Hit NameLength (aa)HSP LengthHSP ScoreHSP Significance
YIL092W63362232460.0
KLLA0A12166g19578740.46
Scas_607.3543144666.8
BLASTP 2.2.26 [Sep-21-2011]

Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, 
Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), 
"Gapped BLAST and PSI-BLAST: a new generation of protein database search
programs",  Nucleic Acids Res. 25:3389-3402.

Reference for compositional score matrix adjustment: Altschul, Stephen F., 
John C. Wootton, E. Michael Gertz, Richa Agarwala, Aleksandr Morgulis,
Alejandro A. Schaffer, and Yi-Kuo Yu (2005) "Protein database searches
using compositionally adjusted substitution matrices", FEBS J. 272:5101-5109.

Query= YIL092W
         (622 letters)

Database: blastdb 
           34,618 sequences; 16,596,109 total letters

Searching..................................................done

                                                                 Score    E
Sequences producing significant alignments:                      (bits) Value

YIL092W (YIL092W) [2583] chr9 (189063..190964) Protein of unknow...  1254   0.0  
KLLA0A12166g complement(1059238..1059825) weakly similar to sp|Q...    33   0.46 
Scas_607.3                                                             30   6.8  

>YIL092W (YIL092W) [2583] chr9 (189063..190964) Protein of unknown
           function [1902 bp, 633 aa]
          Length = 633

 Score = 1254 bits (3246), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 609/622 (97%), Positives = 609/622 (97%)

Query: 1   MVQMRSKNMAYESGTNNYSDTIANGNTLPPXXXXXXXXXXXXXETLPIACNNFCVTRQID 60
           MVQMRSKNMAYESGTNNYSDTIANGNTLPP             ETLPIACNNFCVTRQID
Sbjct: 1   MVQMRSKNMAYESGTNNYSDTIANGNTLPPRSKKGHSGRRKRSETLPIACNNFCVTRQID 60

Query: 61  DDEQAFKMLDKVSHLKKFSAEDGDDNNIFVQWADDITDILFGLCCTGTFLKLLISSALSG 120
           DDEQAFKMLDKVSHLKKFSAEDGDDNNIFVQWADDITDILFGLCCTGTFLKLLISSALSG
Sbjct: 61  DDEQAFKMLDKVSHLKKFSAEDGDDNNIFVQWADDITDILFGLCCTGTFLKLLISSALSG 120

Query: 121 RAKTWFDSTTEGIDDHVIKAYSFEKFLALLSEEFDGARSLRREIFTELLTLSIDSEKSLE 180
           RAKTWFDSTTEGIDDHVIKAYSFEKFLALLSEEFDGARSLRREIFTELLTLSIDSEKSLE
Sbjct: 121 RAKTWFDSTTEGIDDHVIKAYSFEKFLALLSEEFDGARSLRREIFTELLTLSIDSEKSLE 180

Query: 181 AFAHKSGRLTPYYLSSGAALDLFLTKLEPQLQKQLENCAFPMTLNLALLITACEFAKRAS 240
           AFAHKSGRLTPYYLSSGAALDLFLTKLEPQLQKQLENCAFPMTLNLALLITACEFAKRAS
Sbjct: 181 AFAHKSGRLTPYYLSSGAALDLFLTKLEPQLQKQLENCAFPMTLNLALLITACEFAKRAS 240

Query: 241 NHKKYRYKNTRDSDICTPKSKNTAIVSKLSNTKTISKNKVIEKSDKKNYFDKNSQHIPDP 300
           NHKKYRYKNTRDSDICTPKSKNTAIVSKLSNTKTISKNKVIEKSDKKNYFDKNSQHIPDP
Sbjct: 241 NHKKYRYKNTRDSDICTPKSKNTAIVSKLSNTKTISKNKVIEKSDKKNYFDKNSQHIPDP 300

Query: 301 KRRKQNEPGMRLFLVMDEEKNILTSRNVSANAYTSKNGHTNLSDLHTNLKNSKSQQCAVE 360
           KRRKQNEPGMRLFLVMDEEKNILTSRNVSANAYTSKNGHTNLSDLHTNLKNSKSQQCAVE
Sbjct: 301 KRRKQNEPGMRLFLVMDEEKNILTSRNVSANAYTSKNGHTNLSDLHTNLKNSKSQQCAVE 360

Query: 361 PISILNSGSLVTGTINIDLINDEVLGTKEETTTYDERMDGNSRSLNERCCAVKKNSLQPI 420
           PISILNSGSLVTGTINIDLINDEVLGTKEETTTYDERMDGNSRSLNERCCAVKKNSLQPI
Sbjct: 361 PISILNSGSLVTGTINIDLINDEVLGTKEETTTYDERMDGNSRSLNERCCAVKKNSLQPI 420

