Hit NameLength (aa)HSP LengthHSP ScoreHSP Significance
YIL053W (RHR2)27126712940.0
Scas_701.825024610981e-153
YER062C (HOR2)25024610971e-153
CAGL0M11660g24824410751e-150
CAGL0M12430g24924210571e-147
Kwal_23.583124924210391e-144
ADL071C2532419651e-133
CAGL0I05874g2472419351e-128
KLLA0C08217g2562419341e-128
Scas_704.322472409121e-125
Sklu_2394.32432382894e-31
CAGL0D04092g2512362721e-28
CAGL0M12925g2462252608e-27
YHR043C (DOG2)2462272475e-25
KLLA0C11143g2682442488e-25
Scas_690.302592262469e-25
AAL123W2892262481e-24
YHR044C (DOG1)2462242381e-23
Scas_690.312442242372e-23
Scas_694.4059731681.2
Kwal_55.20214127567644.0
KLLA0B05995g49037634.5
Scas_714.22221153624.7
CAGL0A01386g110229634.9
YDL107W (MSS2)35143617.3
BLASTP 2.2.26 [Sep-21-2011]

Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, 
Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), 
"Gapped BLAST and PSI-BLAST: a new generation of protein database search
programs",  Nucleic Acids Res. 25:3389-3402.

Reference for compositional score matrix adjustment: Altschul, Stephen F., 
John C. Wootton, E. Michael Gertz, Richa Agarwala, Aleksandr Morgulis,
Alejandro A. Schaffer, and Yi-Kuo Yu (2005) "Protein database searches
using compositionally adjusted substitution matrices", FEBS J. 272:5101-5109.

Query= YIL053W
         (267 letters)

Database: blastdb 
           34,618 sequences; 16,596,109 total letters

Searching..................................................done

                                                                 Score    E
Sequences producing significant alignments:                      (bits) Value

YIL053W (RHR2) [2614] chr9 (255050..255865) DL-glycerol phosphat...   503   0.0  
Scas_701.8                                                            427   e-153
YER062C (HOR2) [1493] chr5 complement(279928..280680) DL-glycero...   427   e-153
CAGL0M11660g complement(1158566..1159312) highly similar to sp|P...   418   e-150
CAGL0M12430g complement(1238150..1238899) highly similar to sp|P...   411   e-147
Kwal_23.5831                                                          404   e-144
ADL071C [1670] [Homologous to ScYIL053W (RHR2) - SH; ScYER062C (...   376   e-133
CAGL0I05874g complement(558102..558845) highly similar to sp|P41...   364   e-128
KLLA0C08217g 721753..722523 highly similar to sp|P41277 Saccharo...   364   e-128
Scas_704.32                                                           355   e-125
Sklu_2394.3 YHR043C, Contig c2394 2120-2851 reverse complement        115   4e-31
CAGL0D04092g 405613..406368 similar to sp|P38773 Saccharomyces c...   109   1e-28
CAGL0M12925g 1274919..1275659 similar to sp|P38773 Saccharomyces...   104   8e-27
YHR043C (DOG2) [2331] chr8 complement(192797..193537) 2-Deoxyglu...   100   5e-25
KLLA0C11143g 956474..957280 similar to sp|P38773 Saccharomyces c...   100   8e-25
Scas_690.30                                                            99   9e-25
AAL123W [64] [Homologous to ScYHR043C (DOG2) - SH; ScYHR044C (DO...   100   1e-24
YHR044C (DOG1) [2332] chr8 complement(194060..194800) 2-Deoxyglu...    96   1e-23
Scas_690.31                                                            96   2e-23
Scas_694.40                                                            31   1.2  
Kwal_55.20214                                                          29   4.0  
KLLA0B05995g 535752..537224 some similarities with ca|CA0656|IPF...    29   4.5  
Scas_714.22                                                            28   4.7  
CAGL0A01386g 136693..140001 some similarities with sp|P08640 Sac...    29   4.9  
YDL107W (MSS2) [762] chr4 (268921..269976) Protein involved in t...    28   7.3  

