Hit NameLength (aa)HSP LengthHSP ScoreHSP Significance
YIR034C (LYS1)37336718750.0
Sklu_2380.737436616060.0
Scas_628.537236415910.0
CAGL0F06875g37236415330.0
Kwal_14.88037336714890.0
KLLA0E07964g37236514610.0
ACR167C37236713350.0
Sklu_2224.275059682.0
BLASTP 2.2.26 [Sep-21-2011]

Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, 
Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), 
"Gapped BLAST and PSI-BLAST: a new generation of protein database search
programs",  Nucleic Acids Res. 25:3389-3402.

Reference for compositional score matrix adjustment: Altschul, Stephen F., 
John C. Wootton, E. Michael Gertz, Richa Agarwala, Aleksandr Morgulis,
Alejandro A. Schaffer, and Yi-Kuo Yu (2005) "Protein database searches
using compositionally adjusted substitution matrices", FEBS J. 272:5101-5109.

Query= YIR034C
         (367 letters)

Database: blastdb 
           34,618 sequences; 16,596,109 total letters

Searching..................................................done

                                                                 Score    E
Sequences producing significant alignments:                      (bits) Value

YIR034C (LYS1) [2698] chr9 complement(419612..420733) Saccharopi...   726   0.0  
Sklu_2380.7 YIR034C, Contig c2380 16828-17952                         623   0.0  
Scas_628.5                                                            617   0.0  
CAGL0F06875g complement(673222..674340) highly similar to sp|P38...   595   0.0  
Kwal_14.880                                                           578   0.0  
KLLA0E07964g complement(718820..719938) similar to sp|P38998 Sac...   567   0.0  
ACR167C [1214] [Homologous to ScYIR034C (LYS1) - SH] (649155..65...   518   0.0  
Sklu_2224.2 YJL099W, Contig c2224 3190-5442 reverse complement         31   2.0  

>YIR034C (LYS1) [2698] chr9 complement(419612..420733) Saccharopine
           dehydrogenase (NAD+, L-lysine forming), catalyzes the
           eighth and final step in lysine biosynthesis pathway
           [1122 bp, 373 aa]
          Length = 373

 Score =  726 bits (1875), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 354/367 (96%), Positives = 354/367 (96%)

Query: 1   MAAVTLHLRAETKPLEARAALTPTTVKKLIAKGFKIYVEDSPQSTFNINEYRQAGAIIVP 60
           MAAVTLHLRAETKPLEARAALTPTTVKKLIAKGFKIYVEDSPQSTFNINEYRQAGAIIVP
Sbjct: 1   MAAVTLHLRAETKPLEARAALTPTTVKKLIAKGFKIYVEDSPQSTFNINEYRQAGAIIVP 60

Query: 61  AGSWKTAPRDRIIIGLKEMPETDTFPLVHEHIQFAHCYKDQAGWQNVLMRFIKGHGTLYD 120
           AGSWKTAPRDRIIIGLKEMPETDTFPLVHEHIQFAHCYKDQAGWQNVLMRFIKGHGTLYD
Sbjct: 61  AGSWKTAPRDRIIIGLKEMPETDTFPLVHEHIQFAHCYKDQAGWQNVLMRFIKGHGTLYD 120

Query: 121 LEFLENDQGRRVXXXXXXXXXXXXXLGVRDWAFKQTHSDDEDLPAVSPYPNEKALVKDVT 180
           LEFLENDQGRRV             LGVRDWAFKQTHSDDEDLPAVSPYPNEKALVKDVT
Sbjct: 121 LEFLENDQGRRVAAFGFYAGFAGAALGVRDWAFKQTHSDDEDLPAVSPYPNEKALVKDVT 180

Query: 181 KDYKEALATGARKPTVLIIGALGRCGSGAIDLLHKVGIPDANILKWDIKETSRGGPFDEI 240
           KDYKEALATGARKPTVLIIGALGRCGSGAIDLLHKVGIPDANILKWDIKETSRGGPFDEI
Sbjct: 181 KDYKEALATGARKPTVLIIGALGRCGSGAIDLLHKVGIPDANILKWDIKETSRGGPFDEI 240

