Hit NameLength (aa)HSP LengthHSP ScoreHSP Significance
YIL090W49148324270.0
Scas_671.1248648116660.0
CAGL0D04202g49949715750.0
Sklu_2251.1047948314290.0
Kwal_27.1150047548013310.0
ADL208W50250011481e-153
KLLA0E08173g48648711271e-150
KLLA0F01012g55643701.5
BLASTP 2.2.26 [Sep-21-2011]

Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, 
Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), 
"Gapped BLAST and PSI-BLAST: a new generation of protein database search
programs",  Nucleic Acids Res. 25:3389-3402.

Reference for compositional score matrix adjustment: Altschul, Stephen F., 
John C. Wootton, E. Michael Gertz, Richa Agarwala, Aleksandr Morgulis,
Alejandro A. Schaffer, and Yi-Kuo Yu (2005) "Protein database searches
using compositionally adjusted substitution matrices", FEBS J. 272:5101-5109.

Query= YIL090W
         (483 letters)

Database: blastdb 
           34,618 sequences; 16,596,109 total letters

Searching..................................................done

                                                                 Score    E
Sequences producing significant alignments:                      (bits) Value

YIL090W (YIL090W) [2585] chr9 (193592..195067) Protein of unknow...   939   0.0  
Scas_671.12                                                           646   0.0  
CAGL0D04202g 414049..415548 similar to sp|P40499 Saccharomyces c...   611   0.0  
Sklu_2251.10 YIL090W, Contig c2251 10810-12249 reverse complement     555   0.0  
Kwal_27.11500                                                         517   0.0  
ADL208W [1533] [Homologous to ScYIL090W - SH] complement(337120....   446   e-153
KLLA0E08173g complement(740213..741673) similar to sp|P40499 Sac...   438   e-150
KLLA0F01012g complement(90772..92442) similar to sp|P48813 Sacch...    32   1.5  

>YIL090W (YIL090W) [2585] chr9 (193592..195067) Protein of unknown
           function, has low similarity to uncharacterized C.
           albicans Orf6.4010p [1476 bp, 491 aa]
          Length = 491

 Score =  939 bits (2427), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 463/483 (95%), Positives = 463/483 (95%)

Query: 1   MTSLSKSFMQSGRICAACFYLLFTLLSIPISFKVGGLECGLSXXXXXXXXXXXXXXXNVL 60
           MTSLSKSFMQSGRICAACFYLLFTLLSIPISFKVGGLECGLS               NVL
Sbjct: 1   MTSLSKSFMQSGRICAACFYLLFTLLSIPISFKVGGLECGLSFTVTLFTLYFITTTLNVL 60

Query: 61  ARRHGGRLYIFFTNCLYYSQHFIIASLLYLFLSGFSNDELGNVLKNKYNESESFLEALKN 120
           ARRHGGRLYIFFTNCLYYSQHFIIASLLYLFLSGFSNDELGNVLKNKYNESESFLEALKN
Sbjct: 61  ARRHGGRLYIFFTNCLYYSQHFIIASLLYLFLSGFSNDELGNVLKNKYNESESFLEALKN 120

Query: 121 SLNSNQINYVLXXXXXRFVVQPWQFVLTKSTPFFTLSEGFFTILAIQAVGETNRWLSNDL 180
           SLNSNQINYVL     RFVVQPWQFVLTKSTPFFTLSEGFFTILAIQAVGETNRWLSNDL
Sbjct: 121 SLNSNQINYVLYYYYYRFVVQPWQFVLTKSTPFFTLSEGFFTILAIQAVGETNRWLSNDL 180

Query: 181 NSNTWIISSLLTSGGVITASLYYLYRIYVTPIWPLSIQTASLLGLVLSMVCGLGLYGIVS 240
           NSNTWIISSLLTSGGVITASLYYLYRIYVTPIWPLSIQTASLLGLVLSMVCGLGLYGIVS
Sbjct: 181 NSNTWIISSLLTSGGVITASLYYLYRIYVTPIWPLSIQTASLLGLVLSMVCGLGLYGIVS 240