>YIL053W (RHR2) [2614] chr9 (255050..255865) DL-glycerol phosphate
           phosphatase (sn-glycerol-3-phosphatase) [816 bp, 271 aa]
          Length = 271

 Score =  503 bits (1294), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 248/267 (92%), Positives = 248/267 (92%)

Query: 1   MKRFNVLKYIRTTKANIQTIAMPLTTKPLSLKINAALFDVDGTIIISQPAIAAFWRDFGK 60
           MKRFNVLKYIRTTKANIQTIAMPLTTKPLSLKINAALFDVDGTIIISQPAIAAFWRDFGK
Sbjct: 1   MKRFNVLKYIRTTKANIQTIAMPLTTKPLSLKINAALFDVDGTIIISQPAIAAFWRDFGK 60

Query: 61  DKPYFDAEHVIHISHGWRTYDAIAKFAPDFADEEYVNKLEGEIPEKYGEHSIEVPGAVKL 120
           DKPYFDAEHVIHISHGWRTYDAIAKFAPDFADEEYVNKLEGEIPEKYGEHSIEVPGAVKL
Sbjct: 61  DKPYFDAEHVIHISHGWRTYDAIAKFAPDFADEEYVNKLEGEIPEKYGEHSIEVPGAVKL 120

Query: 121 CNALNALPKEKWAVATSGTRDMAKKWFDILKIKRPEYFITANDVKQGKPHPEPYLKGRNG 180
           CNALNALPKEKWAVATSGTRDMAKKWFDILKIKRPEYFITANDVKQGKPHPEPYLKGRNG
Sbjct: 121 CNALNALPKEKWAVATSGTRDMAKKWFDILKIKRPEYFITANDVKQGKPHPEPYLKGRNG 180

Query: 181 LGFPINEQDPSKSKVVVFEDXXXXXXXXXXXXXXXXXXXTTFDLDFLKEKGCDIIVKNHE 240
           LGFPINEQDPSKSKVVVFED                   TTFDLDFLKEKGCDIIVKNHE
Sbjct: 181 LGFPINEQDPSKSKVVVFEDAPAGIAAGKAAGCKIVGIATTFDLDFLKEKGCDIIVKNHE 240

Query: 241 SIRVGEYNAETDEVELIFDDYLYAKDD 267
           SIRVGEYNAETDEVELIFDDYLYAKDD
Sbjct: 241 SIRVGEYNAETDEVELIFDDYLYAKDD 267

>Scas_701.8
          Length = 250

 Score =  427 bits (1098), Expect = e-153,   Method: Compositional matrix adjust.
 Identities = 209/246 (84%), Positives = 216/246 (87%)

Query: 22  MPLTTKPLSLKINAALFDVDGTIIISQPAIAAFWRDFGKDKPYFDAEHVIHISHGWRTYD 81
           M LTTKPLSLK+NAALFDVDGTIIISQ AIAAFWRDFGKDKPYFDAEHVIHISHGWRTYD
Sbjct: 1   MGLTTKPLSLKVNAALFDVDGTIIISQGAIAAFWRDFGKDKPYFDAEHVIHISHGWRTYD 60

Query: 82  AIAKFAPDFADEEYVNKLEGEIPEKYGEHSIEVPGAVKLCNALNALPKEKWAVATSGTRD 141
           AIAKFAPDFADEE V+KLEGEIPEKYGEHSIEVPGAVKLCN LN LPKEKWAVATSGTR+
Sbjct: 61  AIAKFAPDFADEELVSKLEGEIPEKYGEHSIEVPGAVKLCNDLNKLPKEKWAVATSGTRE 120

Query: 142 MAKKWFDILKIKRPEYFITANDVKQGKPHPEPYLKGRNGLGFPINEQDPSKSKVVVFEDX 201
           MA KWFD+LKIKRP+YFITANDVKQGKPHPEPYLKGRNGLGFPINEQDPSKSK +VFED 
Sbjct: 121 MATKWFDLLKIKRPQYFITANDVKQGKPHPEPYLKGRNGLGFPINEQDPSKSKAIVFEDA 180