Query: 241 PQADIFINCIYLSKPIAPFTNMEKLNNPNRRLRTVVDVSADTTNPHNPIPIYTVATVFNK 300
           PQADIFINCIYLSKPIAPFTNMEKLNNPNRRLRTVVDVSADTTNPHNPIPIYTVATVFNK
Sbjct: 241 PQADIFINCIYLSKPIAPFTNMEKLNNPNRRLRTVVDVSADTTNPHNPIPIYTVATVFNK 300

Query: 301 PTVLVPTTAGPKLSVISIDHLPSLLPREASEFFSHDLLPSLELLPQRKTAPVWVRAKKLF 360
           PTVLVPTTAGPKLSVISIDHLPSLLPREASEFFSHDLLPSLELLPQRKTAPVWVRAKKLF
Sbjct: 301 PTVLVPTTAGPKLSVISIDHLPSLLPREASEFFSHDLLPSLELLPQRKTAPVWVRAKKLF 360

Query: 361 DRHCARV 367
           DRHCARV
Sbjct: 361 DRHCARV 367

>Sklu_2380.7 YIR034C, Contig c2380 16828-17952
          Length = 374

 Score =  623 bits (1606), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 294/366 (80%), Positives = 325/366 (88%)

Query: 2   AAVTLHLRAETKPLEARAALTPTTVKKLIAKGFKIYVEDSPQSTFNINEYRQAGAIIVPA 61
           A VTLHLRAETKP+EARAALTPTTVKKL++KGFKIYVE+S QSTF+INEYR+AGA IVP 
Sbjct: 3   APVTLHLRAETKPMEARAALTPTTVKKLLSKGFKIYVEESEQSTFDINEYREAGAEIVPT 62

Query: 62  GSWKTAPRDRIIIGLKEMPETDTFPLVHEHIQFAHCYKDQAGWQNVLMRFIKGHGTLYDL 121
           GSW  AP+DRIIIGLKEMPETDTFPLVHEHIQFAHCYK+QAGWQ+VL RF +G+GTLYDL
Sbjct: 63  GSWVNAPKDRIIIGLKEMPETDTFPLVHEHIQFAHCYKNQAGWQDVLGRFKRGNGTLYDL 122

Query: 122 EFLENDQGRRVXXXXXXXXXXXXXLGVRDWAFKQTHSDDEDLPAVSPYPNEKALVKDVTK 181
           EFLENDQGRRV             LG+RDW+FKQ HSD++DLPAVSPYPNEKAL+KDV  
Sbjct: 123 EFLENDQGRRVAAFGFYAGFAGAALGLRDWSFKQLHSDNQDLPAVSPYPNEKALIKDVVN 182

Query: 182 DYKEALATGARKPTVLIIGALGRCGSGAIDLLHKVGIPDANILKWDIKETSRGGPFDEIP 241
           DY+ AL  GA+KP VLIIGALGRCGSGA+DLLHK G+ D NILKWDIKETSRGGPF+EI 
Sbjct: 183 DYQAALKKGAKKPRVLIIGALGRCGSGAVDLLHKAGVSDENILKWDIKETSRGGPFEEIA 242

Query: 242 QADIFINCIYLSKPIAPFTNMEKLNNPNRRLRTVVDVSADTTNPHNPIPIYTVATVFNKP 301
           QADIFINCIYLSKPIAPF N E LN  NR+LRTVVDVSADTTNPHNP+PIY +ATVF+ P
Sbjct: 243 QADIFINCIYLSKPIAPFINYELLNKKNRKLRTVVDVSADTTNPHNPVPIYEIATVFSSP 302

Query: 302 TVLVPTTAGPKLSVISIDHLPSLLPREASEFFSHDLLPSLELLPQRKTAPVWVRAKKLFD 361
           TVLVPTTAGPKLSVISIDHLPSLLPRE+SEFF+HDLLPSLE LP+R TAPVWV+AKKLFD
Sbjct: 303 TVLVPTTAGPKLSVISIDHLPSLLPRESSEFFAHDLLPSLEQLPERYTAPVWVKAKKLFD 362

Query: 362 RHCARV 367
           +HCAR+
Sbjct: 363 KHCARL 368

>Scas_628.5
          Length = 372

 Score =  617 bits (1591), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 295/364 (81%), Positives = 326/364 (89%)

