNHFAMTLANEEKAVRALAVAPGIVD 186

Query: 183 TDMQVNIRENVGPSSMSAEQLKMFRGLKENNQLLDSSVPATVYAKLALHGIPDGVNGQYL 242
           TDMQVNIREN+GP  MS E L+MFR LK++N+LL SS+PATVY+KLAL+GIP+ +NGQYL
Sbjct: 187 TDMQVNIRENLGPQGMSQEHLEMFRDLKKDNKLLHSSIPATVYSKLALNGIPEEINGQYL 246

Query: 243 SYNDPAL 249
           S++   L
Sbjct: 247 SFDAEVL 253

>Scas_685.8
          Length = 252

 Score =  368 bits (944), Expect = e-130,   Method: Compositional matrix adjust.
 Identities = 178/249 (71%), Positives = 211/249 (84%), Gaps = 1/249 (0%)

Query: 1   MGKVILVTGVSRGIGKSIVDVLFSLDKDTVVYGVARSEAPLKKLKEKYGDRFFYVVGDIT 60
           MGKVI+VTGVSRGIGKSIV+ +F L  D +VYG+ARSEAPLK LKE YGDRFFYV GDIT
Sbjct: 1   MGKVIIVTGVSRGIGKSIVERIFKLSSDAIVYGIARSEAPLKALKETYGDRFFYVTGDIT 60

Query: 61  EDSVLKQLVNAAVKGHGKIDSLVANAGVLEPVQNVNEIDVNAWKKLYDINFFSIVSLVGI 120
           +   L++LV+ A K  GKIDS+VANAGVLEPVQ+VN ID++AWKKL+DINFFS+VSL  I
Sbjct: 61  DQVALQKLVDGAAKEQGKIDSVVANAGVLEPVQDVNHIDIDAWKKLFDINFFSVVSLTSI 120

Query: 121 ALPELKKTNGNVVFVSSDACNMYFSSWGAYGSSKAALNHFAMTLANEERQVKAIAVAPGI 180
            LP LKKTNGN+VFVSSDA +M+FSSWGAY +SKA LN FAMT+ANEE  VK ++VAPGI
Sbjct: 121 TLPYLKKTNGNIVFVSSDASDMHFSSWGAYSASKACLNRFAMTVANEEPAVKCLSVAPGI 180

Query: 181 VDTDMQVNIRENVGPSSMSAEQLKMFRGLKENNQLLDSSVPATVYAKLALHGIPDGVNGQ 240
           VDT MQVNIRENVG   M++E   MF+ LKE+N+LLDS+VPATVY+KLAL+GIP  VNG+
Sbjct: 181 VDTSMQVNIRENVG-KDMTSEDHAMFKDLKESNKLLDSNVPATVYSKLALNGIPVDVNGK 239

Query: 241 YLSYNDPAL 249
           YLS++DP L
Sbjct: 240 YLSFDDPIL 248

>ACR171C [1218] [Homologous to ScYIR035C - SH; ScYIR036C - SH]
           (654580..654909,654959..655384) [756 bp, 251 aa]
          Length = 251

 Score =  296 bits (758), Expect = e-102,   Method: Compositional matrix adjust.
 Identities = 149/250 (59%), Positives = 190/250 (76%), Gaps = 3/250 (1%)

Query: 1   MGKVILVTGVSRGIGKSIVDVLFSLDKDTVVYGVARSEAPLKKLKEKYGDRFFYVVGDIT 60
           M ++I+VTGVSRGIG+S+V+ +     DTVV GVARSEA L++L+  YG++F YVVGD+ 
Sbjct: 1   MPRLIIVTGVSRGIGRSVVEKVCR-QPDTVVLGVARSEAALQELRATYGEQFEYVVGDVA 59

Query: 61  EDSVLKQLVNAAVKGHGKIDSLVANAGVLEPVQNVNEIDVNAWKKLYDINFFSIVSLVGI 120
            +     LV A    +G+ID++VANAGVLEPVQ+VN IDV AW++LY++NFFS+V LVG 
Sbjct: 60  SEDAQDALV-ARATAYGRIDAVVANAGVLEPVQDVNHIDVAAWRRLYEVNFFSVVGLVGR 118

Query: 121 ALPELKKTNGNVVFVSSDACNMYFSSWGAYGSSKAALNHFAMTLANEERQVKAIAVAPGI 180
           ALP LKK  G+VVFVSS A    +S+WGAYGSSKAALNHFAMTLA EE  V+A+AVAPG+
Sbjct: 119 ALPLLKKAGGSVVFVSSGASTKAYSAWGAYGSSKAALNHFAMTLAAEEPAVRAVAVAPGV 178

Query: 181 VDTDMQVNIRENVGPSSMSAEQLKMFRGLKENNQLLDSSVPATVYAKLALHGIPDGVNGQ 240
           VDT MQ +IR+  G   M+ E L+ F  LK+N++LLD  +PAT++A LAL GIPD  NG+
Sbjct: 179 VDTQMQNDIRDKFG-HRMAPEALRRFTELKKNSELLDPQIPATIFANLALRGIPDCANGK 237

Query: 241 YLSYNDPALA 250
           YL YND  LA
Sbjct: 238 YLRYNDDILA 247

>Scas_628.6
          Length = 252

 Score =  291 bits (745), Expect = e-100,   Method: Compositional matrix adjust.
 Identities = 144/248 (58%), Positives = 190/248 (76%), Gaps = 1/248 (0%)

Query: 3   KVILVTGVSRGIGKSIVDVLFSLDKDTVVYGVARSEAPLKKLKEKYGDRFFYVVGDITED 62
           KVI+VTGVSRGIG++IV+ +  L+ + VV+G+AR+ APLK+LK K+G++FFY+VGD+T  
Sbjct: 4   KVIIVTGVSRGIGRAIVNKIIGLNSNAVVFGIARTSAPLKELKSKHGEKFFYIVGDVTNK 63

Query: 63  SVLKQLVNAAVKGHGKIDSLVANAGVLEPVQNVNEIDVNAWKKLYDINFFSIVSLVGIAL 122
           S +K+L+ AA+   G++DS+VANAGVLEPV  V ++D  AWK+L+DINFFSIVSLV   L
Sbjct: 64  SDVKKLITAAIDKFGRLDSVVANAGVLEPVAEVGKVDEEAWKRLFDINFFSIVSLVQSTL 123

Query: 123 PELKKTNGNVVFVSSDACNMYFSSWGAYGSSKAALNHFAMTLANEERQVKAIAVAPGIVD 182
           P ++ TN N VFVSS A    +  W AY +SKAALN FAM++ANE+ +VK I+VAPG+VD
Sbjct: 124 PFMENTNRNYVFVSSGASVKAYFGWAAYSASKAALNSFAMSVANEKPKVKTISVAPGVVD 183

Query: 183 TDMQVNIRENVGPSSMSAEQLKMFRGLKENNQLLDSSVPATVYAKLALHGIPDGVNGQYL 242
           T MQV+IRE  G + M+ E LK F  L +N +LLDS VP  VYAKLA++GIPD +NG+Y 
Sbjct: 184 TQMQVDIREKYG-NEMTTESLKRFIDLHKNGELLDSDVPGEVYAKLAVNGIPDELNGKYS 242

Query: 243 SYNDPALA 250
            YND  LA
Sbjct: 243 RYNDDRLA 250

>CAGL0F06919g complement(677473..678225) similar to sp|P40579
           Saccharomyces cerevisiae YIR035c or sp|P40580
           Saccharomyces cerevisiae YIR036c, start by similarity
          Length = 250

 Score =  280 bits (715), Expect = 2e-95,   Method: Compositional matrix adjust.
 Identities = 136/249 (54%), Positives = 177/249 (71%)

Query: 1   MGKVILVTGVSRGIGKSIVDVLFSLDKDTVVYGVARSEAPLKKLKEKYGDRFFYVVGDIT 60
           M KV+LVTG SRGIG++IV  + +LD + VVYG+AR+E  LK LK+  G RF Y+ GDIT
Sbjct: 1   MKKVVLVTGASRGIGEAIVKNILALDSNAVVYGIARNEDALKSLKDTVGARFQYLAGDIT 60

Query: 61  EDSVLKQLVNAAVKGHGKIDSLVANAGVLEPVQNVNEIDVNAWKKLYDINFFSIVSLVGI 120
           ++  + ++V   V   G+IDS+VANAGVLEPV  V    V  WKKLYDINFFSI+ L+  
Sbjct: 61  DEDKINEIVEKVVLEQGRIDSIVANAGVLEPVAKVGSSSVAEWKKLYDINFFSIIHLINK 120

Query: 121 ALPELKKTNGNVVFVSSDACNMYFSSWGAYGSSKAALNHFAMTLANEERQVKAIAVAPGI 180
            LP L+K+ GN +FVSS A    +  W AYGSSKAA+NH  M+LA E + +K IAVAPG+
Sbjct: 121 TLPHLEKSEGNAIFVSSGASTKPYYGWCAYGSSKAAVNHLTMSLAAENKAIKTIAVAPGV 180

Query: 181 VDTDMQVNIRENVGPSSMSAEQLKMFRGLKENNQLLDSSVPATVYAKLALHGIPDGVNGQ 240
           VDT MQ +IR+  GPS M+A+ LK F  LK+N +LLD+ VP  +YA+LA+ GIP  +NG+
Sbjct: 181 VDTKMQDDIRDKFGPSGMTADALKRFTDLKKNGELLDADVPGKIYARLAVSGIPAELNGE 240

Query: 241 YLSYNDPAL 249
           Y+ YND  L
Sbjct: 241 YVRYNDSRL 249

>YIR036C (YIR036C) [2700] chr9 complement(422071..422862) Reductase
           in the short-chain dehydrogenase/reductase (SDR) family
           of proteins [792 bp, 263 aa]
          Length = 263

 Score =  266 bits (679), Expect = 1e-89,   Method: Compositional matrix adjust.
 Identities = 135/258 (52%), Positives = 182/258 (70%), Gaps = 9/258 (3%)

Query: 1   MGKVILVTGVSRGIGKSIVDVLFSLDKDTVVYGVARSEAPLKKLKEKYG-DRFFYVVGDI 59
           MGKVIL+TG SRGIG  +V  +   D + +VYGVAR+EA L+ L+ +YG D+F Y V DI
Sbjct: 1   MGKVILITGASRGIGLQLVKTVIEEDDECIVYGVARTEAGLQSLQREYGADKFVYRVLDI 60

Query: 60  TEDSVLKQLVNAAVKGHGKIDSLVANAGVLEPVQNVN----EIDVNAWKKLYDINFFSIV 115
           T+ S ++ LV    + HGK+D +VANAG+LEPV++++    E D+  W++L+D+NFFSIV
Sbjct: 61  TDRSRMEALVEEIRQKHGKLDGIVANAGMLEPVKSISQSNSEHDIKQWERLFDVNFFSIV 120

Query: 116 SLVGIALPELKKTN--GNVVFVSSDACNMYFSSWGAYGSSKAALNHFAMTLANEER--QV 171
           SLV + LP LK +   GN+VFVSS A    ++ W AYG SKAALNHFAM +A+EE   +V
Sbjct: 121 SLVALCLPLLKSSPFVGNIVFVSSGASVKPYNGWSAYGCSKAALNHFAMDIASEEPSDKV 180

Query: 172 KAIAVAPGIVDTDMQVNIRENVGPSSMSAEQLKMFRGLKENNQLLDSSVPATVYAKLALH 231
           +A+ +APG+VDT MQ +IRE +GP  M+ + L+ F  L + + LLD  VPA V A+L L 
Sbjct: 181 RAVCIAPGVVDTQMQKDIRETLGPQGMTPKALERFTQLYKTSSLLDPKVPAAVLAQLVLK 240

Query: 232 GIPDGVNGQYLSYNDPAL 249
           GIPD +NGQYL YND  L
Sbjct: 241 GIPDSLNGQYLRYNDERL 258

>ABR249W [843] [Homologous to ScYIR035C - NSH; ScYIR036C - NSH]
           complement(861237..861989) [753 bp, 250 aa]
          Length = 250

 Score =  192 bits (489), Expect = 4e-61,   Method: Compositional matrix adjust.
 Identities = 103/248 (41%), Positives = 157/248 (63%), Gaps = 4/248 (1%)

Query: 3   KVILVTGVSRGIGKSIVDVLFSLDKDTVVYGVARSEAPLKKLKEKYGDRFFYVVGDITED 62
           KVI+VTG SRGIG + VD L S   D VV GVAR+E  L++LK ++G +F YVVGD+T++
Sbjct: 2   KVIIVTGASRGIGAATVDRLCS-TPDVVVVGVARAETKLQELKARHGKKFDYVVGDVTDE 60

Query: 63  SVLKQLVNAAVKGHGKIDSLVANAGVLEPVQNVNEIDVNAWKKLYDINFFSIVSLVGIAL 122
            V++ +++     +G++D++VANAGV    Q + E D+  W++L++IN FS+V+L   AL
Sbjct: 61  RVVQAVIDKVSSEYGRLDAVVANAGV-SYQQRIAEADIKEWRRLFEINLFSVVNLASKAL 119

Query: 123 PELKKTNGNVVFVSSDACNMYFSSWGAYGSSKAALNHFAMTLANEERQVKAIAVAPGIVD 182
           P L+K+ G  + V+S    M   +  AY SSK ALNHFA+ LA EE +++++A+ PG+V 
Sbjct: 120 PLLRKSQGAFIAVTSGLSQMGHPALAAYASSKIALNHFALILAMEETEIRSLALDPGLVQ 179

Query: 183 TDMQVNIRENVGPSSMSAEQLKMFRGLKENNQLLDSSVPATVYAKLALHGIPDGVNGQYL 242
           TDM       V     +  Q    R L +  +++    P TV A LA  GIP+ +NG+Y+
Sbjct: 180 TDM--TAAALVAADKAAGTQDNSVRELTKQIRMVSPEEPGTVLAALAAKGIPEELNGKYV 237

Query: 243 SYNDPALA 250
           +++   LA
Sbjct: 238 TFDSEKLA 245

>ABR247W [841] [Homologous to ScYIR035C - NSH; ScYIR036C - NSH]
           complement(858589..859341) [753 bp, 250 aa]
          Length = 250

 Score =  186 bits (473), Expect = 1e-58,   Method: Compositional matrix adjust.
 Identities = 101/249 (40%), Positives = 156/249 (62%), Gaps = 6/249 (2%)

Query: 3   KVILVTGVSRGIGKSIVDVLFSLDKDTVVYGVARSEAPLKKLKEKYGDRFFYVVGDITED 62
           +V++VTG SRGIG++ V+ L     D VV GVAR+E  L+KLK ++G +F YVVGD+T++
Sbjct: 2   RVVIVTGASRGIGEATVEKLCP-TADVVVVGVARAETKLQKLKARHGKKFDYVVGDVTDE 60

Query: 63  SVLKQLVNAAVKGHGKIDSLVANAGVLEPVQNVNEIDVNAWKKLYDINFFSIVSLVGIAL 122
            V++ +++     +G++D++VANAGV    + +   D+  W++L++IN FS+V+LV  AL
Sbjct: 61  RVVQAVIDKVSSEYGRLDAVVANAGVSRH-ERIATADIKEWRRLFEINLFSVVNLVSKAL 119

Query: 123 PELKKTNGNVVFVSSDACNMYFSSWGAYGSSKAALNHFAMTLANEERQVKAIAVAPGIVD 182
           P L+++ G V+ VSS    M   +  AY SSK ALNHFA+ LA EE +++ IA+ PG V 
Sbjct: 120 PLLRESQGTVIVVSSGLSQMGHPALAAYASSKIALNHFALILAMEEPEIRTIALDPGAVQ 179

Query: 183 TDMQVNIRENVGPSSMSA-EQLKMFRGLKENNQLLDSSVPATVYAKLALHGIPDGVNGQY 241
           TDM   + E +  +  +A  Q    R L +  ++     P  V A LA  GIP+ +NG+Y
Sbjct: 180 TDM---LAEGINAADEAAGSQDNAVRELLKQVRVATPEEPGAVLAALAARGIPEELNGKY 236

Query: 242 LSYNDPALA 250
           +  +   LA
Sbjct: 237 VRADSEKLA 245

>ABR248W [842] [Homologous to ScYIR035C - NSH; ScYIR036C - NSH]
           complement(859663..860448) [786 bp, 261 aa]
          Length = 261

 Score =  186 bits (473), Expect = 2e-58,   Method: Compositional matrix adjust.
 Identities = 101/249 (40%), Positives = 157/249 (63%), Gaps = 6/249 (2%)

Query: 3   KVILVTGVSRGIGKSIVDVLFSLDKDTVVYGVARSEAPLKKLKEKYGDRFFYVVGDITED 62
           KVI+VTG SRGIG + VD L S   + VV GVAR+E  L++LK ++G +F YVVGD+T++
Sbjct: 13  KVIIVTGASRGIGAATVDRLCS-TPEVVVVGVARAETKLQELKARHGKKFDYVVGDVTDE 71

Query: 63  SVLKQLVNAAVKGHGKIDSLVANAGVLEPVQNVNEIDVNAWKKLYDINFFSIVSLVGIAL 122
            V++ +++    G+G++D++VANAGV    + + + D+  W++L++IN FS+V+L   AL
Sbjct: 72  RVVQAVIDKVSSGYGRLDAVVANAGVAGH-ERIEDADIKEWRRLFEINLFSVVNLASKAL 130

Query: 123 PELKKTNGNVVFVSSDACNMYFSSWGAYGSSKAALNHFAMTLANEERQVKAIAVAPGIVD 182
           P L+K+ G  + VSS    M   +   Y SSK ALNHFAM LA EE +++ IA+ PG+  
Sbjct: 131 PLLRKSQGAFLVVSSMLSQMGVPAVATYASSKIALNHFAMILAMEEPEIRTIALDPGVAQ 190

Query: 183 TDMQVNIRENVGPSSMSA-EQLKMFRGLKENNQLLDSSVPATVYAKLALHGIPDGVNGQY 241
           TDM   + + +  +  +A  Q    R +  + ++     P TV A LA  GIP+ +NG++
Sbjct: 191 TDM---LTDGLNAADQAAGTQDNAAREMMRHVRVASPDEPGTVLAALAAKGIPEELNGKF 247