Query: 241 QKGSVIESSLFFAYIVRCIYEISPKLATTATDEILNLFKDVWQKHQRNLPTADNLLCYFH 300
           QKGSVIESSLFFAYIVRCIYEISPKLATTATDEILNLFKDVWQKHQRNLPTADNLLCYFH
Sbjct: 241 QKGSVIESSLFFAYIVRCIYEISPKLATTATDEILNLFKDVWQKHQRNLPTADNLLCYFH 300

Query: 301 NVILKNAEVLWGSFIPRGRKKTGDFHDKLISILSFEKVSLISKPFWKFFKNFTFSVPLSI 360
           NVILKNAEVLWGSFIPRGRKKTGDFHDKLISILSFEKVSLISKPFWKFFKNFTFSVPLSI
Sbjct: 301 NVILKNAEVLWGSFIPRGRKKTGDFHDKLISILSFEKVSLISKPFWKFFKNFTFSVPLSI 360

Query: 361 NEFCQVTIKMASESVSPAIVINLCFRVLMFYSATRIIPALQRKNDKQLRKSRRIMKGLYW 420
           NEFCQVTIKMASESVSPAIVINLCFRVLMFYSATRIIPALQRKNDKQLRKSRRIMKGLYW
Sbjct: 361 NEFCQVTIKMASESVSPAIVINLCFRVLMFYSATRIIPALQRKNDKQLRKSRRIMKGLYW 420

Query: 421 YSPCILIAMYTHLILQYSGELKKDLCIWGCSEKWFGVDQPEIIVDSWGFWNWCNIFCTIL 480
           YSPCILIAMYTHLILQYSGELKKDLCIWGCSEKWFGVDQPEIIVDSWGFWNWCNIFCTIL
Sbjct: 421 YSPCILIAMYTHLILQYSGELKKDLCIWGCSEKWFGVDQPEIIVDSWGFWNWCNIFCTIL 480

Query: 481 VYA 483
           VYA
Sbjct: 481 VYA 483

>Scas_671.12
          Length = 486

 Score =  646 bits (1666), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 319/481 (66%), Positives = 379/481 (78%), Gaps = 9/481 (1%)

Query: 4   LSKSFMQSGRICAACFYLLFTLLSIPISFKVGGLECGLSXXXXXXXXXXXXXXXNVLARR 63
           +S SF++  RIC+A FYLLFTL+SIPISFK+GGL CGL+               ++ AR+
Sbjct: 2   ISSSFIRGIRICSATFYLLFTLISIPISFKIGGLHCGLAFTVSLFILYFLSTTLSIWARK 61

Query: 64  HGGRLYIFFTNCLYYSQHFIIASLLYLFLSGFSNDELGNVLKNKYNESESFLEALK-NSL 122
           +G R++I  TN LYY QHFIIASLLYLFLSGFSN++L ++L++     +S  +  K N  
Sbjct: 62  YGSRIHILLTNILYYFQHFIIASLLYLFLSGFSNEQLSSMLRDGNKPIDSIADIFKKNVA 121

Query: 123 NSNQINYVLXXXXXRFVVQPWQFVLTKSTPFFTLSEGFFTILAIQAVGETNRWLSNDLNS 182
           +S Q N+VL     RF VQPWQF+L+ STPFFTLSEGFFTILAIQA+GETN+WL  ++NS
Sbjct: 122 SSTQANWVLYYYYYRFFVQPWQFILSYSTPFFTLSEGFFTILAIQAIGETNKWLVYEINS 181

Query: 183 NTWIISSLLTSGGVITASLYYLYRIYVTPIWPLSIQTASLLGLVLSMVCGLGLYGIVSQK 242
           NTW+ISSLL SGGVITASLYYLYRIYVTPIW LS+QTASLLG  LS+V GLG+YGIV+ K
Sbjct: 182 NTWVISSLLASGGVITASLYYLYRIYVTPIWQLSVQTASLLGFTLSLVGGLGIYGIVTDK 241