Query: 4   VTLHLRAETKPLEARAALTPTTVKKLIAKGFKIYVEDSPQSTFNINEYRQAGAIIVPAGS 63
           VTLHLRAETKPLEARAALTPTTVK+LIAKGFKIYVEDSPQS F+I+EY++AGAIIVPAGS
Sbjct: 3   VTLHLRAETKPLEARAALTPTTVKQLIAKGFKIYVEDSPQSIFHIDEYKKAGAIIVPAGS 62

Query: 64  WKTAPRDRIIIGLKEMPETDTFPLVHEHIQFAHCYKDQAGWQNVLMRFIKGHGTLYDLEF 123
           W +APRDRIIIGLKEMPETD FPLVHEHIQFAHCYK+QAGW++VL RFI G+GTLYDLEF
Sbjct: 63  WISAPRDRIIIGLKEMPETDKFPLVHEHIQFAHCYKNQAGWKDVLTRFINGNGTLYDLEF 122

Query: 124 LENDQGRRVXXXXXXXXXXXXXLGVRDWAFKQTHSDDEDLPAVSPYPNEKALVKDVTKDY 183
           LE+D+GRRV             LG+RDWAFKQTHSD EDLPAVSPYPNEKAL+KD++ +Y
Sbjct: 123 LEDDEGRRVAAFGFYAGFAGAALGLRDWAFKQTHSDAEDLPAVSPYPNEKALIKDISIEY 182

Query: 184 KEALATGARKPTVLIIGALGRCGSGAIDLLHKVGIPDANILKWDIKETSRGGPFDEIPQA 243
           K AL  GA+KPTVLIIGALGRCGSGAIDLL K+G+P+ NI+KWD+KET+RGGPF EI QA
Sbjct: 183 KNALKKGAKKPTVLIIGALGRCGSGAIDLLRKIGLPEENIIKWDMKETARGGPFPEIAQA 242

Query: 244 DIFINCIYLSKPIAPFTNMEKLNNPNRRLRTVVDVSADTTNPHNPIPIYTVATVFNKPTV 303
           DIFINCIYLSKPI PF N + LN   RRLRTVVDVSADTTNPHNPIPIY +ATVFNKPTV
Sbjct: 243 DIFINCIYLSKPIPPFINYDLLNKDTRRLRTVVDVSADTTNPHNPIPIYNIATVFNKPTV 302

Query: 304 LVPTTAGPKLSVISIDHLPSLLPREASEFFSHDLLPSLELLPQRKTAPVWVRAKKLFDRH 363
           LVPTTAGPKLSVISIDHLPSLLPREASEFF+ DLLPSLE LP+R TAPVWV+A+KLF+RH
Sbjct: 303 LVPTTAGPKLSVISIDHLPSLLPREASEFFARDLLPSLEQLPERYTAPVWVKAEKLFNRH 362

Query: 364 CARV 367
           CARV
Sbjct: 363 CARV 366

>CAGL0F06875g complement(673222..674340) highly similar to sp|P38998
           Saccharomyces cerevisiae YIR034c LYS1 saccharopine
           dehydrogenase, hypothetical start
          Length = 372

 Score =  595 bits (1533), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 285/364 (78%), Positives = 312/364 (85%)

Query: 3   AVTLHLRAETKPLEARAALTPTTVKKLIAKGFKIYVEDSPQSTFNINEYRQAGAIIVPAG 62
           +VTLHLR ETKPLE RAALTPTTVK LI KGFKIYVE+SPQS F I+EYR+AGAIIVP G
Sbjct: 2   SVTLHLRGETKPLEHRAALTPTTVKHLIGKGFKIYVEESPQSIFKIDEYRRAGAIIVPFG 61

Query: 63  SWKTAPRDRIIIGLKEMPETDTFPLVHEHIQFAHCYKDQAGWQNVLMRFIKGHGTLYDLE 122
           SW +APRDRIIIGLKEMPE D FPLVHEHIQFAHCYKDQAGW++VL RFI G+GTLYDLE
Sbjct: 62  SWISAPRDRIIIGLKEMPEEDKFPLVHEHIQFAHCYKDQAGWKDVLRRFINGNGTLYDLE 121

Query: 123 FLENDQGRRVXXXXXXXXXXXXXLGVRDWAFKQTHSDDEDLPAVSPYPNEKALVKDVTKD 182
           FLE+D GRRV             LG+ DWAFKQTH D EDLPAVSPYPNEKAL+KD+ K 
Sbjct: 122 FLEDDNGRRVAAFGFYAGFAGAALGLADWAFKQTHKDSEDLPAVSPYPNEKALIKDIGKA 181