Query: 242 LSYNDPALA 250
           + Y+   LA
Sbjct: 248 VVYDSEELA 256

>ABR246W [840] [Homologous to ScYIR035C - NSH; ScYIR036C - NSH]
           complement(857415..858167) [753 bp, 250 aa]
          Length = 250

 Score =  173 bits (438), Expect = 2e-53,   Method: Compositional matrix adjust.
 Identities = 98/250 (39%), Positives = 154/250 (61%), Gaps = 5/250 (2%)

Query: 1   MGKVILVTGVSRGIGKSIVDVLFSLDKDTVVYGVARSEAPLKKLKEKYGDRFFYVVGDIT 60
           M +VI+VTG SRGIG++ V+ L +   D VV GVAR+E  LK LKE+YG +F YV GD+T
Sbjct: 1   MVRVIIVTGASRGIGEATVEKLCTA-PDVVVVGVARAEKTLKVLKERYGSKFDYVAGDVT 59

Query: 61  EDSVLKQLVNAAVKGHGKIDSLVANAGVLEPVQNVNEIDVNAWKKLYDINFFSIVSLVGI 120
           ++SV++ +++     +G++D+++ANAGV    + + E D+  WK+ ++I   S VSLV  
Sbjct: 60  DESVVQAVLDKVSSDYGRLDAIIANAGV-SRFERIAEADIQQWKRTFEI-IVSAVSLVSK 117

Query: 121 ALPELKKTNGNVVFVSSDACNMYFSSWGAYGSSKAALNHFAMTLANEERQVKAIAVAPGI 180
           ALP L+K+ G V+ V+S    + + +  +  SSK ALNHF   LA EE  ++A+AVAPG+
Sbjct: 118 ALPMLRKSQGTVIVVTSGLSKVGYRASASSASSKIALNHFIRILAAEEPALRAVAVAPGV 177

Query: 181 VDTDMQVNIRENVGPSSMSAEQLKMFRGLKENNQLLDSSVPATVYAKLALHGIPDGVNGQ 240
           V TDM V   +          +   F+ + +  +++    P  V A LA+ GIP  +NG+
Sbjct: 178 VRTDMTVEALD--ASEDAPGARDNFFKAVLKQGRVVLPDAPGAVLAALAVKGIPQELNGR 235

Query: 241 YLSYNDPALA 250
           ++ ++   LA
Sbjct: 236 FVQFDSEKLA 245

>Sklu_2380.4 YIR035C, Contig c2380 9858-10340
          Length = 160

 Score =  169 bits (427), Expect = 6e-53,   Method: Compositional matrix adjust.
 Identities = 84/140 (60%), Positives = 112/140 (80%), Gaps = 1/140 (0%)

Query: 1   MGKVILVTGVSRGIGKSIVDVLFS-LDKDTVVYGVARSEAPLKKLKEKYGDRFFYVVGDI 59
           M KV+LVTG SRGIG++IV+ L +  + + VV G+ARSE PL  +K  +GD+F Y++GDI
Sbjct: 1   MAKVVLVTGASRGIGQAIVNNLCNDGNSEVVVVGIARSEGPLSAIKGVHGDKFEYIIGDI 60

Query: 60  TEDSVLKQLVNAAVKGHGKIDSLVANAGVLEPVQNVNEIDVNAWKKLYDINFFSIVSLVG 119
           +++ VLK+ V  A+K  G+ID++VANAGVLEPVQ+VN IDV  WK+L+D+NFFSIVSLV 
Sbjct: 61  SDEEVLKKYVEYAIKKFGRIDAVVANAGVLEPVQDVNNIDVAQWKRLFDVNFFSIVSLVS 120

Query: 120 IALPELKKTNGNVVFVSSDA 139
           ++LP LKK NGN+VFVSS A
Sbjct: 121 LSLPHLKKFNGNIVFVSSGA 140

>KLLA0E08063g complement(726232..726792) some similarities with
           sp|P40579 Saccharomyces cerevisiae YIR035c, hypothetical
           start
          Length = 186

 Score =  153 bits (386), Expect = 2e-46,   Method: Compositional matrix adjust.
 Identities = 73/139 (52%), Positives = 105/139 (75%)

Query: 1   MGKVILVTGVSRGIGKSIVDVLFSLDKDTVVYGVARSEAPLKKLKEKYGDRFFYVVGDIT 60
           M KV LVTGVSRGIG SIV+ L S++   +V G+ARS+  L++LK +Y  +F Y+ GD++
Sbjct: 1   MSKVFLVTGVSRGIGSSIVEKLCSIETTKIVIGIARSKDKLEELKTQYSGKFDYICGDVS 60

Query: 61  EDSVLKQLVNAAVKGHGKIDSLVANAGVLEPVQNVNEIDVNAWKKLYDINFFSIVSLVGI 120
           ++  + + VN     + ++D +VANAGVL+PV++VN I ++ WK+L+DINFFS+VSLVG 
Sbjct: 61  DEETITEAVNFIESKYKRLDGIVANAGVLDPVEDVNNIHISKWKQLFDINFFSVVSLVGH 120

Query: 121 ALPELKKTNGNVVFVSSDA 139
           ALP LK++NGN+V VSS A
Sbjct: 121 ALPLLKQSNGNIVLVSSGA 139

>KLLA0E08052g complement(725895..726248) similar to sp|P40580
           Saccharomyces cerevisiae YIR036c, hypothetical start
          Length = 117

 Score =  129 bits (325), Expect = 3e-38,   Method: Compositional matrix adjust.
 Identities = 63/103 (61%), Positives = 75/103 (72%)

Query: 147 WGAYGSSKAALNHFAMTLANEERQVKAIAVAPGIVDTDMQVNIRENVGPSSMSAEQLKMF 206
           WGAYG+SKAALNHFA T+A EE  VKAI+VAPG+V T MQ +IRE  GPS M+ E L+ F
Sbjct: 10  WGAYGASKAALNHFAATIAAEEPAVKAISVAPGVVKTKMQEDIRETFGPSGMTKEALQRF 69

Query: 207 RGLKENNQLLDSSVPATVYAKLALHGIPDGVNGQYLSYNDPAL 249
             L +N+QLL  SVP T+YA LA  GIP  ++G YL YND  L
Sbjct: 70  VDLHDNDQLLPPSVPGTIYANLASKGIPSELDGAYLRYNDEKL 112

>KLLA0E09834g complement(872888..873694) similar to sp|Q9ALU7
           Enterobacter cloacae Putative oxidoreductase, start by
           similarity
          Length = 268

 Score = 74.7 bits (182), Expect = 1e-15,   Method: Compositional matrix adjust.
 Identities = 57/187 (30%), Positives = 93/187 (49%), Gaps = 12/187 (6%)

Query: 3   KVILVTGVSRGIGKSIVDVLFSLDKDTVVYGVARSEA-PLKKLKEKYGDRFFYVVGDITE 61
           +VIL+TG S GIG SI + L S   +  V+G +R  + P K+        F  +  DIT+
Sbjct: 4   QVILITGASTGIGLSIAETLRSAGYE--VFGTSRKGSIPGKEYS------FKMIKLDITD 55

Query: 62  DSVLKQLVNAAVKGHGKIDSLVANAGVLEPVQNVNEIDVNAWKKLYDINFFSIVSLVGIA 121
           +  +K  VN  ++  G+ID LV NAG+      V E   +  K +++ NFF +  +    
Sbjct: 56  EESVKSAVNEVIEKAGRIDVLVNNAGIAFKWAAVEECSTDLAKTIFETNFFGVHRMTRAV 115

Query: 122 LPELK-KTNGNVVFVSSDACNMYFSSWGAYGSSKAALNHFAMTLANEERQ--VKAIAVAP 178
           LP ++ + +G ++ +SS    M       Y SSK AL  +  +L  E ++  +    + P
Sbjct: 116 LPHMREQRHGKIINISSMGGIMPIPYGALYCSSKHALEGYTESLDYEVKKFGIHVSTIDP 175

Query: 179 GIVDTDM 185
            I+ T M
Sbjct: 176 HIIKTGM 182

>AER373C [2874] [Homologous to ScYIL124W (AYR1) - SH]
           (1327314..1328216) [903 bp, 300 aa]
          Length = 300

 Score = 68.9 bits (167), Expect = 1e-13,   Method: Compositional matrix adjust.
 Identities = 65/232 (28%), Positives = 116/232 (50%), Gaps = 11/232 (4%)

Query: 2   GKVILVTGVSRGIGKSIVDVLFSLDKDTVVYGVARSEAPLKKLKEKYG-DRFFYVVGDIT 60
            KV+LVTG S GIG  +   L   ++  VVY  ARS  P++ L++K G ++   V  D+T
Sbjct: 14  AKVVLVTGASSGIGYELTKEL--ANRGYVVYAAARSIEPIEALRDKCGPEKVIPVQLDVT 71

Query: 61  ED---SVLKQLVNAAVKGHGKIDSLVANAGVLEPVQNVNEIDVNAWKKLYDINFFSIVSL 117
           ++   + L++ ++  + G GK+ +L  NAG    +  V+ +     +K + +N F+ +++
Sbjct: 72  DEEQVTKLRRRMSKEIPG-GKLHALFNNAGQSCTMPAVD-VTPEMIEKCFRVNVFAPMNI 129

Query: 118 VGIALPELKKTNGNVVFVSSDACNMYFSSWGAYGSSKAALNHFAMTLANEERQ--VKAIA 175
                P L + +G +VF  S A  + F     Y ++KAA++ +A  L  E +   V+ I 
Sbjct: 130 TREFAPLLIRAHGTIVFTGSLAGIIPFPFGSVYSATKAAVHQYARVLHLELKPFGVRVIN 189

Query: 176 VAPGIVDTDMQVNIRENVGPSSMSAEQLKMFRGLKENNQLLDSSVPATVYAK 227
              G V T++  + R     S  +  + K     ++      S +PA VYA+
Sbjct: 190 AVTGGVATNI-ADTRPLPKSSVYNFAEGKAAFAERQRMASRSSPMPAPVYAR 240

>Scas_594.12
          Length = 267

 Score = 65.1 bits (157), Expect = 3e-12,   Method: Compositional matrix adjust.
 Identities = 56/194 (28%), Positives = 94/194 (48%), Gaps = 9/194 (4%)

Query: 3   KVILVTGVSRGIGKSIVDVLFSLDKDTV-VYGVARSEAPLKKLKE----KYGDRFFYVVG 57
           K++ +TG S GIG++           TV +  VAR    L++LKE    KY     Y+  
Sbjct: 14  KIVFITGASAGIGQATALEYMDASNGTVKLVLVARRLEKLQQLKEVIEAKYPKSKVYIGK 73

Query: 58  -DITEDSVLKQLVNAAVKGHGKIDSLVANAGVLEPVQNVNEIDVNAWKKLYDINFFSIVS 116
            D+TE   ++  ++   +    ID L+ NAG       V +ID+   K + D N   +++
Sbjct: 74  LDVTELETIQPFLDNLPEEFKDIDILINNAGKALGSDRVGDIDIKDVKGMMDTNVLGLIN 133

Query: 117 LVGIALPELKKTN-GNVVFVSSDACNMYFSSWGAYGSSKAALNHFAMTLANE--ERQVKA 173
           +    L   +K N G++V + S A    + +   Y +SK A+  F  +L  E    +++ 
Sbjct: 134 VTQAVLHIFQKKNSGDIVNLGSVAGRDAYPTGSIYCASKFAVRAFTESLRRELINTKIRV 193

Query: 174 IAVAPGIVDTDMQV 187
           I +APGIV+T+  V
Sbjct: 194 ILIAPGIVETEFSV 207

>AFR561W [3753] [Homologous to ScYMR226C - SH]
           complement(1438981..1439784) [804 bp, 267 aa]
          Length = 267

 Score = 62.0 bits (149), Expect = 3e-11,   Method: Compositional matrix adjust.
 Identities = 55/200 (27%), Positives = 98/200 (49%), Gaps = 10/200 (5%)

Query: 3   KVILVTGVSRGIGKSI-VDVLFSLDKDTVVYGVARSEAPLKKLKE----KYGDRFFYVVG 57
           K++LVTG S GIG++  ++   + D    +  VAR    L  LK+    KY +   +V  
Sbjct: 14  KIVLVTGASAGIGRATAINYADATDGAIKLILVARRAEKLTSLKQEIESKYPNAKIHVGQ 73

Query: 58  -DITEDSVLKQLVNAAVKGHGKIDSLVANAGVLEPVQNVNEIDVNAWKKLYDINFFSIVS 116
            D+T+   ++  +    +    ID L+ NAG     + V EI ++  +++++ N   +V 
Sbjct: 74  LDVTQLDQIRPFLEGLPEEFRDIDILINNAGKALGTERVGEISMDDIQEVFNTNVIGLVH 133

Query: 117 LVGIALPELK-KTNGNVVFVSSDACNMYFSSWGAYGSSKAALNHFAMTLANE--ERQVKA 173
           L    LP +K K +G++V V S A    +     Y ++K A+  F   +  E    +++ 
Sbjct: 134 LTQEVLPIMKAKNSGDIVNVGSIAGREAYPGGSIYCATKHAVKAFTRAMRKELISTKIRV 193

Query: 174 IAVAPGIVDTDMQ-VNIREN 192
             +APG V+T+   V +R N
Sbjct: 194 FEIAPGSVETEFSMVRMRGN 213

>Kwal_14.2444
          Length = 288

 Score = 62.0 bits (149), Expect = 4e-11,   Method: Compositional matrix adjust.
 Identities = 63/221 (28%), Positives = 101/221 (45%), Gaps = 14/221 (6%)

Query: 3   KVILVTGVSRGIGKSIVDVLFSLDKDTVVYGVARSEAPLKKLKEKYGDRFFYVVGDITED 62
           KV +VTG S GIG  +   L S  K   VY  AR E  L+ L +++ +    V  D++E 
Sbjct: 5   KVAVVTGASSGIGYELTRQLAS--KGYKVYAAARREQRLETLAKEFPELVVPVKLDVSEP 62

Query: 63  SVLKQLVNAAVK--GHGKIDSLVANAG--VLEPVQNVNEIDVNAWKKLYDINFFSIVSLV 118
             +  L     K     K+D L  NAG     P  +V     +  ++ + +N F  V+L 
Sbjct: 63  EQIIHLRERLAKELPSQKLDVLYNNAGQSCTFPASDVTN---DVLEQAFKVNVFGPVNLC 119

Query: 119 GIALPELKKTNGNVVFVSSDACNMYFSSWGAYGSSKAALNHFAMTLANEERQ--VKAIAV 176
              LP + K  G V+F  S A  M F     Y ++K A++ +A  L  E +   V+ + V
Sbjct: 120 KELLPFVIKAKGTVLFTGSVAGLMPFPFGSIYSATKGAIHSYARCLHTEMKPFGVRVLNV 179

Query: 177 APGIVDTDM---QVNIRENVGPSSMSAEQLKMFRGLKENNQ 214
             G V TD+   +    +++     ++E +   R + ENN+
Sbjct: 180 VTGGVKTDIADKRPLPEDSIYNIPEASEAMAYRRNMAENNR 220

>YMR226C (YMR226C) [4182] chr13 complement(721592..722395)
           NADP+-dependent L-allo-threonine dehydrogenase, member
           of the short-chain dehydrogenase-reductase family, which
           are NAD- or NADP-dependent oxidoreductases [804 bp, 267
           aa]
          Length = 267

 Score = 61.6 bits (148), Expect = 4e-11,   Method: Compositional matrix adjust.
 Identities = 53/194 (27%), Positives = 96/194 (49%), Gaps = 9/194 (4%)

Query: 3   KVILVTGVSRGIGKSI-VDVLFSLDKDTVVYGVARSEAPLKKLKEKYGDRF----FYVVG 57
           K +L+TG S GIGK+  ++ L + + D  +   AR    L++LK+     F     +V  
Sbjct: 14  KTVLITGASAGIGKATALEYLEASNGDMKLILAARRLEKLEELKKTIDQEFPNAKVHVAQ 73

Query: 58  -DITEDSVLKQLVNAAVKGHGKIDSLVANAGVLEPVQNVNEIDVNAWKKLYDINFFSIVS 116
            DIT+   +K  +    +    ID LV NAG       V +I     + ++D N  ++++
Sbjct: 74  LDITQAEKIKPFIENLPQEFKDIDILVNNAGKALGSDRVGQIATEDIQDVFDTNVTALIN 133

Query: 117 LVGIALPELK-KTNGNVVFVSSDACNMYFSSWGAYGSSKAALNHFAMTLANE--ERQVKA 173
           +    LP  + K +G++V + S A    + +   Y +SK A+  F  +L  E    +++ 
Sbjct: 134 ITQAVLPIFQAKNSGDIVNLGSIAGRDAYPTGSIYCASKFAVGAFTDSLRKELINTKIRV 193

Query: 174 IAVAPGIVDTDMQV 187
           I +APG+V+T+  +
Sbjct: 194 ILIAPGLVETEFSL 207

>Kwal_47.17102
          Length = 285

 Score = 59.7 bits (143), Expect = 2e-10,   Method: Compositional matrix adjust.
 Identities = 51/187 (27%), Positives = 84/187 (44%), Gaps = 12/187 (6%)

Query: 4   VILVTGVSRGIGKSIV-DVLFSLDKDTVVYGVARSEAPLKKLKEKYGDRFFYVVGDITED 62
           V +VTG S G+G++IV + L  L   T++      E P K     Y     +   D++  
Sbjct: 34  VCVVTGGSNGLGRAIVQEFLLKLPNVTLIS--LDIEPPKKSFPNVY-----HYTCDLSNS 86

Query: 63  SVLKQLVNAAVKGHGKIDSLVANAGVLEPVQNVNEIDVNAWKKLYDINFFSIVSLVGIAL 122
           S + Q +    + HG +  L+ NAG+    QN  E+      K++ +N F+ + LV    
Sbjct: 87  SDVDQTLKIVKRNHGDVTVLINNAGIRAKYQNFRELSKEVADKVFQVNVFTPMRLVQELS 146

Query: 123 PELKKTNGNVVFVSSDACNMYFSSWG-AYGSSKAALNHFAMTLA---NEERQVKAIAVAP 178
           P+            + A  +   + G  YG+SKAA   F    A   +E  +++ + V P
Sbjct: 147 PKAGDLRQFYAVTVASALGVCAPARGSCYGASKAAAIAFHEAWAQELDETSRIRTLLVTP 206