Query: 421 TSNIFQKNAEIQGTKIGSVLDSGISNSFSSTEYMFPPTSSATVSNPVKKNEISKSSQVKD 480
           TSNIFQKNAEIQGTKIGSVLDSGISNSFSSTEYMFPPTSSATVSNPVKKNEISKSSQVKD
Sbjct: 421 TSNIFQKNAEIQGTKIGSVLDSGISNSFSSTEYMFPPTSSATVSNPVKKNEISKSSQVKD 480

Query: 481 IAQFNPFMTNEKEKKLNPSESFKSPGVSMEINRLSRIAGLRNIPGNIYEDSKMLNLKTRK 540
           IAQFNPFMTNEKEKKLNPSESFKSPGVSMEINRLSRIAGLRNIPGNIYEDSKMLNLKTRK
Sbjct: 481 IAQFNPFMTNEKEKKLNPSESFKSPGVSMEINRLSRIAGLRNIPGNIYEDSKMLNLKTRK 540

Query: 541 CYPLHNFAVRTRSAHFNDRPSNYISPHETINATLRSPASFDSIQCITRSKRVDAETNKAT 600
           CYPLHNFAVRTRSAHFNDRPSNYISPHETINATLRSPASFDSIQCITRSKRVDAETNKAT
Sbjct: 541 CYPLHNFAVRTRSAHFNDRPSNYISPHETINATLRSPASFDSIQCITRSKRVDAETNKAT 600

Query: 601 GSAKSENIETKSRKFPEVINPF 622
           GSAKSENIETKSRKFPEVINPF
Sbjct: 601 GSAKSENIETKSRKFPEVINPF 622

>KLLA0A12166g complement(1059238..1059825) weakly similar to
           sp|Q8TFJ7 Kluyveromyces marxianus Gag protein
           (Fragment), hypothetical start
          Length = 195

 Score = 33.1 bits (74), Expect = 0.46,   Method: Compositional matrix adjust.
 Identities = 25/78 (32%), Positives = 39/78 (50%), Gaps = 14/78 (17%)

Query: 123 KTWFDSTTEGIDDHVIKAYSFEKFLALLSEEFDGARSLRREIFTELLTLSIDSEKSLEAF 182
           K W ++  E ID        F + +A++SEE D    LR     E+ TLS+   +S+E F
Sbjct: 14  KKWLENNMEFID-------CFLEAVAIISEENDKPTLLR-----EISTLSLRDRESIEKF 61

Query: 183 AHKSGRLTPYYLSSGAAL 200
           A ++ R  PY  +  A +
Sbjct: 62  AQRATR--PYQRAERAKI 77

>Scas_607.3
          Length = 543

 Score = 30.0 bits (66), Expect = 6.8,   Method: Compositional matrix adjust.
 Identities = 38/144 (26%), Positives = 57/144 (39%), Gaps = 17/144 (11%)

Query: 56  TRQIDDDEQAFKMLDKVSHLKKFSAEDGDDNNIFVQWADDITDILFGLCCTGTFLKLLIS 115
           T   D DE    +L++V+   +FSA D   NN     A  + D    L          +S
Sbjct: 194 TDGYDADEATMAILNEVNDSTRFSAADPYKNN---NKATVLPDFQHNLISKENTTNTDLS 250

Query: 116 SALSGRAKTWFDSTTEGIDDHVIKAYSFEKFLALLSEEFDGARSLRREIFTELLTLSIDS 175
           S+L G              D  ++AY  EK  ++L+ E D      RE +       ID+
Sbjct: 251 SSLLGEKNG---------SDATVQAYEVEKSNSILAAEQDKN---GRESYAAFSI--IDN 296

Query: 176 EKSLEAFAHKSGRLTPYYLSSGAA 199
           +  L     K+ +  PY LS+  A
Sbjct: 297 DSKLNPENKKNAQDMPYGLSASLA 320

  Database: blastdb
    Posted date:  Apr 3, 2006  3:33 PM
  Number of letters in database: 16,596,109
  Number of sequences in database:  34,618
  
Lambda     K      H
   0.313    0.128    0.360 

Gapped
Lambda     K      H
   0.267   0.0410    0.140 

Matrix: BLOSUM62
Gap Penalties: Existence: 11, Extension: 1
Number of Sequences: 34618
Number of Hits to DB: 20,415,429
Number of extensions: 913477
Number of successful extensions: 2873
Number of sequences better than 10.0: 75
Number of HSP's gapped: 2997
Number of HSP's successfully gapped: 75
Length of query: 622
Length of database: 16,596,109
Length adjustment: 108
Effective length of query: 514
Effective length of database: 12,857,365
Effective search space: 6608685610
Effective search space used: 6608685610
Neighboring words threshold: 11
Window for multiple hits: 40
X1: 16 ( 7.2 bits)
X2: 38 (14.6 bits)
X3: 64 (24.7 bits)
S1: 42 (21.9 bits)
S2: 65 (29.6 bits)