Query: 243 GSVIESSLFFAYIVRCIYEISPKLATTATDEILNLFKDVWQKHQRNLPTADNLLCYFHNV 302
           GSVIESS+FFAYIVRCIYEISPKLATTAT+EIL +FK+VWQ+HQ NL + +NLL Y+HNV
Sbjct: 242 GSVIESSVFFAYIVRCIYEISPKLATTATEEILEVFKEVWQRHQANLTSPNNLLSYYHNV 301

Query: 303 ILKNAEVLWGSFIPRGRKKTGDFHDKLISILSFEKVSLISKPFWKFFKNFTFSVPLSINE 362
           +LKN E +W SF      K  D  +  I+  S E+V  I  P WK  K FT +VP SINE
Sbjct: 302 VLKNIETIWESF------KIND--NSFITSFSTERVITIFMPIWKLLKTFTITVPSSINE 353

Query: 363 FCQVTIKMASESVSPAIVINLCFRVLMFYSATRIIPALQRKNDKQLRKSRRIMKGLYWYS 422
            C VT KMA ES+SPA+++NLCFRVL+FYSATRIIPALQR++D +LRKSRRIMK LYWYS
Sbjct: 354 LCFVTYKMACESISPAVIVNLCFRVLIFYSATRIIPALQRRDDNELRKSRRIMKVLYWYS 413

Query: 423 PCILIAMYTHLILQYSGELKKDLCIWGCSEKWFGVDQPEIIVDSWGFWNWCNIFCTILVY 482
           PCILIAMY HLILQYSGELK +LC+WGC+ K F  DQP+IIVDSWGFWNWCNIF TILVY
Sbjct: 414 PCILIAMYAHLILQYSGELKDELCLWGCNSKIFPSDQPKIIVDSWGFWNWCNIFFTILVY 473

Query: 483 A 483
           A
Sbjct: 474 A 474

>CAGL0D04202g 414049..415548 similar to sp|P40499 Saccharomyces
           cerevisiae YIL090w, start by similarity
          Length = 499

 Score =  611 bits (1575), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 314/497 (63%), Positives = 375/497 (75%), Gaps = 25/497 (5%)

Query: 1   MTSLSKSFMQSGRICAACFYLLFTLLSIPISFKVGGLECGLSXXXXXXXXXXXXXXXNVL 60
           M  +++   +S RI +A  YL+ TL+SIPISFK+GGL+CGLS               +VL
Sbjct: 1   MGLITEGVQRSIRISSAALYLVLTLVSIPISFKIGGLQCGLSFTVTLFNLYLISTTLSVL 60

Query: 61  ARRHGGRLYIFFTNCLYYSQHFIIASLLYLFLSGFSNDELGNVLK--NKYNESE---SFL 115
           ARR   R Y+F T+ LYYSQH +IA LL+LFLSGFSN+E    L     Y E +   SFL
Sbjct: 61  ARRSCNRGYVFATSILYYSQHLVIAPLLFLFLSGFSNEEFNRFLSPVGSYQELDPDGSFL 120

Query: 116 EALKNSL-----NSNQINYVLXXXXXRFVVQPWQFVLTKSTPFFTLSEGFFTILAIQAVG 170
           + LK+ +       N  N+ L     +F+VQPWQ++L+ STPFFTL EGFFTILAIQA+G
Sbjct: 121 DLLKHRILMATTAENSKNWTLYYYYFKFIVQPWQWLLSYSTPFFTLLEGFFTILAIQAIG 180

Query: 171 ETNRWLSNDLNSNTWIISSLLTSGGVITASLYYLYRIYVTPIWPLSIQTASLLGLVLSMV 230
           ETN+WLS ++NSNTWII+SLL SGGVIT SLYYLYRIYVTPIW L+IQ+ASLLG VLS+V
Sbjct: 181 ETNKWLSYEMNSNTWIITSLLVSGGVITGSLYYLYRIYVTPIWKLTIQSASLLGFVLSIV 240