Query: 183 YKEALATGARKPTVLIIGALGRCGSGAIDLLHKVGIPDANILKWDIKETSRGGPFDEIPQ 242
           YK AL TGA+KP VLIIGALGRCGSGAID L KVG+P+ NI+KWDI+ETSRGGPF EI  
Sbjct: 182 YKNALKTGAKKPKVLIIGALGRCGSGAIDFLKKVGLPEENIIKWDIQETSRGGPFPEIAA 241

Query: 243 ADIFINCIYLSKPIAPFTNMEKLNNPNRRLRTVVDVSADTTNPHNPIPIYTVATVFNKPT 302
           +DIFINCIYLSKPIAPF N E LN P+R+LRTVVDVSADTTNPHNPIPIY +ATVFNKPT
Sbjct: 242 SDIFINCIYLSKPIAPFINYELLNKPDRKLRTVVDVSADTTNPHNPIPIYNIATVFNKPT 301

Query: 303 VLVPTTAGPKLSVISIDHLPSLLPREASEFFSHDLLPSLELLPQRKTAPVWVRAKKLFDR 362
           V V T++GPKLSVISIDHLPSLLPREASEFF+HDLLPSLE LP R  +PVWVRA+KLF+R
Sbjct: 302 VKVNTSSGPKLSVISIDHLPSLLPREASEFFAHDLLPSLEQLPSRHVSPVWVRAEKLFNR 361

Query: 363 HCAR 366
           H AR
Sbjct: 362 HSAR 365

>Kwal_14.880
          Length = 373

 Score =  578 bits (1489), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 280/367 (76%), Positives = 314/367 (85%)

Query: 1   MAAVTLHLRAETKPLEARAALTPTTVKKLIAKGFKIYVEDSPQSTFNINEYRQAGAIIVP 60
           MA V LHLRAETK  EARAALTPTTV+KLIAKGFKIYVE+S QSTF+I EY++AGA IVP
Sbjct: 1   MAPVILHLRAETKDQEARAALTPTTVQKLIAKGFKIYVEESEQSTFSIEEYKKAGAEIVP 60

Query: 61  AGSWKTAPRDRIIIGLKEMPETDTFPLVHEHIQFAHCYKDQAGWQNVLMRFIKGHGTLYD 120
            GSW  AP+DRIIIGLKE+PE DTFPLVHEHIQFAHCYK+QAGWQ+VL RF +GHGTLYD
Sbjct: 61  KGSWVNAPKDRIIIGLKELPEEDTFPLVHEHIQFAHCYKNQAGWQDVLGRFKRGHGTLYD 120

Query: 121 LEFLENDQGRRVXXXXXXXXXXXXXLGVRDWAFKQTHSDDEDLPAVSPYPNEKALVKDVT 180
           LEFLENDQGRRV             LG++DWAFKQTHSD EDLP V+P+PNE  LVKDV 
Sbjct: 121 LEFLENDQGRRVAAFGFYAGFAGAALGLKDWAFKQTHSDSEDLPGVTPFPNEHELVKDVV 180

Query: 181 KDYKEALATGARKPTVLIIGALGRCGSGAIDLLHKVGIPDANILKWDIKETSRGGPFDEI 240
            DYK AL  GA+KPTVLIIGALGRCGSGA+D+L K GIP+ NI+KWD+KET+RGGPF EI
Sbjct: 181 GDYKAALKKGAKKPTVLIIGALGRCGSGAVDMLRKAGIPEKNIIKWDMKETARGGPFQEI 240

Query: 241 PQADIFINCIYLSKPIAPFTNMEKLNNPNRRLRTVVDVSADTTNPHNPIPIYTVATVFNK 300
            QADIFINCIYLSKPIAPF N   LN+ +RRLR++VDVSADTTN HNP+P+YT+ATVF+K
Sbjct: 241 AQADIFINCIYLSKPIAPFINSTLLNSKSRRLRSIVDVSADTTNVHNPVPVYTIATVFSK 300