Query: 179 GIVDTDM 185
           G +DT M
Sbjct: 207 GQLDTTM 213

>KLLA0D15521g 1311601..1312371 similar to sp|Q8TTF8 Methanosarcina
           acetivorans Cyclohexanol dehydrogenase, start by
           similarity
          Length = 256

 Score = 59.3 bits (142), Expect = 3e-10,   Method: Compositional matrix adjust.
 Identities = 55/196 (28%), Positives = 92/196 (46%), Gaps = 19/196 (9%)

Query: 2   GKVILVTGVSRGIGKSIVDVLFSLDKDTVVYGVARSEAPLKKLKEKYGD---RFFYVVG- 57
           GK+ LVTG S G+G+ I   LF      V+     +   L +++E  G+       V+G 
Sbjct: 8   GKIALVTGASTGVGEGIARALFVRGATVVI-----TSRHLSEVQETAGNIDPSGSRVIGK 62

Query: 58  --DITEDSVLKQLVNAAVKGHGKIDSLVANAGVLEPVQN-VNEIDVNAWKKLYDINFFSI 114
             D+T    ++ L+    +  G +  LV NAG+  P Q  + + D+++W+++ D N    
Sbjct: 63  EVDVTVAKAVEDLIQEIREEFGALHYLVNNAGITGPHQTGIEDYDIDSWRQVIDTNINGT 122

Query: 115 VSLVGIALPELKKT---NGNVVFVSSDACNMYFSSWG--AYGSSKAALNHFAMTLANE-- 167
              +  ALP ++ +   +     V+  A N      G   Y ++K A+     ++A E  
Sbjct: 123 FYTLKYALPLMESSSSPDSEAAVVNLSAVNGLVGIPGISPYTATKHAVIGITQSVALEYA 182

Query: 168 ERQVKAIAVAPGIVDT 183
           ER V+  AVAPG V T
Sbjct: 183 ERNVRVNAVAPGYVST 198

>KLLA0B08371g complement(747517..748323) highly similar to sp|Q05016
           Saccharomyces cerevisiae YMR226c, start by similarity
          Length = 268

 Score = 58.9 bits (141), Expect = 4e-10,   Method: Compositional matrix adjust.
 Identities = 54/194 (27%), Positives = 94/194 (48%), Gaps = 9/194 (4%)

Query: 3   KVILVTGVSRGIGKSI-VDVLFSLDKDTVVYGVARSEAPLKKLKEK----YGDRFFYVVG 57
           K I +TG S GIG++  ++ L + + +  +   AR  A L++LKEK    Y     Y+  
Sbjct: 14  KTIFITGASAGIGQATALEYLDAANGNVKLILAARRLAKLEELKEKINAEYPQAKVYIGQ 73

Query: 58  -DITEDSVLKQLVNAAVKGHGKIDSLVANAGVLEPVQNVNEIDVNAWKKLYDINFFSIVS 116
            D+TE   ++  ++   +    ID L+ NAG       V  I     K + D N  ++++
Sbjct: 74  LDVTETEKIQPFIDNLPEEFKDIDILINNAGKALGSDVVGTISSEDIKGMIDTNVVALIN 133

Query: 117 LVGIALPELK-KTNGNVVFVSSDACNMYFSSWGAYGSSKAALNHFAMTLANE--ERQVKA 173
           +    LP  K K +G++V + S A    + +   Y +SK A+  F  +L  E     ++ 
Sbjct: 134 VTQAVLPIFKAKNSGDIVNLGSVAGRDAYPTGSIYCASKHAVRAFTQSLRKELINTGIRV 193

Query: 174 IAVAPGIVDTDMQV 187
           I +APG V+T+  +
Sbjct: 194 IEIAPGNVETEFSL 207

>Kwal_26.9160
          Length = 267

 Score = 58.2 bits (139), Expect = 6e-10,   Method: Compositional matrix adjust.
 Identities = 50/195 (25%), Positives = 94/195 (48%), Gaps = 9/195 (4%)

Query: 2   GKVILVTGVSRGIGKSI-VDVLFSLDKDTVVYGVARSEAPLKKLKEKYGDRF----FYVV 56
           GK +L+TG S GIG++  ++ L + + +  +   AR    LK++K ++   F     Y+ 
Sbjct: 13  GKTVLITGASAGIGQATALEYLDASNGNIKLILAARRLEKLKEIKSQFEKDFPEAKVYIG 72

Query: 57  G-DITEDSVLKQLVNAAVKGHGKIDSLVANAGVLEPVQNVNEIDVNAWKKLYDINFFSIV 115
             D+T    +K  ++   +    ID L+ NAG       V  ID +  + +   N  +++
Sbjct: 73  QLDVTHTDEIKPFIDNLPEEFKDIDILINNAGKALGSDPVGTIDASDIEGMIQTNVVALI 132

Query: 116 SLVGIALPELKKTN-GNVVFVSSDACNMYFSSWGAYGSSKAALNHFAMTLANE--ERQVK 172
           ++    LP  K  N G++V + S A    + +   Y ++K A+  F  +L  E     ++
Sbjct: 133 NMTQAVLPIFKAKNAGDIVNLGSVAGREAYPTGSIYCATKHAVRAFTQSLRKELINTNIR 192

Query: 173 AIAVAPGIVDTDMQV 187
            I +APG V+T+  +
Sbjct: 193 VIEIAPGNVETEFSL 207

>CAGL0M11242g complement(1105723..1106529) highly similar to
           sp|Q05016 Saccharomyces cerevisiae YMR226c, start by
           similarity
          Length = 268

 Score = 57.8 bits (138), Expect = 9e-10,   Method: Compositional matrix adjust.
 Identities = 55/195 (28%), Positives = 92/195 (47%), Gaps = 9/195 (4%)

Query: 2   GKVILVTGVSRGIGKSIVDVLFSLDKDTV--VYGVAR---SEAPLKKLKEKYGDRFFYVV 56
           GK+  +TG S GIGK+           +V  V G  R    E   K+L  +Y D   ++ 
Sbjct: 13  GKIAFITGASAGIGKATAIEYLDASNGSVKLVLGARRMEKLEELKKELLAQYPDAKIHIG 72

Query: 57  G-DITEDSVLKQLVNAAVKGHGKIDSLVANAGVLEPVQNVNEIDVNAWKKLYDINFFSIV 115
             D+T+   +KQ +    +    ID L+ NAG       V +ID      + + N  +++
Sbjct: 73  KLDVTDFENVKQFLADLPEEFKDIDILINNAGKALGSDKVGDIDPEDIAGMVNTNVLALI 132

Query: 116 SLVGIALPELKKTN-GNVVFVSSDACNMYFSSWGAYGSSKAALNHFAMTLANE--ERQVK 172
           +L  + LP  KK N G++V + S A    + +   Y ++K A+  F  +L  E     ++
Sbjct: 133 NLTQLLLPLFKKKNSGDIVNLGSIAGRDAYPTGAIYCATKHAVRAFTQSLRKELINTDIR 192

Query: 173 AIAVAPGIVDTDMQV 187
            I +APG+V+T+  V
Sbjct: 193 VIEIAPGMVETEFSV 207

>KLLA0E13860g 1219430..1222099 similar to sp|Q02207 Saccharomyces
           cerevisiae YKR009c FOX2
           hydratase-dehydrogenase-epimerase, peroxisomal
           singleton, start by similarity
          Length = 889

 Score = 58.5 bits (140), Expect = 1e-09,   Method: Compositional matrix adjust.
 Identities = 51/183 (27%), Positives = 89/183 (48%), Gaps = 11/183 (6%)

Query: 2   GKVILVTGVSRGIGKSIVDVLFSLDKDTVVYGVARSEAPLKKLKEKYGDRFFYVVGDITE 61
           GKV+++TG   G+GKS            V+  +    A + ++ +KYG      V D T 
Sbjct: 313 GKVVIITGSGSGLGKSHAQWFARYGAKVVINDIRDPSAVVDEINKKYGSG--SAVAD-TH 369

Query: 62  DSV--LKQLVNAAVKGHGKIDSLVANAGVLEPVQNVNEIDVNAWKKLYDINFFSIVSLVG 119
           D V   +Q+V  AV   G++D LV NAG+L   ++  ++  + W  + +++ FS  +L  
Sbjct: 370 DIVKEAQQVVQTAVDKFGRVDILVNNAGILRD-RSFAKMTEDEWNAVINVHLFSTFALSK 428

Query: 120 IALPELKKTNGNVVFVSSDACNMYFSSWGA--YGSSKAALNHFAMTLANE--ERQVKAIA 175
              P   K     +  ++    +Y  ++G   Y ++KAA+  F+ TLA E  +R +    
Sbjct: 429 AVWPIFLKQKSGYIINTTSTSGIY-GNFGQCNYAAAKAAILGFSRTLALEGTKRGITVNV 487

Query: 176 VAP 178
           +AP
Sbjct: 488 IAP 490

 Score = 38.1 bits (87), Expect = 0.006,   Method: Compositional matrix adjust.
 Identities = 46/211 (21%), Positives = 94/211 (44%), Gaps = 21/211 (9%)

Query: 3   KVILVTGVSRGIGKSIVDVLFSLDKDTVVYGVARSEAP--LKKLKEKYGDRFFYVVGDIT 60
           +V+++TG   G+G+             VV  + RS A   ++++K+  G+      GD  
Sbjct: 8   RVVIITGAGGGLGRVYALEYAKRGGKVVVNDLGRSAADSVVQEIKKLGGE------GDAV 61

Query: 61  E--DSVLKQ---LVNAAVKGHGKIDSLVANAGVLEPVQNVNEIDVNAWKKLYDINFFSIV 115
              DSV      +V  A+   G++D L+ NAG+L    +  ++    ++++ D++     
Sbjct: 62  ANYDSVSDNGAAIVETAISNFGRVDILINNAGILRD-SSFAKMSEKQFQQVIDVHLNGAF 120

Query: 116 SLVGIALPELKKTNGNVVFVSSDACNMYFSSWGA-YGSSKAALNHFAMTLANE--ERQVK 172
            L   A P ++K     +  +     +Y +   A Y ++K  L  F  +LA E  +  + 
Sbjct: 121 KLTRAAWPHMRKQKFGRIINTCSPAGLYGNFGQANYSAAKLGLLGFGESLAKEGYKYNIN 180

Query: 173 AIAVAP----GIVDTDMQVNIRENVGPSSMS 199
             ++AP     + +  +  NI + +GP  ++
Sbjct: 181 VNSIAPLARSAMTENVIPANILKELGPEKIA 211

>Sklu_2348.5 YIL124W, Contig c2348 10212-11081 reverse complement
          Length = 289

 Score = 55.5 bits (132), Expect = 6e-09,   Method: Compositional matrix adjust.
 Identities = 66/237 (27%), Positives = 108/237 (45%), Gaps = 24/237 (10%)

Query: 3   KVILVTGVSRGIGKSIVDVLFSLDKDTVVYGVARSEAPLKKLKEKYGDRFFYVVGDITED 62
           KV LVTG S GIG  I  +L S  K   VY  AR   P+K L+E++ ++   V  D+++ 
Sbjct: 5   KVALVTGASSGIGYEITKLLAS--KGYTVYAAARRTTPIKPLEEEFPEKVIAVSLDVSD- 61

Query: 63  SVLKQLVNAAVK-----GHGKIDSLVANAG--VLEPVQNVNEIDVNAWKKLYDINFFSIV 115
             L+Q+ +   +        K+  L  NAG     P  +V    +   ++ + +N F  +
Sbjct: 62  --LQQIQDLKARFSRDLPDSKLHILYNNAGQSCTFPAVDVGNDKI---EQCFKVNVFGPM 116

Query: 116 SLVGIALPELKKTNGNVVFVSSDACNMYFSSWGAYGSSKAALNHFAMTLANEERQ--VKA 173
           +L       +    G +VF  S A  + F     Y S+KAA++ +A  L  E +   VK 
Sbjct: 117 NLCREMSDFVINARGTIVFTGSLAGIVPFPFGSIYSSTKAAIHQYARVLHVEMKPFGVKV 176

Query: 174 IAVAPGIVDT---DMQVNIRENVGPSSMSAEQLKMFRGLKENNQLLDSSVPATVYAK 227
           I    G V T   D +  + ++V  +       +  + + +NN+ +    PA VYAK
Sbjct: 177 INAITGGVATNIADTRPLLEDSVFNTPEGRHAFETRQNMAKNNKPMS---PA-VYAK 229

>Sklu_1578.3 YMR226C, Contig c1578 1774-2580
          Length = 268

 Score = 54.7 bits (130), Expect = 1e-08,   Method: Compositional matrix adjust.
 Identities = 51/196 (26%), Positives = 89/196 (45%), Gaps = 13/196 (6%)

Query: 3   KVILVTGVSRGIGKSIVDVLFSLDKDTVVYGVARSEAPLKKLKE-------KYGDRFFYV 55
           K + +TG S GIG++    L   D       +  S   L+KL+E       +Y +   Y+
Sbjct: 14  KTVFITGASAGIGQATA--LEYCDASNGKINLVLSARRLEKLQELKDKITKEYPEAKVYI 71

Query: 56  -VGDITEDSVLKQLVNAAVKGHGKIDSLVANAGVLEPVQNVNEIDVNAWKKLYDINFFSI 114
            V D+TE   +K  ++   +    ID L+ NAG       V  I     + + + N  ++
Sbjct: 72  GVLDVTETEKIKPFLDGLPEEFKDIDILINNAGKALGSDPVGTIKTEDIEGMINTNVLAL 131

Query: 115 VSLVGIALPELKKTN-GNVVFVSSDACNMYFSSWGAYGSSKAALNHFAMTLANE--ERQV 171
           +++    LP  K  N G++V + S A    + +   Y +SK A+  F  +L  E     +
Sbjct: 132 INITQAVLPIFKAKNFGDIVNLGSVAGRDAYPTGAIYCASKHAVRAFTQSLRKELVNTNI 191

Query: 172 KAIAVAPGIVDTDMQV 187
           + I +APG V+T+  +
Sbjct: 192 RVIEIAPGNVETEFSL 207

>KLLA0F04455g complement(428010..428927) similar to sp|P40471
           Saccharomyces cerevisiae YIL124w AYR1
           1-Acyldihydroxyacetone-phosphate reductase, hypothetical
           start
          Length = 305

 Score = 53.5 bits (127), Expect = 3e-08,   Method: Compositional matrix adjust.
 Identities = 53/189 (28%), Positives = 85/189 (44%), Gaps = 11/189 (5%)

Query: 3   KVILVTGVSRGIGKSIVDVLFSLDKDTVVYGVARSEAPLKKLKEKYGDRFFYVVGDITED 62
           K  LVTG S GIG  +   L  L +   VY  AR   P+++L+ ++GDR      D++  
Sbjct: 5   KYALVTGASSGIGYEVTKEL--LRRGWYVYACARRTHPMEELRAEFGDRCIPRKLDVSNQ 62

Query: 63  SVLKQLVNAAVK--GHGKIDSLVANAG--VLEPVQNVNEIDVNAWKKLYDINFFSIVSLV 118
           + + QL     +     K+  L  NAG     P  +V+E  ++     + +N +  ++  
Sbjct: 63  NDITQLKLKLEQELPDQKLHLLYNNAGQSCSLPAIDVSEEIID---NTFRVNVYGPINSC 119

Query: 119 GIALPELKKTNGNVVFVSSDACNMYFSSWGAYGSSKAALNHFAMTLANE--ERQVKAIAV 176
               P +    G +VF  S A    F     Y +SKAA++ +A  L  E     V+ I +
Sbjct: 120 REFAPLIINAKGTIVFTGSLAGICPFPFGAVYSASKAAIHQYARVLHGELGPLGVRVINM 179

Query: 177 APGIVDTDM 185
             G V TD+
Sbjct: 180 ITGGVATDI 188

>KLLA0E24046g complement(2136583..2137425) similar to
           ca|CA3771|CaSOU1 Candida albicans Sorbitol utilization
           protein Sou1p [Candida albicans], hypothetical start
          Length = 280

 Score = 52.8 bits (125), Expect = 5e-08,   Method: Compositional matrix adjust.
 Identities = 54/205 (26%), Positives = 95/205 (46%), Gaps = 15/205 (7%)

Query: 2   GKVILVTGVSRGIGKSIVDVLFSLDKDTVVYGVARSEAPLKK----LKEKYGDRFFYVVG 57
           GKV +VTG S GIG ++ + L        V+    S A L +    L  KY  +      
Sbjct: 30  GKVAVVTGASSGIGYAVAEGLAQAGASLAVW--YNSNAALVERAVELSAKYNVKVVAYQC 87

Query: 58  DITEDSVLKQLVNAAVKGHGKIDSLVANAGVLE---PVQNVNE--IDVNAWKKLYDINFF 112
            +TE++ +K+ +   ++  GKID  +ANAGV     P+    E   D + W K+   +F 
Sbjct: 88  PVTEEAKVKKTIEDVIQEFGKIDVFIANAGVPWTKGPLVEAAESGTDTDEWNKVIHTDFN 147

Query: 113 SIVSLVGIALPELKKT-NGNVVFVSSDACNM--YFSSWGAYGSSKAALNHFAMTLANEER 169
            +         + K+  +G++V  +S + ++         Y ++KA + HFA +LA E  
Sbjct: 148 GVYYCAKYVGAQFKRQGSGSMVITASMSGHIVNIPQLQACYNAAKAGVIHFAKSLAVEWA 207

Query: 170 QVKAI-AVAPGIVDTDMQVNIRENV 193
               +  V+PG + T +   + E++
Sbjct: 208 GFARVNTVSPGYIATPISNFVDEDL 232

>CAGL0H10450g complement(1018805..1019740) similar to tr|Q07530
           Saccharomyces cerevisiae YDL114w, hypothetical start
          Length = 311

 Score = 52.4 bits (124), Expect = 8e-08,   Method: Compositional matrix adjust.
 Identities = 59/234 (25%), Positives = 108/234 (46%), Gaps = 21/234 (8%)