Query: 231 CGLGLYGIVSQKGSVIESSLFFAYIVRCIYEISPKLATTATDEILNLFKDVWQKHQRNLP 290
             LGLYGI+S+KGSVIESSLFFAYIVRCIYEISPKLAT AT+EIL+L KDVWQ HQRNL 
Sbjct: 241 FCLGLYGIISRKGSVIESSLFFAYIVRCIYEISPKLATRATEEILDLVKDVWQTHQRNLL 300

Query: 291 TADNLLCYFHNVILKNAEVLWGSFI-PRGRKKTGDFHDKLISILSFEKVS--LISKPFWK 347
             DNLL Y+HNV+LKNAE++W SFI PR R           S+ + EK+   L   P WK
Sbjct: 301 NRDNLLAYYHNVVLKNAEMVWESFILPRSR-----------SLNAMEKIRFWLDVTPVWK 349

Query: 348 FFKNFTFSVPLSINEFCQVTIKMASESVSPAIVINLCFRVLMFYSATRIIPALQRKNDKQ 407
           FFKNFT SVP SI E   VT KMASES+SPA+++NLCFR+L+FYSATRIIPALQR + K+
Sbjct: 350 FFKNFTVSVPSSIVELVSVTYKMASESLSPAVIVNLCFRILIFYSATRIIPALQRSSYKE 409

Query: 408 LRKSRRIMKGLYWYSPCILIAMYTHLILQYSGELKKDLCIWGCSEKWFGV-DQPEIIVDS 466
            R+SRRI+K LYWYSPC+LIAMYTHLILQYSGELK++LC+WGC+  WFG  DQP I+ DS
Sbjct: 410 QRQSRRILKLLYWYSPCVLIAMYTHLILQYSGELKRELCLWGCTSNWFGSKDQPRIVTDS 469

Query: 467 WGFWNWCNIFCTILVYA 483
           W FWNWCNIF T+LVYA
Sbjct: 470 WSFWNWCNIFWTVLVYA 486

>Sklu_2251.10 YIL090W, Contig c2251 10810-12249 reverse complement
          Length = 479

 Score =  555 bits (1429), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 285/483 (59%), Positives = 350/483 (72%), Gaps = 17/483 (3%)

Query: 4   LSKSFMQSGRICAACFYLLFTLLSIPISFKVGGLECGLSXXXXXXXXXXXXXXXNVLARR 63
           L +S +QS R C   FYLL  L++IPISF+VGGL CGLS                +++++
Sbjct: 2   LPRSLIQSIRGCLTTFYLLLVLITIPISFQVGGLYCGLSFTVTLFNLYFLTTTLKIVSKK 61

Query: 64  HGGRLYIFFTNCLYYSQHFIIASLLYLFLSGFSNDELGNVLKNKYN-ESESFLEALKNSL 122
           +  RLY   T+ +YY QHFII SLL+LFLSGF+NDEL   +    N   ES +  L+N  
Sbjct: 62  YN-RLYYSITSFVYYLQHFIIPSLLFLFLSGFNNDELKRQIDGDVNLPRESLVNFLRN-- 118

Query: 123 NSNQINYVLXXXXXRFVVQPWQFVLTKSTPFFTLSEGFFTILAIQAVGETNRWLSNDLNS 182
            S + +++      +F V+PWQFVL  STP+FTL EGFFT+L IQA+GETN+WL    NS
Sbjct: 119 KSGKHSWIFYYYYYKFTVKPWQFVLLHSTPYFTLLEGFFTVLGIQAIGETNKWLRYHKNS 178