Query: 301 PTVLVPTTAGPKLSVISIDHLPSLLPREASEFFSHDLLPSLELLPQRKTAPVWVRAKKLF 360
           PTVLVPTTAGPKLSVISIDHLPSLLPRE+SEFF+HDLLPSLE LP R  APVW RAK L+
Sbjct: 301 PTVLVPTTAGPKLSVISIDHLPSLLPRESSEFFAHDLLPSLEQLPYRDQAPVWARAKALY 360

Query: 361 DRHCARV 367
            +HCAR+
Sbjct: 361 HKHCARL 367

>KLLA0E07964g complement(718820..719938) similar to sp|P38998
           Saccharomyces cerevisiae YIR034c LYS1 saccharopine
           dehydrogenase singleton, start by similarity
          Length = 372

 Score =  567 bits (1461), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 267/365 (73%), Positives = 304/365 (83%)

Query: 3   AVTLHLRAETKPLEARAALTPTTVKKLIAKGFKIYVEDSPQSTFNINEYRQAGAIIVPAG 62
           +VTLHLRAETKPLEAR ALTPTT KKL+ KGFKI+VE+S QS F+I EY++ GA IVP G
Sbjct: 2   SVTLHLRAETKPLEARTALTPTTTKKLLDKGFKIFVEESSQSAFDIEEYKKVGATIVPEG 61

Query: 63  SWKTAPRDRIIIGLKEMPETDTFPLVHEHIQFAHCYKDQAGWQNVLMRFIKGHGTLYDLE 122
           SWKTAPRDRIIIGLKEMPETDTFPLVHEHIQFAHCYK+QAGW++VL RF +G+G LYDLE
Sbjct: 62  SWKTAPRDRIIIGLKEMPETDTFPLVHEHIQFAHCYKNQAGWEDVLSRFKRGNGVLYDLE 121

Query: 123 FLENDQGRRVXXXXXXXXXXXXXLGVRDWAFKQTHSDDEDLPAVSPYPNEKALVKDVTKD 182
           FLENDQGRRV             +G+RDWAFKQTHSD E+L A+ PY NE+A++KDV +D
Sbjct: 122 FLENDQGRRVAAFGFYAGFAGAAVGIRDWAFKQTHSDSENLGAIEPYENEEAMIKDVRRD 181

Query: 183 YKEALATGARKPTVLIIGALGRCGSGAIDLLHKVGIPDANILKWDIKETSRGGPFDEIPQ 242
           Y+ AL  GARKP VLIIGALGRCGSGA DLL K G+P+ NI+KWD+KET+RGGPF EI  
Sbjct: 182 YQLALKRGARKPKVLIIGALGRCGSGAADLLRKCGLPEENIIKWDMKETARGGPFQEIAD 241

Query: 243 ADIFINCIYLSKPIAPFTNMEKLNNPNRRLRTVVDVSADTTNPHNPIPIYTVATVFNKPT 302
           AD+FINCIYLSKPI PF N E LN P RRLRTVVDVSADTTNPHNP+PIYT+ T F+ PT
Sbjct: 242 ADVFINCIYLSKPIPPFINNELLNKPTRRLRTVVDVSADTTNPHNPVPIYTINTTFDAPT 301

Query: 303 VLVPTTAGPKLSVISIDHLPSLLPREASEFFSHDLLPSLELLPQRKTAPVWVRAKKLFDR 362
           V VPTT GPKLSV SIDHLPSLLP+EASE FS DLLPSLE LPQR TA VWV+A+ L+++
Sbjct: 302 VQVPTTVGPKLSVCSIDHLPSLLPKEASESFSRDLLPSLEQLPQRATASVWVKARNLYEK 361

Query: 363 HCARV 367
             A+V
Sbjct: 362 FAAKV 366

>ACR167C [1214] [Homologous to ScYIR034C (LYS1) - SH]
           (649155..650273) [1119 bp, 372 aa]
          Length = 372

 Score =  518 bits (1335), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 249/367 (67%), Positives = 299/367 (81%), Gaps = 1/367 (0%)

Query: 1   MAAVTLHLRAETKPLEARAALTPTTVKKLIAKGFKIYVEDSPQSTFNINEYRQAGAIIVP 60
           M+A+ LHLRAETKP+EARAALTPTTV+ L++ GFKIYVE+S QS F   EY  AGA +V 
Sbjct: 1   MSAI-LHLRAETKPMEARAALTPTTVRTLVSHGFKIYVEESAQSVFEAAEYAAAGAEVVA 59