Query: 4   VILVTGVSRGIGKSIVDVLFSLDKDTVVYGVARSEAPLKKLKEKYGDRFFYVVGDITEDS 63
           V L+TG S G+G  I   L    K  +V  +     P K+L ++Y +   Y   DIT+  
Sbjct: 46  VALITGGSGGLGLEIAIALVQRYKSVIV-AIVDVVPPKKQLVKQYPNIIHYRC-DITDSF 103

Query: 64  VLKQLVNAAVKGHGKIDSLVANAG--VLEPVQNVNEIDVNAWKKLYDINFFSIVSLVGIA 121
            +  +    +   GK++ LV NA   +++ + ++ E ++   +++ ++N  +   LV + 
Sbjct: 104 QVAHMKKKVLLDFGKVNILVNNAAITIIKQLTDMTEAEI---QRVINVNLIASYHLVSMF 160

Query: 122 LPELKKT-NGNVVFVSSDACNMYFSSWGAYGSSKAAL----NHFAMTL------ANEERQ 170
           +PE+  T NG ++ ++S    +  S    YG++K  L    N+    +      A   R 
Sbjct: 161 VPEMLYTKNGCIINIASVLGELTPSRLIVYGATKGGLIELHNYLNQQINAHNSYAYNRRG 220

Query: 171 VKAIAVAPGIVDTDMQVNIRENVGPSSMSAEQLKMFRGLKENNQLLDSSVPATV 224
           +KAI V PG + T M    ++   PS   A  L       E  + +DS + +T+
Sbjct: 221 LKAILVCPGKISTTM---FKDVDTPSKFLAPDLPPNELATEIIKTVDSKISSTL 271

>YKL071W (YKL071W) [3189] chr11 (304759..305529) Protein with
           similarity to proteins of the short-chain alcohol
           dehydrogenase family, expression is regulated by Yap1p
           transcription factor [771 bp, 256 aa]
          Length = 256

 Score = 51.2 bits (121), Expect = 1e-07,   Method: Compositional matrix adjust.
 Identities = 58/193 (30%), Positives = 87/193 (45%), Gaps = 14/193 (7%)

Query: 6   LVTGVSRGIGKSIVDVLFSLDKDTVVYGVARSEAPLKKLKE-----KYGDRFFYVVGDIT 60
            + G SRGIG ++V +L +   +TV+  + R    L K K+     K       V  D+T
Sbjct: 10  FIIGGSRGIGFNLVKILSASTGNTVITSI-RGSPSLPKNKQVEDLAKIRKNIHIVQLDLT 68

Query: 61  EDSVLKQLVNAAVKG--HGKIDSLVANAGVLEPVQNVNEIDVNAWKKLYDINFF-SIVSL 117
           +D  +  + +   K      ID  +A + V +    V E   + W   Y  N    I++L
Sbjct: 69  KDESIGNIADEIKKTPFFLGIDIFIACSAVSDSYYKVLETPKSVWLNHYSTNALGPILAL 128

Query: 118 VGIALPELKKTNGNVVFVSSDA--CNMYFS-SWGAYGSSKAALNHFAMTLANEERQ--VK 172
             +    L K    + F+SS A   N +   S  AYG SKAALN+   TL+ E +     
Sbjct: 129 QKVYPLLLLKKTRKIFFISSVAGSINAFVPLSVSAYGQSKAALNYAVKTLSFELKPEGFT 188

Query: 173 AIAVAPGIVDTDM 185
            +A  PG+V TDM
Sbjct: 189 VVAFHPGMVSTDM 201

>AGL060W [4251] [Homologous to ScYKR009C (FOX2) - SH]
           complement(595270..597945) [2676 bp, 891 aa]
          Length = 891

 Score = 51.2 bits (121), Expect = 3e-07,   Method: Compositional matrix adjust.
 Identities = 51/217 (23%), Positives = 96/217 (44%), Gaps = 7/217 (3%)

Query: 3   KVILVTGVSRGIGKSIVDVLFSLDKDTVVYGVARSEAPLKKLKEKYGD-RFFYVVGDITE 61
           KV+++TG   G+G+S            VV  +  ++  + ++  +YG+ R      +I  
Sbjct: 320 KVVIITGAGAGLGRSHALWFAKYGARVVVNDLKGADGVVAEINSQYGEGRAVADSHNIVT 379

Query: 62  DSVLKQLVNAAVKGHGKIDSLVANAGVLEPVQNVNEIDVNAWKKLYDINFFSIVSLVGIA 121
           D+    +V  A+K   ++D LV NAG+L     V   D + W  +  ++  S+ +L    
Sbjct: 380 DAA--AVVETAMKAFERVDVLVNNAGILRDRSFVKMTD-DEWNSVLQVHLLSVFALSKAV 436

Query: 122 LPELKKTNGNVVFVSSDACNMYFSSWGA-YGSSKAALNHFAMTLANE--ERQVKAIAVAP 178
            P   +    V+  ++    +Y +   A Y ++KAA+  F+ +LA E  +R ++   +AP
Sbjct: 437 WPIFMQQRSGVIVNTTSTSGIYGNFGQANYSAAKAAVLGFSKSLAIEGAKRGIRVYVIAP 496

Query: 179 GIVDTDMQVNIRENVGPSSMSAEQLKMFRGLKENNQL 215
                  +    E    SS    Q+  F  L  +N+ 
Sbjct: 497 HAFTNMTKTIFGETEIKSSFEPSQVSPFVVLLASNEF 533

 Score = 29.6 bits (65), Expect = 2.7,   Method: Compositional matrix adjust.
 Identities = 29/117 (24%), Positives = 55/117 (47%), Gaps = 8/117 (6%)

Query: 67  QLVNAAVKGHGKIDSLVANAGVLEPVQNVNEIDVNAWKKLYDINFFSIVSLVGIALPELK 126
           ++V  A+   G++D +V NAG+L         + N +  + D++      L   A P ++
Sbjct: 79  KIVKTAIDAFGRVDVIVNNAGILRDGSFAKMTEKN-FSAVVDVHLNGSYKLCKAAWPYMR 137

Query: 127 KTN-GNVVFVSSDACNMYFSSWGA--YGSSKAALNHFAMTLANEERQ--VKAIAVAP 178
           +   G +V  +S A    + ++G   Y ++K  L   + TLA E  +  +K   +AP
Sbjct: 138 QQKYGRIVNTASPAG--LYGNFGQTNYSAAKLGLVGLSETLAKEGHKYNIKVNVIAP 192

>Kwal_34.16024
          Length = 292

 Score = 50.4 bits (119), Expect = 3e-07,   Method: Compositional matrix adjust.
 Identities = 56/203 (27%), Positives = 92/203 (45%), Gaps = 28/203 (13%)

Query: 2   GKVILVTGVSRGIGKSIVDVLFSLDKDTVVYGVARSEAPLKKLKEKYG--DRFFYVVGDI 59
           GK+++VTG +  IG++I +   S   D  V            L +KYG   R + V  DI
Sbjct: 39  GKLVIVTGAAGVIGRAICEGFASAGADVCVVDYKYDADLATLLAQKYGVEARAYQV--DI 96

Query: 60  TEDSVLKQLVNAAVKGHGK--IDSLVANAGVLEPVQNV-NEIDV-NAWKKLYDINF---F 112
           T D  ++  + A  K      ID+ +ANAGV     +V NE     AW+++ D+N    F
Sbjct: 97  TNDEDVRACIQAVQKDFPSRDIDTFIANAGVAWTHGSVLNESATPEAWRRVMDVNVQGTF 156

Query: 113 SIVSLVGIALPELKKTNGNVVFVSSDACNM-----YFSSWGAYGSSKAALNHFAMTLANE 167
                V       ++ +G ++  +S + ++     Y +    Y +SKAA+ H A   A E
Sbjct: 157 HCAQEVAHVFK--RQGHGCLILTASMSSHIANVPNYQT---CYNASKAAVRHMARGFAVE 211

Query: 168 -------ERQVKAIAVAPGIVDT 183
                    +++  +V+PG  DT
Sbjct: 212 FAHLTEPAGRIRCNSVSPGYTDT 234

>Sklu_2420.5 YOR246C, Contig c2420 9342-10322 reverse complement
          Length = 326

 Score = 50.4 bits (119), Expect = 4e-07,   Method: Compositional matrix adjust.
 Identities = 49/167 (29%), Positives = 76/167 (45%), Gaps = 31/167 (18%)

Query: 43  KLKEKYGDRFFYVVGDITEDSVLKQLVNAAVKGHG---KIDSLVANAGVLE-PVQNVNEI 98
           KL+  +G   F  + D+++   L+ +  AA K  G    +D L+ NAGV+  P     EI
Sbjct: 79  KLERNFGKLHFLSL-DLSD---LRSVDKAAAKFKGLELSLDVLINNAGVMALPY----EI 130

Query: 99  DVNAWKKLYDINFFSIVSLVGIALPELKKTNGNVVFVSSDACNMYFS------------- 145
             + ++     N+ S   L    LP +K+ NG V+ VSS   N+ F+             
Sbjct: 131 TKDGFEIQLQTNYISHFLLTMRLLPRIKRCNGRVITVSSIGHNLEFTYFNLNRDFNYMPN 190

Query: 146 ---SWGAYGSSKAALNHFAMTLANEERQVKAIAVAPGIVDTDMQVNI 189
              +W  Y  +K AL  F   LA +   V  I+V PG+V   M+ N+
Sbjct: 191 IIFTWMRYAMAKTALIQFTKMLAIKHPDVLCISVHPGLV---METNL 234

>Kwal_55.19569
          Length = 288

 Score = 50.1 bits (118), Expect = 4e-07,   Method: Compositional matrix adjust.
 Identities = 51/206 (24%), Positives = 91/206 (44%), Gaps = 33/206 (16%)

Query: 2   GKVILVTGVSRGIGKSIVDVLFSLDKDTVVYGVARSE--APLKKLKEKYGDRFFYVVGDI 59
           GKV  ++G S GIG ++         D  V+  +  +     K+L E YG R       +
Sbjct: 38  GKVACISGASSGIGGAVAVAFAQAGADIAVWYNSNDKLIQTAKELSETYGVRAKAYKCPV 97

Query: 60  TEDSVLKQLVNAAVKGHGKIDSLVANAGVLE---PVQNVNE--IDVNAWKKLYDINF--- 111
           T+++ +K+ +    K   KID  VANAGV     P+    E  +    W+K+++ +F   
Sbjct: 98  TDEAKVKETILQVEKDFSKIDIFVANAGVPWSEGPLIEAEERGVATKEWEKVFNTDFQGV 157

Query: 112 FSIVSLVGIALPELKKTNGNVVFVSS-----------DACNMYFSSWGAYGSSKAALNHF 160
           +    ++G      K+  G++V  +S            AC         Y ++KA + H 
Sbjct: 158 YYCSKVIGAIFK--KQGRGSLVITASMSGHVVNVPQLQAC---------YNAAKAGVIHL 206

Query: 161 AMTLANEERQVKAI-AVAPGIVDTDM 185
           + +LA E      + +++PG +DT +
Sbjct: 207 SRSLAVEWAGFARVNSISPGYIDTPI 232

>YNL202W (SPS19) [4400] chr14 (259568..260455) Peroxisomal
           2,4-dienoyl-CoA reductase [888 bp, 295 aa]
          Length = 295

 Score = 49.3 bits (116), Expect = 9e-07,   Method: Compositional matrix adjust.
 Identities = 51/188 (27%), Positives = 85/188 (45%), Gaps = 8/188 (4%)

Query: 2   GKVILVTGVSRGIGKSIVDVLFSLDKDTVVYGV--ARSEAPLKKLKE--KYGDRFFYVVG 57
           GKV  VTG +  I +   + L  L     + G    R+E   K + +  K  D    +  
Sbjct: 27  GKVAFVTGGAGTICRVQTEALVLLGCKAAIVGRDQERTEQAAKGISQLAKDKDAVLAIAN 86

Query: 58  -DITEDSVLKQLVNAAVKGHGKIDSLVANAGVLEPVQNVNEIDVNAWKKLYDINFFSIVS 116
            D+     ++  V   V+  GKID ++A A     V +   +  NA+K + DI+     +
Sbjct: 87  VDVRNFEQVENAVKKTVEKFGKIDFVIAGAAG-NFVCDFANLSPNAFKSVVDIDLLGSFN 145

Query: 117 LVGIALPELKKTNGNVVFVSSDACNMYFSSWGAYGSSKAALNHFAMTLANE--ERQVKAI 174
                L ELKK+ G+++FVS+          G  G++KA ++  A  LA E     +++ 
Sbjct: 146 TAKACLKELKKSKGSILFVSATFHYYGVPFQGHVGAAKAGIDALAKNLAVELGPLGIRSN 205

Query: 175 AVAPGIVD 182
            +APG +D
Sbjct: 206 CIAPGAID 213

>Scas_666.17*
          Length = 283

 Score = 48.9 bits (115), Expect = 1e-06,   Method: Compositional matrix adjust.
 Identities = 41/190 (21%), Positives = 88/190 (46%), Gaps = 14/190 (7%)

Query: 4   VILVTGVSRGIGKSIVDVLFSLDKDTVVYGVARSEAPLKKLKEKYGDRFFYVVGDITEDS 63
            +++TG S G+G +IV    +      +  V +  +P      +   R   +  D++   
Sbjct: 27  CVVITGGSHGLGHAIVVRFLNKVPKITIINVDKISSP------QDDPRMVTIQCDLSNQV 80

Query: 64  VLKQLVNAAVKGHG-KIDSLVANAGVLEPVQNVNEIDVNAWKKLYDINFFSIVSLVGIAL 122
            +++ ++   + +G +I  ++ NAG+    QN   +D N   +++ +N F+ V  +   +
Sbjct: 81  EMEKTLSLIKRKYGERIAVIINNAGMRMKYQNFQHLDQNECMRVFQLNTFNAVRFMQSLV 140

Query: 123 PELKKTNGN--VVFVSSDACNMYFSSWGAYGSSKAALNHFAMTLANEER-----QVKAIA 175
           PE    +    +V V+S    +  +    YG+SK+AL  F  + + E +      ++ + 
Sbjct: 141 PEENSNDRQCYIVNVASTLGTLTPAKVAGYGASKSALIAFHQSYSMELQTRRVSNIRTLL 200

Query: 176 VAPGIVDTDM 185
           V PG ++T M
Sbjct: 201 VVPGQLNTAM 210

>CAGL0G08690g complement(822798..823682) similar to sp|P40471
           Saccharomyces cerevisiae YIL124w AYR1
           1-Acyldihydroxyacetone-phosphate reductase, hypothetical
           start
          Length = 294

 Score = 48.9 bits (115), Expect = 1e-06,   Method: Compositional matrix adjust.
 Identities = 65/232 (28%), Positives = 100/232 (43%), Gaps = 13/232 (5%)

Query: 3   KVILVTGVSRGIGKSIVDVLFSLDKDTVVYGVARSEAPLKKLKEKYGDRFFYVVG-DITE 61
           KV +VTG S GIG  +   L    K   V+  AR  AP++ L   +G         DI+E
Sbjct: 8   KVAVVTGASSGIGYEVTKEL--ARKGFKVFACARRTAPIEPLVNSFGKELIVPHHLDISE 65

Query: 62  -DSVLK-QLVNAAVKGHGKIDSLVANAG--VLEPVQNVNEIDVNAWKKLYDINFFSIVSL 117
            D VLK +   A+     K+D L  NAG     P  +V+    +  ++ + +N F  +++
Sbjct: 66  LDEVLKFKEFLASELPEQKLDILYNNAGQSCTFPALDVSN---DVMEQCFKVNVFGHINM 122

Query: 118 VGIALPELKKTNGNVVFVSSDACNMYFSSWGAYGSSKAALNHFAMTLANEERQ--VKAIA 175
                  L    G V+F  S A          Y ++KAA++ +A TL  E +   V+ I 
Sbjct: 123 TRELAQYLINAKGTVIFTGSIAGFSTLPFGSIYAATKAAIHEYARTLHLELKPFGVRVIN 182

Query: 176 VAPGIVDTDMQVNIRENVGPSSMSAEQLKMFRGLKENNQLLDSSVPATVYAK 227
              G V TD+        G      + +  FR  ++     +  +PA VYAK
Sbjct: 183 AITGGVLTDIADKRDLPEGSIYKFPQGIDAFR-TRQTMAKDNHPMPADVYAK 233

>Kwal_26.8838
          Length = 323

 Score = 48.9 bits (115), Expect = 1e-06,   Method: Compositional matrix adjust.
 Identities = 55/219 (25%), Positives = 92/219 (42%), Gaps = 38/219 (17%)

Query: 3   KVILVTGVSRGIGKSIVDVLFSLDKDTVVYG--VARSEAPLKKLKEKYGDR--------- 51
           KV LVTG + GIG   V  L+       V G   +R    +K +K++   R         
Sbjct: 19  KVALVTGGNSGIGWYTVLHLYLHGFAVYVAGRNSSRVNRAIKDIKKEARTRIKKEDPESR 78

Query: 52  -----FFYVVGDITEDSVLKQLVNAAVKGHGKIDSLVANAGVLEPVQNVNEIDVNAWKKL 106
                 +++  D+TE  ++ +          ++D L+ NAGV+    +V E   + ++  
Sbjct: 79  HPVGELYFLSLDLTELKLVDKAAKRFRSLETRLDVLINNAGVMALPYSVTE---DGFEIQ 135

Query: 107 YDINFFSIVSLVGIALPELKKTNGNVVFVSSDACNMYFS----------------SWGAY 150
              N+ +   L    LP +K+  G ++ VSS   N+ FS                +W  Y
Sbjct: 136 LQTNYIAHFLLTMRLLPSVKRCRGRIITVSSIGHNLEFSYFSLAQSFNYKPNMLFTWMRY 195

Query: 151 GSSKAALNHFAMTLANEERQVKAIAVAPGIVDTDMQVNI 189
             +K A   FA  LA +   V  ++V PG+V   M+ N+
Sbjct: 196 AMAKTASIQFAKMLAIKHPDVLCMSVHPGLV---MKTNL 231

>KLLA0D18909g complement(1592628..1593500) similar to sp|P32573
           Saccharomyces cerevisiae YNL202w SPS19 peroxisomal 2,
           4-dienoyl-CoA reductase singleton, start by similarity
          Length = 290