Query: 183 NTWIISSLLTSGGVITASLYYLYRIYVTPIWPLSIQTASLLGLVLSMVCGLGLYGIVSQK 242
           NTWII SLL SGGVIT SLYYLYRIYVTP+W LSIQTASLLG  LS+VCGLGLYGIVS K
Sbjct: 179 NTWIIVSLLISGGVITTSLYYLYRIYVTPVWELSIQTASLLGFTLSIVCGLGLYGIVSGK 238

Query: 243 GSVIESSLFFAYIVRCIYEISPKLATTATDEILNLFKDVWQKHQRNLPTADNLLCYFHNV 302
           GSVIESSLFFAYIVRCIYEISP+LAT+A DEI  + KD WQKHQ NLPT DNLL Y+ NV
Sbjct: 239 GSVIESSLFFAYIVRCIYEISPQLATSAMDEIFKIVKDTWQKHQGNLPT-DNLLSYYRNV 297

Query: 303 ILKNAEVLWGSFIPRGRKKTGDFHDKLISILSFEKVSLISKPFWKFFKNFTFSVPLSINE 362
           +LKN E++W + +    +KTG       S  + + V L  +P WKF KNFT SVP SI E
Sbjct: 298 VLKNGEMIWDAIV----QKTGT-----TSPSTTQMVWLRLQPLWKFTKNFTISVPSSIRE 348

Query: 363 FCQVTIKMASESVSPAIVINLCFRVLMFYSATRIIPALQRKNDKQLRKSRRIMKGLYWYS 422
             +VT+KMA+ESV+P +VINL FR+L+FYSATRIIPALQ+ N    + SRR+M+ +YWYS
Sbjct: 349 IFRVTLKMATESVTPTVVINLVFRILVFYSATRIIPALQKDNPNGRKSSRRLMRLIYWYS 408

Query: 423 PCILIAMYTHLILQYSGELKKDLCIWGCSEKWFGVDQP--EIIVDSWGFWNWCNIFCTIL 480
           PCI+IAMYTHLILQYSGEL  DLC+WGC   W   + P  +++VD+WGFWNWCN+FCT+ 
Sbjct: 409 PCIVIAMYTHLILQYSGELNNDLCLWGCFP-WSHTNDPSSKVVVDAWGFWNWCNVFCTLA 467

Query: 481 VYA 483
           +Y 
Sbjct: 468 IYG 470

>Kwal_27.11500
          Length = 475

 Score =  517 bits (1331), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 262/480 (54%), Positives = 340/480 (70%), Gaps = 15/480 (3%)

Query: 4   LSKSFMQSGRICAACFYLLFTLLSIPISFKVGGLECGLSXXXXXXXXXXXXXXXNVLARR 63
           + +S +QS R+C   FYLL  L++IPI+F+VGGL CGLS                + AR 
Sbjct: 2   IPRSILQSIRVCLTSFYLLLILITIPIAFQVGGLYCGLSFTVTLFNLYLITTTLKIAARA 61

Query: 64  HGGRLYIFFTNCLYYSQHFIIASLLYLFLSGFSNDELGNVLKNKYNESESFLEALKNSLN 123
            G   +    +  YY+QHF I SLL+LFLSGFSNDEL + +       ES ++ L++S +
Sbjct: 62  RG---FAKLASAAYYAQHFFIPSLLFLFLSGFSNDELKHQIDTNTRPDESLIDLLRSSTH 118

Query: 124 SNQINYVLXXXXXRFVVQPWQFVLTKSTPFFTLSEGFFTILAIQAVGETNRWLSNDLNSN 183
           S    ++       +VV+PWQF+L +STP+FTL EGFFT+L IQAVGETNRWLS    SN
Sbjct: 119 SQP--WIFYYYYYHYVVRPWQFLLLRSTPYFTLLEGFFTVLGIQAVGETNRWLSRGHGSN 176

Query: 184 TWIISSLLTSGGVITASLYYLYRIYVTPIWPLSIQTASLLGLVLSMVCGLGLYGIVSQKG 243
            W+IS L+TSGGVITA+LYYLYRIYVTPIW LS+QTASLLG   S+V GLG++GIVS +G
Sbjct: 177 VWVISGLMTSGGVITAALYYLYRIYVTPIWELSVQTASLLGFTFSIVSGLGIFGIVSGRG 236