Query: 61  AGSWKTAPRDRIIIGLKEMPETDTFPLVHEHIQFAHCYKDQAGWQNVLMRFIKGHGTLYD 120
            GSW+ APR+RII+GLKE+PE DTFPL H HIQFAHCYK+Q+GW+ VL RF  G G LYD
Sbjct: 60  TGSWRGAPRERIIVGLKELPEEDTFPLEHTHIQFAHCYKNQSGWREVLGRFQSGGGLLYD 119

Query: 121 LEFLENDQGRRVXXXXXXXXXXXXXLGVRDWAFKQTHSDDEDLPAVSPYPNEKALVKDVT 180
           LEFL++D+GRRV             LG+RDWA+KQTH+D EDLPAV+PY NE+ALV +V 
Sbjct: 120 LEFLQDDRGRRVAAFGYYAGFAGAALGLRDWAWKQTHTDAEDLPAVAPYENEQALVSEVA 179

Query: 181 KDYKEALATGARKPTVLIIGALGRCGSGAIDLLHKVGIPDANILKWDIKETSRGGPFDEI 240
              +EA   GARKP VL+IGALGRCGSGA++LL + G+ D +I++WDI ET+RGGPF EI
Sbjct: 180 AACEEAYKKGARKPRVLVIGALGRCGSGAVELLRQCGLHDKHIIRWDIAETARGGPFPEI 239

Query: 241 PQADIFINCIYLSKPIAPFTNMEKLNNPNRRLRTVVDVSADTTNPHNPIPIYTVATVFNK 300
             ADIFINCIYLS+PIAPF NME L+ P+R+LRT+VDVSADTTNPHNP+P+Y VATVF+ 
Sbjct: 240 AAADIFINCIYLSQPIAPFINMELLDRPDRKLRTIVDVSADTTNPHNPVPVYNVATVFSS 299

Query: 301 PTVLVPTTAGPKLSVISIDHLPSLLPREASEFFSHDLLPSLELLPQRKTAPVWVRAKKLF 360
           PTV+VPT+ GPKLSVISIDHLPSLLPREASE F+ DLLPSL  LP+R TAPVW+RAK+LF
Sbjct: 300 PTVVVPTSQGPKLSVISIDHLPSLLPREASEAFASDLLPSLLQLPERDTAPVWLRAKELF 359

Query: 361 DRHCARV 367
            +HC R+
Sbjct: 360 QQHCERL 366

>Sklu_2224.2 YJL099W, Contig c2224 3190-5442 reverse complement
          Length = 750

 Score = 30.8 bits (68), Expect = 2.0,   Method: Compositional matrix adjust.
 Identities = 22/59 (37%), Positives = 30/59 (50%), Gaps = 10/59 (16%)

Query: 276 VDVSADTTNPHNPIPIYTVATVFNK---PTVLVPTTAGPKLSVISIDHLPSLLPREASE 331
           V+V  DTT       IYT  T+F+     T+L   +  PKL   +ID L  L+ +E SE
Sbjct: 254 VEVGCDTT-------IYTYPTLFHNYLVDTLLELLSTAPKLYGFTIDTLKKLIYKEESE 305

  Database: blastdb
    Posted date:  Apr 3, 2006  3:33 PM
  Number of letters in database: 16,596,109
  Number of sequences in database:  34,618
  
Lambda     K      H
   0.320    0.137    0.415 

Gapped
Lambda     K      H
   0.267   0.0410    0.140 

Matrix: BLOSUM62
Gap Penalties: Existence: 11, Extension: 1
Number of Sequences: 34618
Number of Hits to DB: 12,377,210
Number of extensions: 543270
Number of successful extensions: 1202
Number of sequences better than 10.0: 9
Number of HSP's gapped: 1221
Number of HSP's successfully gapped: 9
Length of query: 367
Length of database: 16,596,109
Length adjustment: 103
Effective length of query: 264
Effective length of database: 13,030,455
Effective search space: 3440040120
Effective search space used: 3440040120
Neighboring words threshold: 11
Window for multiple hits: 40
X1: 16 ( 7.4 bits)
X2: 38 (14.6 bits)
X3: 64 (24.7 bits)
S1: 41 (21.8 bits)
S2: 62 (28.5 bits)