 Score = 47.4 bits (111), Expect = 3e-06,   Method: Compositional matrix adjust.
 Identities = 63/250 (25%), Positives = 113/250 (45%), Gaps = 21/250 (8%)

Query: 2   GKVILVTGVSRGIGKSIVDVLFSLDKDTVVYGVARSEAPLKKLKEKYGDRFFYVVGDITE 61
           GKV+ VTG +  I +   + +  L    V+ G  R+    +K   + G         +  
Sbjct: 22  GKVVFVTGGAGTICRVQTEAMVLLGCKAVIVG--RNPEKTRKTAHEIGQLVHDPHSCLPI 79

Query: 62  DSV-------LKQLVNAAVKGHGKIDSLVANAGVLEPVQNVNEIDVNAWKKLYDINFFSI 114
            SV       L + V  A++  G++D ++A A     + +   +  NA+K +  I+    
Sbjct: 80  SSVDVRNVDQLHEAVKVAIQKFGRLDYVIAGAAG-NFLADFTHLSSNAFKSVVSIDLLGS 138

Query: 115 VSLVGIALPELKKTNGNVVFVSSDACNMYFSSWGAY-GSSKAALNHFAMTLANE--ERQV 171
            + V    PEL KT G+V+FVSS   + Y   + ++ G++KA ++  +  LA E     +
Sbjct: 139 FNTVKACFPELVKTKGSVLFVSS-TLHYYGVPFQSHVGAAKAGIDALSNALAVEMGPLGL 197

Query: 172 KAIAVAPG-IVDTDMQVNIRENVGPSSMSAEQLKMFRGLKENNQLLDSSV----PATVYA 226
           +   VAPG I +T+    + +N   S +S E + + R L     + +++V    PA  Y 
Sbjct: 198 RFNCVAPGAIANTEGLARLTKNDSSSDLS-EMIPLQR-LGTTVDIANTTVFLFSPAASYI 255

Query: 227 KLALHGIPDG 236
              +H +  G
Sbjct: 256 TGTIHVVDGG 265

>YIL124W (AYR1) [2552] chr9 (126204..127097) 1-Acyl dihydroxyacetone
           phosphate reductase [894 bp, 297 aa]
          Length = 297

 Score = 47.4 bits (111), Expect = 4e-06,   Method: Compositional matrix adjust.
 Identities = 55/188 (29%), Positives = 84/188 (44%), Gaps = 8/188 (4%)

Query: 3   KVILVTGVSRGIGKSIVDVLFSLDKDTVVYGVARSEAPLKKLKEKYG-DRFFYVVGDIT- 60
           K+ +VTG S GIG  +   L       +VY  AR   P+ +L  ++G D       DI+ 
Sbjct: 10  KIAVVTGASGGIGYEVTKEL--ARNGYLVYACARRLEPMAQLAIQFGNDSIKPYKLDISK 67

Query: 61  -EDSVLKQLVNAAVKGHGKIDSLVANAGVLEPVQNVNEIDVNAWKKLYDINFFSIVSLVG 119
            E+ V       A    GK+D L  NAG       ++  D  A ++ + +N F  +++  
Sbjct: 68  PEEIVTFSGFLRANLPDGKLDLLYNNAGQSCTFPALDATDA-AVEQCFKVNVFGHINMCR 126

Query: 120 IALPELKKTNGNVVFVSSDACNMYFSSWGAYGSSKAALNHFAMTLANEER--QVKAIAVA 177
                L K  G +VF  S A  + F     Y +SKAA++ +A  L  E +   V+ I   
Sbjct: 127 ELSEFLIKAKGTIVFTGSLAGVVSFPFGSIYSASKAAIHQYARGLHLEMKPFNVRVINAI 186

Query: 178 PGIVDTDM 185
            G V TD+
Sbjct: 187 TGGVATDI 194

>KLLA0D02596g
           join(complement(219682..219797),
           complement(218659..219586)) similar to sgd|S0004418
           Saccharomyces cerevisiae YLR426w, start by similarity
          Length = 347

 Score = 46.2 bits (108), Expect = 1e-05,   Method: Compositional matrix adjust.
 Identities = 60/248 (24%), Positives = 99/248 (39%), Gaps = 37/248 (14%)

Query: 4   VILVTGVSRGIGKSIVDVLFS--LDKDTVVYGVARSEAPLKKLKEKYGDRFFYVVGDITE 61
           V ++TG S G+G  +V  L S   D   V+  V   +  L   K    DR  ++  D++ 
Sbjct: 85  VCVITGGSLGLGNELVKSLMSDIPDIKIVILDVVDPKLDLSITK----DRIEFLRCDLSS 140

Query: 62  DSVLKQLVNAAVKGHGKIDSLVANAGVLEPVQNVNEIDVNAWKKLYDINFFSIVSLVGIA 121
           D  ++  +        K+D L+ NA +      + ++      K++  N  S + L+   
Sbjct: 141 DEEVENAIKTIKNKFPKVDLLINNAAIRGRFSRLADMPCVEMNKIFHANVLSTIRLIQAF 200

Query: 122 LPELKKTNGN----VVFVSSDACNMYFSSWGAYGSSKAAL--NHFAMT---LANEERQVK 172
            P  KK+  N    VV ++S    M  +    Y +SKAAL   H + T   L +    V+
Sbjct: 201 HP--KKSANNDFYYVVNIASALGIMSPARASTYAASKAALISYHESWTYELLNDNAMNVR 258

Query: 173 AIAVAPGIVDTDMQVNIRENVGPSSMSAEQLKMFRGLKENNQLLDSSVPATVYAKLALHG 232
            + V PG +DT                    +MF+G +   Q L   + A   AK     
Sbjct: 259 TLLVLPGQMDT--------------------QMFQGFEPPRQFLAPVIKAPELAKEITQC 298

Query: 233 IPDGVNGQ 240
             +G  G+
Sbjct: 299 CIEGRRGE 306

>Sklu_2219.3 YDL114W, Contig c2219 6060-7151 reverse complement
          Length = 363

 Score = 46.2 bits (108), Expect = 1e-05,   Method: Compositional matrix adjust.
 Identities = 56/220 (25%), Positives = 88/220 (40%), Gaps = 26/220 (11%)

Query: 6   LVTGVSRGIGKSIVDVLFSLDKDTVVYG-VARSEAPLKKLKEKYGDRFFYVVGDITEDSV 64
           L+TG S G+G  IV     L+  T +   V   +      + K     FY   DI+    
Sbjct: 87  LITGGSGGLGLEIVQQFQLLNIKTFILDIVPPPQMVFGNCEIKSNTNVFYYPCDISNPKE 146

Query: 65  LKQLVNAAVKGHGKIDSLVANAGVLEPVQNVNEIDVNAWKKLYDINFFSIVSLVGIALPE 124
           + +L       HG +  L+ NAG+    + + E+     +K   +N+ S    +   LP+
Sbjct: 147 IAELHKKIKLQHGNVTILINNAGITSGYR-LQELSDKVIEKTIQVNYVSAFYTIQEFLPD 205

Query: 125 L-KKTNGNVVFVSSDACNMYFSSWGAYGSSKAALNHFAMTLANEERQ------------- 170
           +   + G +V V+S    M  +   AYG+SK  L      L NE  Q             
Sbjct: 206 MVSMSRGYIVNVASVLGFMSPARLTAYGASKGGLISLHEALVNELYQIKRTRPQDSLHNL 265

Query: 171 -------VKAIAVAPGIVDTDMQVNIRENVGPSSMSAEQL 203
                  +KA+ V PG + T +   I+    PSS+ A  L
Sbjct: 266 SPRSKIPIKALLVCPGKIKTPLFQAIQT---PSSVMAPDL 302

>Scas_478.2
          Length = 920

 Score = 45.4 bits (106), Expect = 2e-05,   Method: Compositional matrix adjust.
 Identities = 32/143 (22%), Positives = 64/143 (44%), Gaps = 4/143 (2%)

Query: 2   GKVILVTGVSRGIGKSIVDVLFSLDKDTVVYGVARSEAPLKKLKEKYG-DRFFYVVGDIT 60
           GKV+++TG + G+GKS            ++  +   E  + ++  K+G D  F    +I 
Sbjct: 325 GKVVIITGANGGLGKSHAMWFAKYGAKVIINDITNPETTVNEINSKFGADTAFPDSHNII 384

Query: 61  EDSVLKQLVNAAVKGHGKIDSLVANAGVLEPVQNVNEIDVNAWKKLYDINFFSIVSLVGI 120
            +S L  +V  A+   G +D LV NAG+L   ++  ++    W  +  ++  +  ++   
Sbjct: 385 TESEL--VVKTAIDHFGHVDILVNNAGILRD-KSFLKMTEKEWYPVLQVHLQATFAMCKA 441

Query: 121 ALPELKKTNGNVVFVSSDACNMY 143
             P   K N   +  ++    +Y
Sbjct: 442 VWPHFSKQNSGFIINTTSTSGIY 464

 Score = 36.6 bits (83), Expect = 0.016,   Method: Compositional matrix adjust.
 Identities = 30/103 (29%), Positives = 51/103 (49%), Gaps = 6/103 (5%)

Query: 68  LVNAAVKGHGKIDSLVANAGVLEPVQNVNEIDVNAWKKLYDINFFSIVSLVGIALPELKK 127
           ++  A+   GKID L+ NAG+L  V + N++    ++ + D++      L   A P +K 
Sbjct: 85  IIKTAIDNFGKIDILINNAGILRDV-SFNKMSEKEFQAVIDVHLNGAFQLTHAAWPYMKA 143

Query: 128 TN-GNVVFVSSDACNMYFSSWGA--YGSSKAALNHFAMTLANE 167
              G ++  +S A    F ++G   Y ++K  L   A TLA E
Sbjct: 144 QKFGRIINTASPAG--LFGNFGQANYSAAKLGLVGLAETLAKE 184

>ABL163W [429] [Homologous to ScYNL202W (SPS19) - SH]
           complement(93017..93895) [879 bp, 292 aa]
          Length = 292

 Score = 44.7 bits (104), Expect = 3e-05,   Method: Compositional matrix adjust.
 Identities = 47/188 (25%), Positives = 86/188 (45%), Gaps = 10/188 (5%)

Query: 2   GKVILVTGVSRGIGKSIVDVLFSLDKDTVVYG--VARSEAPLKKLKEKYGDRFFYVVG-- 57
           GKV+ VTG +  I +   + +  L     + G  V +++    ++ E  GD    V+G  
Sbjct: 22  GKVVFVTGGAGTICRVQAEAMVLLGAKAAIIGRNVEKTKKAAAEIAE-LGDSADCVLGIG 80

Query: 58  --DITEDSVLKQLVNAAVKGHGKIDSLVANAGVLEPVQNVNEIDVNAWKKLYDINFFSIV 115
             D+ E + +K+ V   V   G+ID ++A A     + ++  +   A+K + DI+     
Sbjct: 81  GVDVREVADMKRAVEQTVAAFGRIDYVIAGA-AGNFLADMTNLSSRAFKTVLDIDLVGSY 139

Query: 116 SLVGIALPELKKTNGNVVFVSSDACNMYFSSWGAYGSSKAALNHFAMTLANE--ERQVKA 173
           + V   L EL K  G V+FVS+              ++KA ++  +  LA E     ++ 
Sbjct: 140 NTVKATLSELAKNKGAVLFVSATLHYTGTPLQAHVSAAKAGVDALSNVLAVELGPLGIRC 199

Query: 174 IAVAPGIV 181
             +APG++
Sbjct: 200 NCIAPGLI 207

>CAGL0H08063g 785331..786203 highly similar to sp|P32573
           Saccharomyces cerevisiae YNL202w SPS19, start by
           similarity
          Length = 290

 Score = 44.7 bits (104), Expect = 3e-05,   Method: Compositional matrix adjust.
 Identities = 34/127 (26%), Positives = 66/127 (51%), Gaps = 5/127 (3%)

Query: 58  DITEDSVLKQLVNAAVKGHGKIDSLVANAGVLEPVQNVNEIDVNAWKKLYDINFFSIVSL 117
           D+ E   L+  V   V  +G+ID ++A A     + + N +  NA+K +  I+     + 
Sbjct: 83  DVREVKQLESAVKRTVDRYGRIDYVIAGAAG-NFICDFNHLSANAFKSVVSIDLLGSFNT 141

Query: 118 VGIALPELKKTNGNVVFVSSDACNMYFSSWGAY-GSSKAALNHFAMTLANE--ERQVKAI 174
               +PEL K+ G+++FVS+   + Y   + ++ G++KA ++  +  LA E     V++ 
Sbjct: 142 AKATMPELIKSRGSILFVSA-TFHYYGVPFQSHVGAAKAGIDALSNALAVEMGPFGVRSN 200

Query: 175 AVAPGIV 181
            +APG +
Sbjct: 201 CIAPGAI 207

>Scas_613.18
          Length = 286

 Score = 43.5 bits (101), Expect = 6e-05,   Method: Compositional matrix adjust.
 Identities = 51/212 (24%), Positives = 90/212 (42%), Gaps = 24/212 (11%)

Query: 2   GKVILVTGVSRGIGKSIVDVLFSLDKDTVVYGVARSEAPLKKLKEKYG--DRFFYVVGDI 59
           G V LVTG S G+G  IV  L S     ++  +            ++G      Y   D+
Sbjct: 35  GSVALVTGGSSGLGLEIVKQLLSKRCTVIILDIYPPNI-------QFGADKALTYYKCDV 87

Query: 60  TEDSVLKQLVNAAVKGHGKIDSLVANAGV--LEPVQNVNEIDVNAWKKLYDINFFSIVSL 117
                +++      K H  I  L+ NAG+  L+P+   ++ +VN   K+ ++N+     L
Sbjct: 88  GSQEEIEKTYKRISKDHASIHILINNAGITCLKPITEFSKEEVN---KVINVNYLGACKL 144

Query: 118 VGIALPELKKTNGNVVFVSSDACNMYFSSWGAYGSSKAALNHFAMTL-----ANEERQVK 172
           + + L       G +V ++S    +  +   AYG+SK  L  F  +L          ++K
Sbjct: 145 MHLWLSA--NNEGFIVNIASVLGLITPARLAAYGASKGGLISFHQSLNLLLKKRTTNKIK 202

Query: 173 AIAVAPGIVDTDMQVNIRENVGPSSMSAEQLK 204
            + V  G + T M  ++     PS++ A  +K
Sbjct: 203 MLLVCTGKIRTKMFQSVD---SPSTLFAPDIK 231

>KLLA0C12694g 1077786..1078565 similar to sp|P35731 Saccharomyces
           cerevisiae YKL055c OAR1 putative 3-oxoacyl-(acyl carrier
           protein) reductase singleton, start by similarity
          Length = 259

 Score = 43.5 bits (101), Expect = 6e-05,   Method: Compositional matrix adjust.
 Identities = 52/219 (23%), Positives = 96/219 (43%), Gaps = 39/219 (17%)

Query: 4   VILVTGVSRGIGKSIVDVLFSLDKDTVVYGVARSEAPLK---KLKEKYGD---------- 50
           V +V+G +RGIG  I D L  L   +V+Y  +  ++ +K   ++K  +G           
Sbjct: 6   VSIVSGATRGIGSKIRDELL-LSGYSVIYIGSNDDSVVKNQPRIKLNHGQFAKGISINFK 64

Query: 51  -----------RFFYVVGDITEDSVLKQLVNAAVKGHGKIDSLVANAGVLEPVQNVNEID 99
                      +F    G I        L+    K   ++D LV  AG+ +    + + +
Sbjct: 65  GWPTWVDTTWSQFICRNGKIETKIESNDLMAGFDKKQYRLDLLVNCAGITQTTAAI-KAN 123

Query: 100 VNAWKKLYDINFFSIVSLVGIALPELKKTN------GNVVFVSS----DACNMYFSSWGA 149
            N    + ++NF S VSL  +AL ++ +        G +V ++S     + N+       
Sbjct: 124 TNEMADIMNVNFMSSVSLTQLALKQMIRNTKLHGHRGKIVNIASVLGDSSSNIIVPGTAM 183

Query: 150 YGSSKAALNHFAMTLANEERQ--VKAIAVAPGIVD-TDM 185
           Y +SKAA+  +   L+ E ++  +    ++PG+V+ TDM
Sbjct: 184 YSASKAAMIQYNRVLSEELKRLSIDVQTISPGLVESTDM 222

>Sklu_2267.5 YNL202W, Contig c2267 5903-6955
          Length = 350

 Score = 43.5 bits (101), Expect = 8e-05,   Method: Compositional matrix adjust.
 Identities = 46/187 (24%), Positives = 83/187 (44%), Gaps = 9/187 (4%)

Query: 2   GKVILVTGVSRGIGKSIVDVLFSLDKDTVVYGVARSEAPLKKLKE----KYGDRFFYVVG 57
           GKV+ VTG +  I +   + +  L     + G  + E  +K   E     +G     V G
Sbjct: 83  GKVLFVTGGAGTICRVQTEAMVLLGCKAAIVGRDK-EKTIKVAGEISQLGHGTSVLPVYG 141

Query: 58  -DITEDSVLKQLVNAAVKGHGKIDSLVANAGVLEPVQNVNEIDVNAWKKLYDINFFSIVS 116
            D+ +   L+  V+  V   G+ID ++A A     + +   +  NA+K +  I+     +
Sbjct: 142 VDVRDIKQLEDAVSQTVNEFGRIDFVIAGAAG-NFISDFTNLSSNAFKSVVSIDLLGSFN 200

Query: 117 LVGIALPELKKTNGNVVFVSSDACNMYFSSWGAYGSSKAALNHFAMTLANE--ERQVKAI 174
            V    P+LKK  G ++FVS+             G++KA ++  +  LA E     +++ 
Sbjct: 201 TVKACFPQLKKNKGAIIFVSATFHYYGVPFQSHVGAAKAGIDALSNALAVELGVLGIRSN 260

Query: 175 AVAPGIV 181
            +APG +
Sbjct: 261 CIAPGAI 267

>Scas_662.4
          Length = 307

 Score = 43.1 bits (100), Expect = 8e-05,   Method: Compositional matrix adjust.
 Identities = 53/198 (26%), Positives = 82/198 (41%), Gaps = 20/198 (10%)