Query: 244 SVIESSLFFAYIVRCIYEISPKLATTATDEILNLFKDVWQKHQRNLPTADNLLCYFHNVI 303
           S IESSLFFAYIVRC+YEISP+LAT+A DEI NL KD W    R+L ++D  L Y+ ++I
Sbjct: 237 STIESSLFFAYIVRCLYEISPQLATSAMDEISNLVKDTWHNQHRSLRSSDTFLAYYRDII 296

Query: 304 LKNAEVLWGSFIPRGRKKTGDFHDKLISILSFEKVSLISKPFWKFFKNFTFSVPLSINEF 363
           LKN E++W + + R            ++ +S+ +V    +P WKF K+FT SVP SI E 
Sbjct: 297 LKNGEMIWDAVLARTNVNVSG--AGPVAWISWHRV----QPLWKFVKHFTSSVPSSIQEI 350

Query: 364 CQVTIKMASESVSPAIVINLCFRVLMFYSATRIIPALQRKNDKQLRKSRRIMKGLYWYSP 423
             +T+ MA E+++PA+VINLCFR+L+FYSATRIIPALQRK+    R+SRR M+ LYWYSP
Sbjct: 351 FLLTLSMAREAIAPAVVINLCFRILIFYSATRIIPALQRKHK---RRSRRFMRMLYWYSP 407

Query: 424 CILIAMYTHLILQYSGELKKDLCIWGCSEKWFGVDQPEIIVDSWGFWNWCNIFCTILVYA 483
           CI+IAMYTHLI+QYSG++  DLC+WGC   W   +  +++VDSWGFWNWCNIFCT+ +YA
Sbjct: 408 CIVIAMYTHLIMQYSGQISNDLCLWGCF-PWSPPEGSKVVVDSWGFWNWCNIFCTMAIYA 466

>ADL208W [1533] [Homologous to ScYIL090W - SH]
           complement(337120..338628) [1509 bp, 502 aa]
          Length = 502

 Score =  446 bits (1148), Expect = e-153,   Method: Compositional matrix adjust.
 Identities = 241/500 (48%), Positives = 318/500 (63%), Gaps = 30/500 (6%)

Query: 6   KSFMQSGRICAACFYLLFTLLSIPISFKVGGLECGLSXXXXXXXXXXXXXXXNVLARRHG 65
           K  ++S R   A FYL   L+++PISF++GGL CGLS                + A   G
Sbjct: 4   KGLLRSLRFALASFYLFLVLITVPISFQIGGLYCGLSFTVTLFILYFVTTTLKITAATRG 63

Query: 66  GRLYIFFTNCLYYSQHFIIASLLYLFLSGFSNDELGNVLKN------------KYNESES 113
              +    + LYY QHF++ S+L+LFLSGF+ND+L   L                N +ES
Sbjct: 64  DE-WKHIASTLYYLQHFLMPSILFLFLSGFNNDQLQKKLVGSDPKGARGGFIFDGNMNES 122

Query: 114 FLEALKNSLNSNQINYVLXXXXXRFVVQPWQFVLTKSTPFFTLSEGFFTILAIQAVGETN 173
            L+ L  S +       L     R+VV+PWQ++L  +TP FTL+EGFFT+LAIQ +GET 
Sbjct: 123 LLQLLGRSRDDRATMAYLHYY--RYVVRPWQYMLLHATPCFTLTEGFFTVLAIQVIGETG 180

Query: 174 RWLSNDLNSNTWIISSLLTSGGVITASLYYLYRIYVTPIWPLSIQTASLLGLVLSMVCGL 233
           RWL    NS  W+ISSL+ SG VIT S+YYLYRIYVTPIWPLS+ TA+LLG  LS+V GL
Sbjct: 181 RWLRYKRNSTAWVISSLMVSGVVITTSMYYLYRIYVTPIWPLSVHTATLLGFTLSLVFGL 240