Query: 3   KVILVTGVSRGIGKSIVDVLFSLDKDTVVYGVARSEAPLKKLKEKYGDRFFYVVG----- 57
           K  +VTG S GIG  I   L       +VY  AR   P+  L           +      
Sbjct: 10  KTAIVTGASSGIGYEITKEL--ARNGFIVYACARRLGPIDDLINDLAPELTTELAKAVIK 67

Query: 58  ----DITEDSVLKQLVNAAVK--GHGKIDSLVANAG--VLEPVQNVNEIDVNAWKKLYDI 109
               DI+++  +KQ      K   +GK+D L  NAG     P  +V     +  ++ + +
Sbjct: 68  PYQLDISKEDEVKQFRVFLEKELPNGKLDLLYNNAGQSCTFPALDVTN---DVMEQCFKV 124

Query: 110 NFFSIVSLVGIALPELKKTNGNVVFVSSDACNMYFSSWGAYGSSKAALNHFAMTLANEER 169
           N F  V++       L +  G +VF  S A    F     Y ++KAA++ +A  L  E +
Sbjct: 125 NVFGHVNMCRELASYLIQARGTIVFTGSLAGITPFPFGSIYSATKAAIHEYARVLHLEMK 184

Query: 170 Q--VKAIAVAPGIVDTDM 185
              V+ I V  G V T++
Sbjct: 185 PFGVRVINVVTGGVATNI 202

>CAGL0L02167g 253055..255760 highly similar to sp|Q02207
           Saccharomyces cerevisiae YKR009c FOX2
           hydratase-dehydrogenase-epimerase peroxisomal, start by
           similarity
          Length = 901

 Score = 43.5 bits (101), Expect = 9e-05,   Method: Compositional matrix adjust.
 Identities = 43/184 (23%), Positives = 80/184 (43%), Gaps = 15/184 (8%)

Query: 3   KVILVTGVSRGIGKSIVDVLFSLDKDTVVYGVARSEAPLKKLKEKYGD-RFFYVVGDITE 61
           KV+++TG   G+GKS            VV  +      + ++  KYG+ R      ++  
Sbjct: 324 KVVIITGAGGGLGKSHALWFAKYGARVVVNDIKDPNTVVNEINSKYGEGRAIPDTHNVVT 383

Query: 62  DSVLKQLVNAAVKGHGKIDSLVANAGVLEPVQNVNEIDVNAWKKLYDINFFSIVSLVGIA 121
           ++   Q++  A+K +G++D LV NAG+L     +   D   W  +  ++ +S   L    
Sbjct: 384 EA--NQVIETAMKAYGRVDVLVNNAGILRDRSFLKMTD-QEWFAVVQVHLYSTFLLSKAV 440

Query: 122 LPELKKTNGNVVFVSSDACNMYFSSWGAYGSSKAALNH-----FAMTLANE--ERQVKAI 174
            P   K  G  +  ++    +Y    G +G +  A        F+ T+A E  +R ++  
Sbjct: 441 WPIFLKQKGGHIINTTSTSGIY----GNFGQANYAAAKAAILGFSRTIAVEGAKRGIRVN 496

Query: 175 AVAP 178
            +AP
Sbjct: 497 IIAP 500

 Score = 40.8 bits (94), Expect = 7e-04,   Method: Compositional matrix adjust.
 Identities = 36/143 (25%), Positives = 71/143 (49%), Gaps = 12/143 (8%)

Query: 66  KQLVNAAVKGHGKIDSLVANAGVLEPVQNVNEIDVNAWKKLYDINFFSIVSLVGIALPEL 125
           +Q+V  A+K  G+ID L+ NAG+L  V +  ++    +  + D++      L   A P +
Sbjct: 81  EQIVETAIKAFGRIDILINNAGILRDV-SFAKMTEKEFSAVLDVHLTGAYRLTKAAWPYM 139

Query: 126 KKTN-GNVVFVSSDACNMYFSSWGA--YGSSKAALNHFAMTLANE--ERQVKAIAVAP-- 178
           ++   G ++  +S A    F ++G   Y ++K  L  FA TLA E  +  +   ++AP  
Sbjct: 140 RQQKFGRIINTASPAG--LFGNFGQANYSAAKLGLVGFAETLAKEGYKYNINVNSIAPLA 197

Query: 179 --GIVDTDMQVNIRENVGPSSMS 199
              + +  +  +I + +GP  ++
Sbjct: 198 RSRMTENVLPPHILKQLGPEKIA 220

>Sklu_268.1 , Contig c268 57-791 reverse complement
          Length = 244

 Score = 42.4 bits (98), Expect = 1e-04,   Method: Compositional matrix adjust.
 Identities = 60/196 (30%), Positives = 88/196 (44%), Gaps = 17/196 (8%)

Query: 5   ILVTGVSRGIGKSIVDVLFSLDKDTVVYGVARSEAPLKKLKEKYGDRFFYVVGDITEDSV 64
           ++VTG + GIGK+IV+    L +   V     +E  L  LKE   D     V D     V
Sbjct: 7   VIVTGAASGIGKAIVNQ--CLQEGASVIACDLNEQALLVLKESLNDS---TVLDTYPMDV 61

Query: 65  LKQLVNAAV-----KGHGKIDSLVANAGVLEPVQNVNEIDVNAWKKLYDIN---FFSIVS 116
            K    AA        H  +D LV NAG+    +++ +   +   K+ DIN   +     
Sbjct: 62  RKYEEVAAFFAYVETEHSDVDGLVNNAGIY-LAKHILDYQEDEIDKVLDINVKGYIYFSQ 120

Query: 117 LVGIALPELKKTNGNVVFVSSDACNMYFSSWGAYGSSKAALNHFAMTLA-NEERQVKAIA 175
           + G  L   ++  G +V +SS       SS   YGSSKAA+     + A N    ++  A
Sbjct: 121 MFGKKLFHSQR-KGVIVNLSS-VSGQEGSSDAIYGSSKAAILGLTKSCAMNFSPYIRVNA 178

Query: 176 VAPGIVDTDMQVNIRE 191
           VAP +V+T M  +I E
Sbjct: 179 VAPTMVNTSMMDSIPE 194

>Kwal_23.4572
          Length = 300

 Score = 42.4 bits (98), Expect = 1e-04,   Method: Compositional matrix adjust.
 Identities = 34/130 (26%), Positives = 69/130 (53%), Gaps = 9/130 (6%)

Query: 58  DITEDSVLKQLVNAAVKGHGKIDSLVANAG--VLEPVQNVNEIDVNAWKKLYDINFFSIV 115
           D+ E   L++ V   V+  G+ID ++A A    + P    +++  NA+K +  I+     
Sbjct: 93  DVREIEQLEEAVARTVERFGRIDFVIAGAAGNFIAPF---SKLSANAFKSVVSIDLLGSF 149

Query: 116 SLVGIALPELKKTNGNVVFVSSDACNMYFSSWGAY-GSSKAALNHFAMTLANE--ERQVK 172
           +     L EL++T G+++FVS+   + Y   + ++ G++KA ++  +  LA E     V+
Sbjct: 150 NTAKACLAELQRTKGSILFVSA-TFHYYGVPYQSHVGAAKAGVDALSNALAVELGVSGVR 208

Query: 173 AIAVAPGIVD 182
           +  +APG ++
Sbjct: 209 SNCIAPGAIE 218

>AAL089W [98] [Homologous to ScYOR246C - SH]
           complement(184564..185550) [987 bp, 328 aa]
          Length = 328

 Score = 42.4 bits (98), Expect = 2e-04,   Method: Compositional matrix adjust.
 Identities = 58/221 (26%), Positives = 92/221 (41%), Gaps = 51/221 (23%)

Query: 3   KVILVTGVSRGIGKSIVDVLFSLDKDTVVY----GVARSEAPLKKLKEKYGDRF------ 52
           KV LVTG + GIG   V  L+      +VY      +R    +K++K++  +R       
Sbjct: 20  KVALVTGGNSGIGWYTVLHLYM--HGFIVYVGGRNSSRVHKAIKEIKQEAENRLETARQD 77

Query: 53  ------------FYVVGDITEDSVLKQLVNAAVKGHGK---IDSLVANAGVLE-PVQNVN 96
                        Y+  D+T+   L+ +  AA K   +   +D L+ NAGV+  P     
Sbjct: 78  PHDELERCLGELRYLPIDLTD---LRSVEKAAKKFRAQESTLDVLINNAGVMALPY---- 130

Query: 97  EIDVNAWKKLYDINFFSIVSLVGIALPELKKTNGNVVFVSSDACNMYFS----------- 145
           E+  + ++     N+ S   L    LP +K++ G VV +SS    + F+           
Sbjct: 131 ELTHDGFEVQMQTNYVSHFLLTMRLLPYVKRSGGRVVTLSSIGHKIQFTYCPLDCHFDYR 190

Query: 146 -----SWGAYGSSKAALNHFAMTLANEERQVKAIAVAPGIV 181
                +W  Y  +K A   F   LA +   V  IAV PG+V
Sbjct: 191 PNIFFTWLRYAMAKTAAIQFTKMLAIKHPDVMCIAVHPGLV 231

>Kwal_14.1511
          Length = 277

 Score = 41.6 bits (96), Expect = 2e-04,   Method: Compositional matrix adjust.
 Identities = 56/211 (26%), Positives = 93/211 (44%), Gaps = 27/211 (12%)

Query: 1   MGKVILVTGVSRGIGKSI-VDVL---FSLDKDTVVYGVARSEAPLKKLKE-KYGDRF-FY 54
           M K IL+TG ++GIGK+I VD+    + L    +     +++A LK++KE + G +   +
Sbjct: 1   MPKTILITGAAQGIGKAIAVDLARKGYQLAIADLPQQNEKAQAVLKEIKELQSGVKAPIF 60

Query: 55  VVGDITEDSVLKQLVNAAVKGHGKIDSLVANAGVL----------EPVQNVNEIDVN--- 101
           +  D++    +  +V+      G  D ++ NAG+           E +  + +I+V    
Sbjct: 61  LPIDVSNKESVFGVVDKVASHFGAFDVMINNAGIAMVAKILEATPEELDRIMKINVGGVL 120

Query: 102 -----AWKKLYDINFFSIVSLVGIALPELKKTNGNVVFVSSDACNMYFSSWGAYGSSKAA 156
                A +K  ++N     +   +     KK  G ++   S A N    S G Y SSK A
Sbjct: 121 YGTQAATRKFVELNRAGDYTPATVKTAS-KKLTGKIINCCSIAGNEAIGSLGLYCSSKFA 179

Query: 157 LNHFAMTLANE--ERQVKAIAVAPGIVDTDM 185
           +       A E     +   A APGIV T M
Sbjct: 180 VKCLTQASAKELAPLGITVNAYAPGIVLTPM 210

>CAGL0J04774g join(452094..452179,452259..453189) similar to
           tr|Q06417 Saccharomyces cerevisiae YLR426w
          Length = 338

 Score = 42.0 bits (97), Expect = 2e-04,   Method: Compositional matrix adjust.
 Identities = 44/188 (23%), Positives = 86/188 (45%), Gaps = 11/188 (5%)

Query: 4   VILVTGVSRGIGKSIVDVLFSLDKDTVVYGVARSEAPLKKLKEKYGDRFFYVVGDITE-D 62
           ++L+TG S G+G+ I+  L     +  V  +   +  ++   E+   R   +  D+   D
Sbjct: 71  IVLITGGSNGLGRCIIHKLLRSYNNIKVINL---DLDVQYWSEE--ARVINIECDLVNAD 125

Query: 63  SVLKQLVNAAVKGHGKIDSLVANAGVLEPVQNVNEIDVNAWKKLYDINFFSIVSLVGIAL 122
            +   L    ++   KI+ L+ NAGV        +  ++  +++ +IN +S   ++   +
Sbjct: 126 GLELALKKIKLEYEDKINLLICNAGVRSRFNWFEDTPIDEMQRIMNINTWSTARILQAII 185

Query: 123 PELKKTNGNVVFVSSDACNMYFSSWGAYGSSKAALN--HFAMT---LANEERQVKAIAVA 177
           P   +    +V +SS    +  S   +Y +SKAA+   H +MT   L      ++ + V 
Sbjct: 186 PRDNQRQLYIVTISSVLGILAPSKVASYAASKAAITALHNSMTNDFLVRGIGNIRTLLVL 245

Query: 178 PGIVDTDM 185
           PG +DT M
Sbjct: 246 PGQIDTQM 253

>Kwal_26.7950
          Length = 897

 Score = 41.6 bits (96), Expect = 4e-04,   Method: Compositional matrix adjust.
 Identities = 34/145 (23%), Positives = 65/145 (44%), Gaps = 8/145 (5%)

Query: 2   GKVILVTGVSRGIGKSIVDVLFSLDKDTVVYGVARSEAPLKKLKEKYGDRFFYVVGDITE 61
           GKV+++TG   G+G+S            VV  +      + ++++ YG      V D  +
Sbjct: 324 GKVVIITGAGAGLGRSHALTFAKYGAKVVVNDIKDPHTVVSEIEKLYGRN--SAVAD--K 379

Query: 62  DSVLK---QLVNAAVKGHGKIDSLVANAGVLEPVQNVNEIDVNAWKKLYDINFFSIVSLV 118
             V+K   ++V +A +  G++D LV NAGVL   ++  ++    W+ +  ++ FS   L 
Sbjct: 380 HDVVKDPGEIVKSAFQTFGRVDILVNNAGVLRD-RSFAKMSDEEWEIVLKVHLFSTFGLC 438

Query: 119 GIALPELKKTNGNVVFVSSDACNMY 143
               P   K     +  ++    +Y
Sbjct: 439 KAVWPIFVKQKSGYIINTTSTSGIY 463

 Score = 39.7 bits (91), Expect = 0.002,   Method: Compositional matrix adjust.
 Identities = 44/180 (24%), Positives = 83/180 (46%), Gaps = 21/180 (11%)

Query: 3   KVILVTGVSRGIGKSIVDVLFSLDKDTVV------------YGVARSEAPLKKLKEKYGD 50
           +V+++TG   G+GK +  + F+     VV            +    ++  + +++EKY  
Sbjct: 11  RVVVITGAGGGLGK-VYALEFAKRGAKVVVNDLGGSLGGEGHNSRAADVVVSEIREKYKT 69

Query: 51  RFFYVVGDITEDSVLKQLVNAAVKGHGKIDSLVANAGVLEPVQNVNEIDVNAWKKLYDIN 110
           +       +TE++    +V  AV   G++D ++ NAG+L      N  D +A+  + D++
Sbjct: 70  QAAANYDSVTENAA--AIVQTAVDNFGRVDIIINNAGILRDSSFANMSD-SAFASVVDVH 126

Query: 111 FFSIVSLVGIALPELKKTN-GNVVFVSSDACNMYFSSWGA--YGSSKAALNHFAMTLANE 167
                +L   A P +K    G +V   S A    + ++G   Y ++K  L  F+ TLA E
Sbjct: 127 LTGAYNLTRAAWPHMKNQKFGRIVNTCSPAG--LYGNFGQANYSAAKMGLVGFSETLAQE 184

>YDL114W (YDL114W) [755] chr4 (255604..256530) Member of the
           short-chain dehydrogenase-reductase family, which are
           NAD- or NADP-dependent oxidoreductases, has low
           similarity to S. cerevisiae Ylr426p [927 bp, 308 aa]
          Length = 308

 Score = 40.8 bits (94), Expect = 5e-04,   Method: Compositional matrix adjust.
 Identities = 46/194 (23%), Positives = 89/194 (45%), Gaps = 15/194 (7%)

Query: 6   LVTGVSRGIGKSIVDVLFSLDKDTVVYGVARSEAPLKKLKEKYGDRFFYVVGDITEDSVL 65
           L+TG S G+G  +   L S   + V+    +S     +++  Y + F+Y   DIT    +
Sbjct: 42  LITGGSSGLGFELAKEL-SRRINKVIVADIQSFPTFAQVE--YNNIFYYQC-DITSLDEI 97

Query: 66  KQLVNAAVKGHGKIDSLVANAGVLEPVQNVNEIDVNAWKKLYDINFFSIVSLVG-IALPE 124
           K L  A  + HG I+ ++ NAGV   ++ +  +     ++L DIN      ++   A   
Sbjct: 98  KNLKKAIERDHGNINIIINNAGVAH-IKKLEHMTNKEVEQLIDINLIGAYRIISTFAEDM 156

Query: 125 LKKTNGNVVFVSSDACNMYFSSWGAYGSSKAALNHFAMTLANEERQ---------VKAIA 175
           +    G ++ ++S    +  +   +YG+SK A+  F   ++   R          +K + 
Sbjct: 157 IDNREGFIINIASVLGELTPARLTSYGASKGAMIGFHKCMSRHFRSLSTECNKTGIKTLL 216

Query: 176 VAPGIVDTDMQVNI 189
           V PG + T+M +++
Sbjct: 217 VCPGKIKTNMFIDV 230

>YKL055C (OAR1) [3204] chr11 complement(334966..335802)
           3-Oxoacyl-[acyl-carrier-protein] reductase [837 bp, 278
           aa]
          Length = 278

 Score = 40.0 bits (92), Expect = 8e-04,   Method: Compositional matrix adjust.
 Identities = 56/236 (23%), Positives = 95/236 (40%), Gaps = 51/236 (21%)

Query: 4   VILVTGVSRGIGKSIVDVLFSLDKDTVVYG-----VARSEAPLKKLK------------- 45
           V +VTG +RGIGK+I   LF      ++ G     + R+     +L+             
Sbjct: 6   VAIVTGATRGIGKAICQKLFQKGLSCIILGSTKESIERTAIDRGQLQSGLSYQRQCAIAI 65

Query: 46  --EKYGDRFFYVVGD----ITEDSVLKQLVNAAVKGHGK---------IDSLVANAGVLE 90
             +K+     Y   D      +   LKQ  +       K         ++ L+  AG+ +
Sbjct: 66  DFKKWPHWLDYESYDGIEYFKDRPPLKQKYSTLFDPCNKWSNNERRYYVNLLINCAGLTQ 125

Query: 91  PVQNVNEIDVNAWKKLYDINFFSIVSLVGIAL----------PEL--KKTNGNVVFVSS- 137
              +V     +  + + ++NF S V++  I +          PEL  +     +V +SS 
Sbjct: 126 ESLSV-RTTASQIQDIMNVNFMSPVTMTNICIKYMMKSQRRWPELSGQSARPTIVNISSI 184

Query: 138 -DACNMYFSSWGAYGSSKAALNHFAMTLAN--EERQVKAIAVAPGIVD-TDMQVNI 189
             +  M       Y +SKAAL+ F   LA   E R ++   ++PG+V  TDM  N+
Sbjct: 185 LHSGKMKVPGTSVYSASKAALSRFTEVLAAEMEPRNIRCFTISPGLVKGTDMIQNL 240

>Kwal_23.3107
          Length = 248

 Score = 39.3 bits (90), Expect = 0.001,   Method: Compositional matrix adjust.
 Identities = 44/191 (23%), Positives = 85/191 (44%), Gaps = 14/191 (7%)

Query: 2   GKVILVTGVSRGIGKSIVDVLFSLDKDTVVYGVARSEAPLKKLKE----KYGDRFFYVVG 57
           GKV L+TG ++ +G+     L S  K  +      ++   KKL +    KY  +     G
Sbjct: 5   GKVALITGGTKNLGRLTAIELASRHKANLFLHYNSTQGDEKKLADELSSKYNVKVELYQG 64

Query: 58  DITEDSVLKQLVNAAVKGHGKIDSLVANAG--VLEPVQNVNEIDVNAWKKLYD-INFFSI 114
           ++     +++L  AA    G ID  + N G  + +P+  V E + +    + + I FF I
Sbjct: 65  NLGSAKNVEKLFEAAKAKFGSIDIAINNVGKVLKKPMVEVTEEEFDEMDLVNNKIAFFFI 124

Query: 115 VSLVGIALPELKKTNGNVVFVSSDACNMYFSSWGAYGSSKAALNHFAMTLANE--ERQVK 172
                    +   + G+++ + +     Y   +  Y  +K+A+  +  + + E  E++V 
Sbjct: 125 AQAT-----KHVSSGGSIISLVTSLLAAYTPFYAVYQGTKSAVEFYTKSASKELIEKRVS 179

Query: 173 AIAVAPGIVDT 183
              +APG +DT
Sbjct: 180 VNCIAPGPMDT 190

>ADL292C [1449] [Homologous to ScYDL114W - SH] (189102..190091) [990
           bp, 329 aa]
          Length = 329

 Score = 38.9 bits (89), Expect = 0.002,   Method: Compositional matrix adjust.
 Identities = 51/221 (23%), Positives = 93/221 (42%), Gaps = 31/221 (14%)

Query: 4   VILVTGVSRGIGKSIVDVLFSLDKDTVVYGVARSEAPLKKLKEKYGDRFFYVVGDITEDS 63
           + LVTG + G+GK IV  L      TV+  V     P   L+   G  F+    DI+   
Sbjct: 62  IALVTGGAGGLGKEIVRELRRRQIVTVILDV----VPPPDLESLTGVHFY--ACDISLPG 115

Query: 64  VLKQLVNAAVKGHGKIDSLVANAGVLEPVQNVNEIDVNAWKKLYDINFFSIVSLVGIALP 123
            ++ +    ++  G +  L+ NA +   +  ++ +D +  +++  +N     +L+   LP
Sbjct: 116 RIRVIHENIIRDVGHVTILINNAAITSDLP-LDRVDNDKIEQIIRVNLLGPYTLIREFLP 174

Query: 124 ELKKTN-GNVVFVSSDACNMYFSSWGAYGSSKAALNHFAMTLANEERQ------------ 170
            +   + G +V ++S    +  +   AYG+SK  L     +L +E  Q            
Sbjct: 175 SMIAIDRGYIVNIASVLGFVTPARLTAYGASKGGLIALHESLVDELEQYTWKDSSNPGYV 234

Query: 171 --------VKAIAVAPGIVDTDMQVNIRENVGPSSMSAEQL 203
                   ++++ V PG + T M  N R    PS + A  L
Sbjct: 235 PLLKSRGVIRSLLVCPGKLTTKMFDNARS---PSKIIAPDL 272

>Scas_650.8
          Length = 326

 Score = 38.9 bits (89), Expect = 0.002,   Method: Compositional matrix adjust.
 Identities = 53/223 (23%), Positives = 88/223 (39%), Gaps = 54/223 (24%)

Query: 3   KVILVTGVSRGIGKSIVDVLFSLDKDTVVYGVARSEAPLKK--------------LKEKY 48
           KV ++TG + GIG   V  L+       VY   R+   +KK              L EK 
Sbjct: 17  KVAVITGGNSGIGWYTVLHLYM--HGFTVYLCGRTSHKIKKAINEITIEAEARLGLLEKE 74

Query: 49  GDRF---------FYVVGDITEDSVLKQLVNAAVKGHGKIDSLVANAGVL----EPVQNV 95
            D F          Y+  D+T+   +++     +K   KID L+ NA +L    E  ++ 
Sbjct: 75  VDDFGKDIHLGSLRYIHMDLTDLKCVEKAAQKLLKLEDKIDVLINNAAILAIPYELTKDG 134

Query: 96  NEIDVNAWKKLYDINFFSIVSLVGIALPELKKTNGNVVFVSSDAC--------------- 140
            EI +         N+ +   L    LP +KK +G ++ + S                  
Sbjct: 135 FEIQLQT-------NYIAHFLLTMRLLPAIKKCHGRIITLGSLGHRLEVTYWNLNKKWDY 187

Query: 141 --NMYFSSWGAYGSSKAALNHFAMTLANEERQVKAIAVAPGIV 181
             NM F +W  Y  +K A   +   L+ +  +V  +++ PG+V
Sbjct: 188 KPNMIF-TWFRYAVAKTASIQYTKMLSIKYPEVLCLSLHPGLV 229

>YBR265W (TSC10) [445] chr2 (738539..739501) 3-Ketosphinganine
           reductase, catalyzes the second step in the synthesis of
           phytosphingosine [963 bp, 320 aa]
          Length = 320

 Score = 38.1 bits (87), Expect = 0.004,   Method: Compositional matrix adjust.
 Identities = 50/212 (23%), Positives = 90/212 (42%), Gaps = 35/212 (16%)

Query: 3   KVILVTGVSRGIGKSIVDVLFSLDKDTVVYGVARSEAPL----------KKLKEKYGD-- 50
           +V+L+TG S+G+GK      ++  ++T +  V+RSEA L            L+ +  D  
Sbjct: 8   QVVLITGGSQGLGKEFAKKYYNEAENTKIIIVSRSEARLLDTCNEIRIEAHLRRETTDEG 67

Query: 51  --------------RFFYVVGDITEDSVLKQLVNAAVKGHGKIDSLVANAGVLEP--VQN 94
                         R FY   D++    ++ L NA           +  AG   P   + 
Sbjct: 68  QVQHKLAAPLDLEQRLFYYPCDLSCYESVECLFNALRDLDLLPTQTLCCAGGAVPKLFRG 127

Query: 95  VNEIDVNAWKKLYDINFFSIVSLVG-IALPELKKTNGNVVFVSSDACNMY-FSSWGAYGS 152
           ++  ++N      DIN+ + +++   IAL E  K +  ++F S+ A  +Y F  +  Y  
Sbjct: 128 LSGHELNLG---MDINYKTTLNVAHQIALAEQTKEHHLIIFSSATA--LYPFVGYSQYAP 182

Query: 153 SKAALNHFAMTLANEERQVKAIAVAPGIVDTD 184
           +KAA+      L  E    +   V PG  +++
Sbjct: 183 AKAAIKSLVAILRQELTNFRISCVYPGNFESE 214

>YOR246C (YOR246C) [5035] chr15 complement(795801..796793) Member of
           the short-chain dehydrogenase-reductase family, which
           are NAD- or NADP-dependent oxidoreductases, has low
           similarity to a region of WW domain-containing
           oxidoreductase (mouse Wwox), which is an apoptosis
           activator [993 bp, 330 aa]
          Length = 330

 Score = 37.7 bits (86), Expect = 0.006,   Method: Compositional matrix adjust.
 Identities = 35/145 (24%), Positives = 61/145 (42%), Gaps = 21/145 (14%)

Query: 54  YVVGDITEDSVLKQLVNAAVKGHGKIDSLVANAGVLE-PVQNVNEIDVNAWKKLYDINFF 112
           Y+  D+T+   +++     +K    ID LV NAG++  P+    E+  + ++     N+ 
Sbjct: 93  YIHLDLTDLKCVERAALKILKLEDHIDVLVNNAGIMAVPL----EMTKDGFEVQLQTNYI 148

Query: 113 SIVSLVGIALPELKKTNGNVVFVSSDACNMYFS----------------SWGAYGSSKAA 156
           S        LP L+   G ++ +SS   ++ F                 +W  Y  SK A
Sbjct: 149 SHFIFTMRLLPLLRHCRGRIISLSSIGHHLEFMYWKLSKTWDYKPNMLFTWFRYAMSKTA 208

Query: 157 LNHFAMTLANEERQVKAIAVAPGIV 181
           L      LA +   V  ++V PG+V
Sbjct: 209 LIQCTKMLAIKYPDVLCLSVHPGLV 233

>AER111W [2616] [Homologous to ScYLR426W - SH]
           complement(846805..846884,846937..847840) [984 bp, 327
           aa]
          Length = 327

 Score = 37.4 bits (85), Expect = 0.007,   Method: Compositional matrix adjust.
 Identities = 37/195 (18%), Positives = 79/195 (40%), Gaps = 26/195 (13%)

Query: 51  RFFYVVGDITEDSVLKQLVNAAVKGHGKIDSLVANAGVLEPVQNVNEIDVNAWKKLYDIN 110
           R  ++  D+++ + +++++    + + ++D L+  AG+    Q +  +      K + +N
Sbjct: 114 RVRFLRADLSKPADVERVLEQVTREYSRVDVLINCAGMRSRYQGLQAVAPEELHKTFQVN 173

Query: 111 FFSIVSLVGIALPELKKTNGNVVFVSSDACNMYFSSWGAYGSSKAAL----NHFAMTLAN 166
            F+    +    P        +V V S    +  +   AY ++KAA     + +   L +
Sbjct: 174 VFAPQRFIQKLAPR-DDRQFYLVTVGSTLGILAPARLSAYAATKAATIAYHDSWTFELLS 232

Query: 167 EERQ-VKAIAVAPGIVDTDMQVNIRENVGPSSMSAEQLKMFRGLKENNQLLDSSVPATVY 225
             RQ V+ + V  G +DT                    +MF+G +   Q L   + +   
Sbjct: 233 SGRQRVRTLLVVLGQMDT--------------------RMFQGFRPPRQFLAPVLESEEL 272

Query: 226 AKLALHGIPDGVNGQ 240
           A+  +H    G+ GQ
Sbjct: 273 ARRIVHCCSIGMRGQ 287

>YLR426W (YLR426W) [3802] chr12 (987058..987137,987209..988109)
           Member of the short chain alcohol dehydrogenase/ribitol
           dehydrogenase family [981 bp, 326 aa]
          Length = 326

 Score = 37.4 bits (85), Expect = 0.008,   Method: Compositional matrix adjust.
 Identities = 40/189 (21%), Positives = 88/189 (46%), Gaps = 13/189 (6%)

Query: 4   VILVTGVSRGIGKSIVDVLFSLDKDTVVYGVARSEAPLKKLKEKYGDRFFYVVGDITEDS 63
           ++L+TG S+G+G++IV  L     +  +  V    + ++  + K       ++ D+++D 
Sbjct: 72  IVLITGGSKGLGRAIVSQLLQDYSNLTILNVDICPSSVRNTRVK------DLICDLSDDE 125

Query: 64  VLKQLVNAAVKGH-GKIDSLVANAGVLEPVQNVNEIDVNAWKKLYDINFFSIVSLVGIAL 122
            +  L+N   + +  +I  +V NAGV       N ++ +   K++ IN F+ +  +    
Sbjct: 126 EVAALLNLLKRKYKNEIRLIVNNAGVRANFTGFNGMERDNLDKIFKINTFAPLQFIQELA 185

Query: 123 PELKKTNG----NVVFVSSDACNMYFSSWGAYGSSKAALNH-FAMTLANE-ERQVKAIAV 176
           P    T      N+  +         +++ A  ++  A +  ++  L NE  R ++ + V
Sbjct: 186 PSRHSTRQCYIVNIASILGILTPAKVAAYAASKAALIAFHQSYSFELQNEGVRNIRTLLV 245

Query: 177 APGIVDTDM 185
            PG ++T+M
Sbjct: 246 TPGQLNTEM 254

>Kwal_55.21822
          Length = 283

 Score = 37.0 bits (84), Expect = 0.010,   Method: Compositional matrix adjust.
 Identities = 48/199 (24%), Positives = 85/199 (42%), Gaps = 16/199 (8%)

Query: 2   GKVILVTGVSRGIGKSIVDVLFSLDKDTVVYGVARSEAP--LKKLKEKYGDRFFYVVGDI 59
           GKV  VTG S GIG  +         D  ++  +       + ++ EKYG +       +
Sbjct: 30  GKVAAVTGASSGIGYDVAVAFAQAGADVAMWYNSNPHITELVGEISEKYGVKVKAYKCSV 89

Query: 60  TEDSVLKQLVNAAVKGH-GKIDSLVANAGV-------LEPVQNVNEIDVNAWKKLYDINF 111
           T    +   ++   K   GKID +V NAGV       ++ V+   E     W K+ D++ 
Sbjct: 90  TSSKDVASTIDQIKKDFGGKIDIMVGNAGVAWSEGPLIDLVEKDEEKCDAEWNKVIDVDL 149

Query: 112 FSIVSLVGIALPELKKTNGNVVFVSSDACNMYF----SSWGAYGSSKAALNHFAMTLANE 167
             I   V   +  + K  G+  F+ + + + +         AY ++KA + H + +LA E
Sbjct: 150 NGIYR-VAKNIGRVFKEQGHGSFIITASMSGHVVNVPQMQTAYNAAKAGVLHMSKSLAVE 208

Query: 168 ERQVKAI-AVAPGIVDTDM 185
                 +  V+PG + T++
Sbjct: 209 WAGFARVNTVSPGYIATEI 227

>Scas_655.19
          Length = 297

 Score = 36.6 bits (83), Expect = 0.011,   Method: Compositional matrix adjust.
 Identities = 36/131 (27%), Positives = 59/131 (45%), Gaps = 13/131 (9%)

Query: 58  DITEDSVLKQLVNAAVKGHGKIDSLVANAGVLEPVQNVNEIDVNAWKKLYDINFFSIVSL 117
           D+     LK  V   V   G ID L+A A     + +   +  NA+K + DI+     + 
Sbjct: 90  DVRNFDQLKNAVKKTVDTFGHIDYLIAGAAG-NFICDFMNLSPNAFKSVIDIDLLGSFNT 148

Query: 118 VGIALPELKKTNGNVVFVSSDACNMYFSSWGA-----YGSSKAALNHFAMTLANE--ERQ 170
           V     +L K  G+V+FVS+      F  +G       G++KA ++  +  LA E     
Sbjct: 149 VKACASQLIKNKGSVLFVSAT-----FHYYGVPFQLHVGAAKAGIDALSNNLAVELGPLG 203

Query: 171 VKAIAVAPGIV 181
           V++  +APG +
Sbjct: 204 VRSNCIAPGAI 214

>Sklu_1570.1 YKR009C, Contig c1570 100-2370
          Length = 756

 Score = 37.0 bits (84), Expect = 0.012,   Method: Compositional matrix adjust.
 Identities = 32/146 (21%), Positives = 58/146 (39%), Gaps = 12/146 (8%)

Query: 3   KVILVTGVSRGIGKSIVDVLFSLDKDTVVYGVARSEAPLKKLKEKYGDRFFYVVGDITED 62
           K+++VTG   G+G+S            VV  +   E  + ++ + YG       G    D
Sbjct: 185 KIVIVTGAGGGLGRSHALWFAKYGAKVVVNDIKAPEPVVDEINKIYGG------GSAIPD 238

Query: 63  -----SVLKQLVNAAVKGHGKIDSLVANAGVLEPVQNVNEIDVNAWKKLYDINFFSIVSL 117
                +   ++V  A++  G++D LV NAG+L     +   D   W  +  ++ FS   L
Sbjct: 239 KHDVVTQPTEIVKTALEAFGRVDVLVNNAGILRDRSFLKMTD-EEWYAVLKVHLFSTYGL 297

Query: 118 VGIALPELKKTNGNVVFVSSDACNMY 143
                P   K     +  ++    +Y
Sbjct: 298 SKAVWPVFLKQRSGYIINTTSTSGIY 323

>Scas_721.47
          Length = 344

 Score = 36.2 bits (82), Expect = 0.017,   Method: Compositional matrix adjust.
 Identities = 51/182 (28%), Positives = 82/182 (45%), Gaps = 22/182 (12%)

Query: 2   GKVILVTGVSRGIGKSIVDVLFSLDKDTVVYGVARSEAPLKKLKE----KYGDRFFYVVG 57
           GK  +VTG S GIGK   + + +   + V+  ++R+ + L+ LKE    KYG +   +  
Sbjct: 62  GKYCVVTGASDGIGKEFANQMAARGFNLVL--ISRTLSKLEALKEEFEKKYGIKVEILAI 119

Query: 58  DITEDSVLKQLVNAAVKGHGK---IDSLVANAGVLE--PVQNVNEIDVNAWKKLYDINFF 112
           DI+ DS   Q     +KG  K   I  L+ N G     PV  + E +    + +  IN  
Sbjct: 120 DISSDS---QDNYEFIKGLCKDLPITVLINNVGQSHSIPVPFL-ETEEEELRNIITINNT 175

Query: 113 SIVSLVGIALP-------ELKKTNGNVVFVSSDACNMYFSSWGAYGSSKAALNHFAMTLA 165
           + + +  I  P       E KK+ G ++ + S    +       Y  SKA L  ++ +LA
Sbjct: 176 ATLLITQIIAPIISKTVKETKKSRGLILTMGSFGGLIPTPLLATYSGSKAFLQQWSTSLA 235

Query: 166 NE 167
            E
Sbjct: 236 GE 237

>Kwal_26.8282
          Length = 298

 Score = 36.2 bits (82), Expect = 0.018,   Method: Compositional matrix adjust.
 Identities = 51/234 (21%), Positives = 95/234 (40%), Gaps = 49/234 (20%)