Query: 234 GLYGIVSQKGSVIESSLFFAYIVRCIYEISPKLATTATDEILNLFKDVWQKHQRNLPTAD 293
           GLYGI+S KGS IESSLFFAY+V CIYEISP+LA TA  EI  +  + WQ  Q  LP  +
Sbjct: 241 GLYGIISGKGSAIESSLFFAYMVHCIYEISPQLALTAMSEIFQVVHNTWQMQQGTLP-KN 299

Query: 294 NLLCYFHNVILKNAEVLWGSFIPRG-RKKTGDFHDKLISILSFEKVSLI-------SKPF 345
           +LL Y+ N IL NAE LW   + +     + +      S++  + + L+       S+  
Sbjct: 300 SLLAYYKNFIL-NAENLWDVLLKKAFLLHSVELDQAPSSVVVKDALVLVQQQWWNKSQQL 358

Query: 346 WKFFKNFTFSVPLSINEFCQVTIKMASESVSPAIVINLCFRVLMFYSATRIIPALQRKND 405
           W F KNF+  +P SI+E   VT+ +A ES++ A+V NL FRV++FYSATRIIPALQR   
Sbjct: 359 WSFTKNFSAGIPRSIHEIFIVTLGLARESINAAVVSNLVFRVIVFYSATRIIPALQRATG 418

Query: 406 KQLRKSRRIMKGLYWYSPCILIAMYTHLILQYSGELKKDLCIWGCSEKWFG--VDQPEII 463
               +SR++M+ +YWYSPCI+IAMYTH+IL+YSGEL  +LCIWGC   W     ++   +
Sbjct: 419 GT--QSRKLMRIIYWYSPCIVIAMYTHMILRYSGELNNELCIWGCF-PWLQSEANRDRWV 475

Query: 464 VDSWGFWNWCNIFCTILVYA 483
           VD+WGFWNWCN+F T+L+YA
Sbjct: 476 VDAWGFWNWCNLFFTLLIYA 495

>KLLA0E08173g complement(740213..741673) similar to sp|P40499
           Saccharomyces cerevisiae YIL090w singleton, start by
           similarity
          Length = 486

 Score =  438 bits (1127), Expect = e-150,   Method: Compositional matrix adjust.
 Identities = 242/487 (49%), Positives = 300/487 (61%), Gaps = 52/487 (10%)

Query: 1   MTSLSKSFMQSGRICAACFYLLFTLLSIPISFKVGGLECGLSXXXXXXXXXXXXXXXNVL 60
           M  + KS +Q+ RI     YL   L++IPISF+VGGL CGLS                ++
Sbjct: 40  MPLIKKSVLQTLRIFLTTMYLFLVLITIPISFQVGGLNCGLSFTVTLFALYFVSTTFKLV 99

Query: 61  ARRHGGRLYIFFTNCLYYSQHFIIASLLYLFLSGFSNDELGNVLKNKYNESESFLEALKN 120
               G  L    +  +YY QH +I S+L++FLS F N +   V      +SE F      
Sbjct: 100 LLDRGSAL----STLIYYLQHLLIPSILFMFLSYFENIDSDTV------DSEYF------ 143

Query: 121 SLNSNQINYVLXXXXXRFVVQPWQFVLTKSTPFFTLSEGFFTILAIQAVGETNRWLSNDL 180
                             +V+PWQ  L  STP FTL EG FTILAIQA+GET RWL    
Sbjct: 144 ------------KVFWNVMVKPWQLSLIHSTPVFTLLEGVFTILAIQAIGETERWLKMSR 191

Query: 181 NSNTWIISSLLTSGGVITASLYYLYRIYVTPIWPLSIQTASLLGLVLSMVCGLGLYGIVS 240
            SN W+I SLL SGG+IT SL+Y YRIYVTP+W LS  +ASLLG   S+VCG+GLYGI +
Sbjct: 192 RSNQWVILSLLISGGIITLSLFYFYRIYVTPMWELSTPSASLLGFTFSIVCGIGLYGI-N 250