Query: 4   VILVTGVSRGIGKSIVDVL-------FSLDKDTVVYGVARSEAPLKKLKEKYGDRFFYVV 56
           V LVTG +RGIG++IVD L         +      +   R   P  + K ++       +
Sbjct: 37  VALVTGATRGIGRAIVDKLADKGVSCLMIGSQMTSFDRMRKRPPKIRNKHQWHRALAIDL 96

Query: 57  GDITEDSVLKQLVNAAVKGHGKIDS-----------------------LVANAGVLE--P 91
           G   + +  +Q V   V  +G +                         LV  AG+ +  P
Sbjct: 97  GKWPQWT--EQDVYTGVHFNGSMHEQLYAQEANQWSLFDIPDTHDIALLVNCAGITQASP 154

Query: 92  VQNVNEIDVNAWKKLYDINFFSIVSLVGIALPELKKTNGN------VVFVSS---DACNM 142
               +  D+    ++ +IN+ S V+L  ++  ++ ++  +      ++ VSS   D    
Sbjct: 155 ALRCSPEDI---LRITNINYMSAVTLCSLSAKKMLRSRKHLATPPCIINVSSILGDPKTP 211

Query: 143 YFSSWGAYGSSKAALNHFAMTLANE--ERQVKAIAVAPGIV-DTDMQVNIRENV 193
                  Y +SKAAL  ++  L+ E     ++  +++P +V DTDM   + + V
Sbjct: 212 PLPGTALYSASKAALTQYSRVLSEELARSGIQVHSLSPSLVSDTDMIRTLEDTV 265

>Scas_652.19d
          Length = 341

 Score = 34.7 bits (78), Expect = 0.050,   Method: Compositional matrix adjust.
 Identities = 54/222 (24%), Positives = 92/222 (41%), Gaps = 40/222 (18%)

Query: 3   KVILVTGVSRGIGKSIVDVLFSLDKD--TVVYGVARSEAPLKKLKEKYGDR--FFYVVG- 57
           K  L+TG + GIG  ++ +L+S + +   VV    + EA  K+  EKY +      VVG 
Sbjct: 42  KTALITGTNTGIGFEVMKLLYSKNCNIIAVVRSAEKGEAAKKEAIEKYPNSKGSISVVGG 101

Query: 58  -DITEDSVLKQLVNAA--VKGHGKIDSLVANAGVLEPVQNVNEIDVNAWKKLYDINFFSI 114
            D  + + +K        V G   ++ ++ NAG++ PV           + ++  N    
Sbjct: 102 NDFLDLTTVKPASEEIKLVLGDKPLNIIIHNAGLMAPVN--TGTSKQGLEAMFSTNVLGP 159

Query: 115 VSLVGIALPELKKTNGN---VVFVSS----DACNMYFSSWG-----------------AY 150
             L     P   K + +   +V+VSS    +AC  Y   W                   Y
Sbjct: 160 QLLQHFLDPLFLKKDDDLKRIVWVSSGAHANACFDYGIHWDDPTYEKCTIAERPSPYELY 219

Query: 151 GSSKAALNHFAMTLANEERQV------KAIAVAPGIVDTDMQ 186
           G SKAA  + A   A + +++       +++  PG + TD+Q
Sbjct: 220 GQSKAANIYQAKAWATKNKEIVDEIGCVSVSCYPGNLKTDLQ 261

>CAGL0K09152g 909456..910439 highly similar to tr|Q08651
           Saccharomyces cerevisiae YOR246c, hypothetical start
          Length = 327

 Score = 32.3 bits (72), Expect = 0.30,   Method: Compositional matrix adjust.
 Identities = 53/218 (24%), Positives = 89/218 (40%), Gaps = 44/218 (20%)

Query: 3   KVILVTGVSRGIGKSIVDVLF------------------SLDKDTVVYGVARSEAPLKKL 44
           +V +VTG + GIG   V  L+                  ++D D +   V R    LK L
Sbjct: 18  RVAVVTGGNSGIGWFTVLHLYMHGFRVYVCGRNSHKVSRAMD-DIIEEAVRRHNLYLKGL 76

Query: 45  KEKYGDRFF----YVVGDITEDSVLKQLVNAAVKGHGKIDSLVANAGVLE-PVQNVNEID 99
            ++   R+     Y+  D+T+   + +     ++    +D LV NAGV+  P     EI 
Sbjct: 77  HDQKPTRYLGSLQYLHTDLTDLKCVDRAAAKILRMENHLDVLVNNAGVMAVPY----EIT 132

Query: 100 VNAWKKLYDINFFSIVSLVGIALPELKKTNGNVVFVSS------------DACNMYFS-- 145
            + ++     N+ +   L    LP L+ ++G VV +SS            D    YF   
Sbjct: 133 KDGFEIQMQTNYIAHFLLTMRLLPLLRCSHGRVVTLSSLGHHIIFKYSKLDETWNYFPNF 192

Query: 146 --SWGAYGSSKAALNHFAMTLANEERQVKAIAVAPGIV 181
             +W  Y  +K A   +   LA +   +  ++V PG+V
Sbjct: 193 VFTWFRYAMTKVASIQYTKMLAIKNPDILFVSVHPGLV 230

>Scas_652.19d1
          Length = 344

 Score = 32.0 bits (71), Expect = 0.44,   Method: Compositional matrix adjust.
 Identities = 17/45 (37%), Positives = 30/45 (66%), Gaps = 2/45 (4%)

Query: 3  KVILVTGVSRGIGKSIVDVLFSLDKDTVVYGVARSEAPLKKLKEK 47
          K  +VTG + GIGK +V++L+   K+  V GV R++A  ++ K++
Sbjct: 42 KTAVVTGCNTGIGKHVVELLYQ--KNCNVIGVVRTDAKGEEAKKE 84

>YGR194C (XKS1) [2144] chr7 complement(886076..887878) Xylulokinase,
           required for growth on D-xylulose [1803 bp, 600 aa]
          Length = 600

 Score = 31.6 bits (70), Expect = 0.62,   Method: Compositional matrix adjust.
 Identities = 38/143 (26%), Positives = 61/143 (42%), Gaps = 20/143 (13%)

Query: 25  LDKDTVVYGVARSEAPLKKLKEKYGDRFFYVVGDITEDSVLKQL--VNAAVKGHGKIDSL 82
           L++DT+V      E+PL+    K  +R F+V G    D+++K+   V  A KG+ ++++ 
Sbjct: 474 LNEDTIV-KFDYDESPLRDYLNKRPERTFFVGGASKNDAIVKKFAQVIGATKGNFRLET- 531

Query: 83  VANAGVLEPVQNVNEIDVNAWKKLYDINFFSIVSLVGIALPELKKTNGNVVF-VSSDACN 141
             N+  L             W  LYD N         IA+P  K  N N  + V     +
Sbjct: 532 -PNSCALGGCYKA------MWSLLYDSN--------KIAVPFDKFLNDNFPWHVMESISD 576

Query: 142 MYFSSWGAYGSSKAALNHFAMTL 164
           +   +W  Y S    L+    TL
Sbjct: 577 VDNENWDRYNSKIVPLSELEKTL 599

>CAGL0J05852g complement(554403..555434) weakly similar to
          sp|P40580 Saccharomyces cerevisiae YIR036, hypothetical
          start
          Length = 343

 Score = 30.4 bits (67), Expect = 1.2,   Method: Compositional matrix adjust.
 Identities = 15/38 (39%), Positives = 23/38 (60%), Gaps = 2/38 (5%)

Query: 2  GKVILVTGVSRGIGKSIVDVLFSLDKDTVVYGVARSEA 39
          GK  +VTG + G+GK    +L+   K+  V GV R+E+
Sbjct: 41 GKTAVVTGCNTGVGKEAAKLLY--QKNCNVIGVCRTES 76

>Sklu_1624.3 YBR265W, Contig c1624 1338-2288
          Length = 316

 Score = 29.6 bits (65), Expect = 2.1,   Method: Compositional matrix adjust.
 Identities = 38/199 (19%), Positives = 80/199 (40%), Gaps = 19/199 (9%)

Query: 3   KVILVTGVSRGIGKSIVDVLFSLDKDTVVYGVARSEAPL-KKLKEKYGD----------- 50
           + +LV G S+G+GK      F+      V  V+RS A L   +K+  G            
Sbjct: 12  QTLLVAGGSQGLGKQFACKYFAEGTANTVIVVSRSAAKLAAAVKDITGQDAQELTVDLEF 71

Query: 51  -----RFFYVVGDITEDSVLKQLVNAAVKGHGKIDSLVANAGVLEPVQNVNEIDVNAWKK 105
                  FY+  D+++    +++    ++ +     ++  AG   P +   ++  +    
Sbjct: 72  DSKERNMFYIPCDLSDYHATEKMYELLLERNLSPTQVMLCAGGSTP-KLFKDLTGDELVT 130

Query: 106 LYDINFFSIVSLVGIALPELKKTNGNVVFVSSDACNMYFSSWGAYGSSKAALNHFAMTLA 165
              +N+ + ++L  + L     +  +V+F SS+     F  +  Y   K ++    M L 
Sbjct: 131 GVQVNYMTCLNLAHV-LARKHSSLPHVIFFSSETAFFPFIGYSQYAPMKQSIKALVMILR 189

Query: 166 NEERQVKAIAVAPGIVDTD 184
            E  + +   V PG  +++
Sbjct: 190 QEFPESRISCVYPGNFESE 208

>AEL164C [2342] [Homologous to ScYBR265W (TSC10) - SH]
          (326834..327757) [924 bp, 307 aa]
          Length = 307

 Score = 29.6 bits (65), Expect = 2.2,   Method: Compositional matrix adjust.
 Identities = 15/45 (33%), Positives = 27/45 (60%), Gaps = 1/45 (2%)

Query: 2  GKVILVTGVSRGIGKSIVDVLFSLDKDTVVYGVARSEAPLKKLKE 46
          G+V+L++G S+G+G++        + D+ V  V+RSE  L +  E
Sbjct: 7  GQVVLISGGSQGLGRAFAQKYIE-ESDSTVVIVSRSEEKLTRAGE 50

>Scas_454.2
          Length = 1251

 Score = 29.6 bits (65), Expect = 2.5,   Method: Composition-based stats.
 Identities = 18/47 (38%), Positives = 29/47 (61%), Gaps = 7/47 (14%)

Query: 196 SSMSAEQLKMFRGLKENNQLLDSSVPATVYAKLALHGIPDGVNGQYL 242
           SS+++ + + F+GLK++N+LL  S     Y  L L+     VNGQY+
Sbjct: 254 SSLTSLKAESFKGLKKSNELLKKS--GIDYNMLGLY-----VNGQYM 293

>YML131W (YML131W) [3841] chr13 (10199..11296) Putative
           NAD-dependent oxidoreductase [1098 bp, 365 aa]
          Length = 365

 Score = 29.3 bits (64), Expect = 3.1,   Method: Compositional matrix adjust.
 Identities = 26/91 (28%), Positives = 42/91 (46%), Gaps = 6/91 (6%)

Query: 2   GKVILVTGVSRGIGKSIVDVLFSLDKDTVVYGVARSEAPLKKLKEKYGDRFFYVVGDITE 61
           GKV L++G +  +G   + +  ++ K + V  +A     +    E +GD    VVG   +
Sbjct: 166 GKVYLISGAAGAVGTVCIQLALNVFKASKVIAIAGGPEKVA-FVESFGDN---VVGVDYK 221

Query: 62  DSVLKQLVNAAVKGHGKIDSLVANAG--VLE 90
           D   KQ +  A  G   +D  + N G  VLE
Sbjct: 222 DPSFKQKLIEAAGGENTVDYFIDNVGSNVLE 252

>Kwal_27.12155
          Length = 280

 Score = 28.5 bits (62), Expect = 4.6,   Method: Compositional matrix adjust.
 Identities = 24/91 (26%), Positives = 39/91 (42%), Gaps = 6/91 (6%)

Query: 2   GKVILVTGVSRGIGKSIVDVLFSLDKDTVVYGVARSEAPL----KKLKEKYGDRFFYVVG 57
           GKV  ++G S GIG ++ +       D  V+    S   L    + L   Y  R      
Sbjct: 30  GKVACISGASSGIGAAVAEAFAQAGADLAVW--YNSHPALVETARDLANTYHVRVVAYKC 87

Query: 58  DITEDSVLKQLVNAAVKGHGKIDSLVANAGV 88
            + ++  ++  +   +   G+ID  VANAGV
Sbjct: 88  PVDDEQQVQATIARVITEFGRIDVFVANAGV 118

>Kwal_27.11767
          Length = 190

 Score = 28.5 bits (62), Expect = 4.6,   Method: Compositional matrix adjust.
 Identities = 16/60 (26%), Positives = 26/60 (43%)

Query: 134 FVSSDACNMYFSSWGAYGSSKAALNHFAMTLANEERQVKAIAVAPGIVDTDMQVNIRENV 193
           F+  D  N  F SW   G     ++  ++ L      +K +AV+       M V+I EN+
Sbjct: 91  FMGPDFFNDSFPSWNKSGLKHVTMDQLSLFLYQTLTGIKFVAVSTQSTTNAMAVSIAENL 150

>YBR159W (YBR159W) [344] chr2 (558641..559684) Major 3-ketoreductase
           of the fatty acid elongase system involved in synthesis
           of very long chain fatty acids [1044 bp, 347 aa]
          Length = 347

 Score = 28.5 bits (62), Expect = 5.8,   Method: Compositional matrix adjust.
 Identities = 20/65 (30%), Positives = 34/65 (52%), Gaps = 6/65 (9%)

Query: 2   GKVILVTGVSRGIGKSIVDVLFSLDKDTVVYGVARSEAPLKKLKEKYGDRFFYVVG---- 57
           GK   +TG S GIGK     +     + V+  ++R+++ L+ L+++  D+   VV     
Sbjct: 62  GKYCAITGASDGIGKEFARQMAKRGFNLVL--ISRTQSKLEALQKELEDQHHVVVKILAI 119

Query: 58  DITED 62
           DI ED
Sbjct: 120 DIAED 124

>ADR059C [1800] [Homologous to ScYBR159W - SH] (811943..812998)
           [1056 bp, 351 aa]
          Length = 351

 Score = 28.1 bits (61), Expect = 6.6,   Method: Compositional matrix adjust.
 Identities = 21/46 (45%), Positives = 26/46 (56%), Gaps = 2/46 (4%)

Query: 2   GKVILVTGVSRGIGKSIVDVLFSLDKDTVVYGVARSEAPLKKLKEK 47
           G   LVTG S GIGK     L S  K   V  V+R+EA L +LK++
Sbjct: 68  GAYALVTGASDGIGKEFALQLAS--KGFNVLLVSRTEAKLLELKQE 111

>Kwal_23.3485
          Length = 688

 Score = 28.1 bits (61), Expect = 9.1,   Method: Compositional matrix adjust.
 Identities = 13/35 (37%), Positives = 20/35 (57%)

Query: 44  LKEKYGDRFFYVVGDITEDSVLKQLVNAAVKGHGK 78
           L + Y    F + G+ +EDS L+++VNA     GK
Sbjct: 384 LSDPYCSAVFILTGNTSEDSALERIVNARQNFKGK 418

>AGR014W [4324] [Homologous to ScYMR077C (VPS20) - NSH]
           complement(742013..742672) [660 bp, 219 aa]
          Length = 219

 Score = 27.7 bits (60), Expect = 9.1,   Method: Compositional matrix adjust.
 Identities = 31/113 (27%), Positives = 48/113 (42%), Gaps = 18/113 (15%)

Query: 18  IVDVLFSLDKDTVVYGVARSEAPLKKLKEKYGDRFFYVVGDITEDSVLKQLVNAAVKGHG 77
           ++ + F L +   V G+AR    LKKL     +R F  V  + +D      V   V    
Sbjct: 90  VMTIEFKLVEKQFVEGLARGNEVLKKL-----NREFSGVEQLMDD------VAEQVAYQE 138

Query: 78  KIDSLVANAGVLEPVQNVNEIDVNAWKKLYDINFFSIVSLVGIALPELKKTNG 130
           +ID L++N  +       +E+D    +   ++N          ALPEL  TNG
Sbjct: 139 EIDQLLSNGPMSAGYGLQDELDRELEQLEQEVNAQE-------ALPELPSTNG 184

>Scas_717.60
          Length = 3259

 Score = 28.1 bits (61), Expect = 9.5,   Method: Composition-based stats.
 Identities = 22/104 (21%), Positives = 50/104 (48%), Gaps = 21/104 (20%)

Query: 43  KLKEKYGDRFFYVVGDITEDSVLKQLVNAAVKGHGKIDSLVANAGVLEPVQNVNEIDVNA 102
           ++ E+Y  RFFYV+ +I +  +L +             SL+A AG++  + ++  I +N 
Sbjct: 394 QINEEYNVRFFYVISNIADVKMLHE-------------SLLA-AGLIPALLDIISIKMNN 439

Query: 103 WKKLYDINFFSIVSLVGIALPELKKTNGNVVFVSSDACNMYFSS 146
            ++       ++ S   +    ++ T+    F+S++  N+  +S
Sbjct: 440 RRR-------TLASATHLLESFIRNTDSTAEFISNNGFNILINS 476

  Database: blastdb
    Posted date:  Apr 3, 2006  3:33 PM
  Number of letters in database: 16,596,109
  Number of sequences in database:  34,618
  
Lambda     K      H
   0.316    0.134    0.376 

Gapped
Lambda     K      H
   0.267   0.0410    0.140 

Matrix: BLOSUM62
Gap Penalties: Existence: 11, Extension: 1
Number of Sequences: 34618
Number of Hits to DB: 7,941,695
Number of extensions: 328141
Number of successful extensions: 1107
Number of sequences better than 10.0: 101
Number of HSP's gapped: 1030
Number of HSP's successfully gapped: 108
Length of query: 250
Length of database: 16,596,109
Length adjustment: 99
Effective length of query: 151
Effective length of database: 13,168,927
Effective search space: 1988507977
Effective search space used: 1988507977
Neighboring words threshold: 11
Window for multiple hits: 40
X1: 16 ( 7.3 bits)
X2: 38 (14.6 bits)
X3: 64 (24.7 bits)
S1: 41 (21.6 bits)
S2: 60 (27.7 bits)