Query: 241 QKGSVIESSLFFAYIVRCIYEISPKLATTATDEILNLFKDVWQKHQRNLPTADNLLCYFH 300
             GSV+ESSLFFAY+VR +YEISPK+A  A DEI ++ K+ W+ HQ NLP  DNLL    
Sbjct: 251 GSGSVMESSLFFAYMVRNVYEISPKMAMNAMDEIFDIVKETWKIHQANLPKKDNLL---- 306

Query: 301 NVILKNAEVLWGSFI---PRGRKKTGDFHDKLISILSFEKVSLISKPFWKFFKNFTFSVP 357
            ++ KN   +W   +   PR  K           I   ++   I  P W   KNFT SVP
Sbjct: 307 ELMTKNYRAIWSQIVEHTPRNHKY----------IKMMDQCKWILNPLWNSVKNFTKSVP 356

Query: 358 LSINEFCQVTIKMASESVSPAIVINLCFRVLMFYSATRIIPALQRKNDKQLRKSRRIMKG 417
           +SI E   VT KMA ES+ PA+VINL FR+L+FYSATRIIP LQR N K+ R  RRIM  
Sbjct: 357 ISIQEIFVVTFKMAKESLIPAVVINLVFRLLIFYSATRIIPTLQR-NTKERRSFRRIMNF 415

Query: 418 LYWYSPCILIAMYTHLILQYSGELKKDLCIWGCSEKWFGVD-QPEIIVDSWGFWNWCNIF 476
           +YWYSPCI+IAMYTHLIL+YSG+LK DLCIWGC    F  + +P+I+VDSW FWNWCNI+
Sbjct: 416 VYWYSPCIIIAMYTHLILRYSGQLKNDLCIWGC----FPYETEPKIVVDSWSFWNWCNIY 471

Query: 477 CTILVYA 483
            T+L+YA
Sbjct: 472 STMLIYA 478

>KLLA0F01012g complement(90772..92442) similar to sp|P48813
           Saccharomyces cerevisiae YDR508c GNP1 high-affinity
           glutamine permease, hypothetical start
          Length = 556

 Score = 31.6 bits (70), Expect = 1.5,   Method: Compositional matrix adjust.
 Identities = 16/43 (37%), Positives = 28/43 (65%), Gaps = 1/43 (2%)

Query: 346 WKFFKNFTFSVPLSINEFCQVTIKMASESVSPAIVINLCFRVL 388
           W FF N+T  +PL I     +TI   +E+++P+IV+ LC+ ++
Sbjct: 125 WLFFLNWTVVLPLEIC-VASMTINFWNENINPSIVVALCYSLV 166

  Database: blastdb
    Posted date:  Apr 3, 2006  3:33 PM
  Number of letters in database: 16,596,109
  Number of sequences in database:  34,618
  
Lambda     K      H
   0.327    0.140    0.443 

Gapped
Lambda     K      H
   0.267   0.0410    0.140 

Matrix: BLOSUM62
Gap Penalties: Existence: 11, Extension: 1
Number of Sequences: 34618
Number of Hits to DB: 14,697,636
Number of extensions: 607586
Number of successful extensions: 2247
Number of sequences better than 10.0: 14
Number of HSP's gapped: 2261
Number of HSP's successfully gapped: 14
Length of query: 483
Length of database: 16,596,109
Length adjustment: 106
Effective length of query: 377
Effective length of database: 12,926,601
Effective search space: 4873328577
Effective search space used: 4873328577
Neighboring words threshold: 11
Window for multiple hits: 40
X1: 15 ( 7.1 bits)
X2: 38 (14.6 bits)
X3: 64 (24.7 bits)
S1: 40 (21.7 bits)
S2: 63 (28.9 bits)