Query: 202 XXXXXXXXXXXXXXXXXXTTFDLDFLKEKGCDIIVKNHESIRVGEYNAETDEVELIFDDY 261
                             TTFDLDFLKEKGCDIIVKNHESIRVG Y+  TDEVE IFDDY
Sbjct: 181 PAGIVAGKAAGCKIVGIATTFDLDFLKEKGCDIIVKNHESIRVGGYDPVTDEVEFIFDDY 240

Query: 262 LYAKDD 267
           LYAKDD
Sbjct: 241 LYAKDD 246

>YER062C (HOR2) [1493] chr5 complement(279928..280680) DL-glycerol
           phosphate phosphatase (sn-glycerol-3-phosphatase) [753
           bp, 250 aa]
          Length = 250

 Score =  427 bits (1097), Expect = e-153,   Method: Compositional matrix adjust.
 Identities = 209/246 (84%), Positives = 218/246 (88%)

Query: 22  MPLTTKPLSLKINAALFDVDGTIIISQPAIAAFWRDFGKDKPYFDAEHVIHISHGWRTYD 81
           M LTTKPLSLK+NAALFDVDGTIIISQPAIAAFWRDFGKDKPYFDAEHVI +SHGWRT+D
Sbjct: 1   MGLTTKPLSLKVNAALFDVDGTIIISQPAIAAFWRDFGKDKPYFDAEHVIQVSHGWRTFD 60

Query: 82  AIAKFAPDFADEEYVNKLEGEIPEKYGEHSIEVPGAVKLCNALNALPKEKWAVATSGTRD 141
           AIAKFAPDFA+EEYVNKLE EIP KYGE SIEVPGAVKLCNALNALPKEKWAVATSGTRD
Sbjct: 61  AIAKFAPDFANEEYVNKLEAEIPVKYGEKSIEVPGAVKLCNALNALPKEKWAVATSGTRD 120

Query: 142 MAKKWFDILKIKRPEYFITANDVKQGKPHPEPYLKGRNGLGFPINEQDPSKSKVVVFEDX 201
           MA+KWF+ L I+RP+YFITANDVKQGKPHPEPYLKGRNGLG+PINEQDPSKSKVVVFED 
Sbjct: 121 MAQKWFEHLGIRRPKYFITANDVKQGKPHPEPYLKGRNGLGYPINEQDPSKSKVVVFEDA 180

Query: 202 XXXXXXXXXXXXXXXXXXTTFDLDFLKEKGCDIIVKNHESIRVGEYNAETDEVELIFDDY 261
                             TTFDLDFLKEKGCDIIVKNHESIRVG YNAETDEVE IFDDY
Sbjct: 181 PAGIAAGKAAGCKIIGIATTFDLDFLKEKGCDIIVKNHESIRVGGYNAETDEVEFIFDDY 240

Query: 262 LYAKDD 267
           LYAKDD
Sbjct: 241 LYAKDD 246

>CAGL0M11660g complement(1158566..1159312) highly similar to
           sp|P41277 Saccharomyces cerevisiae YIL053w RHR2 or
           sp|P40106 Saccharomyces cerevisiae YER062c GPP2,
           hypothetical start
          Length = 248

 Score =  418 bits (1075), Expect = e-150,   Method: Compositional matrix adjust.
 Identities = 204/244 (83%), Positives = 214/244 (87%)

Query: 24  LTTKPLSLKINAALFDVDGTIIISQPAIAAFWRDFGKDKPYFDAEHVIHISHGWRTYDAI 83
           ++T P+SLK+NAALFDVDGTIIISQPAIAAFWRDFGKDKPYFDAEHVIHISHGWRTYDAI
Sbjct: 1   MSTSPVSLKVNAALFDVDGTIIISQPAIAAFWRDFGKDKPYFDAEHVIHISHGWRTYDAI 60

Query: 84  AKFAPDFADEEYVNKLEGEIPEKYGEHSIEVPGAVKLCNALNALPKEKWAVATSGTRDMA 143
           AKFAPD+ADEEYVNKLEGEIPEKYGEHSIEVPGAVKLC  LN LPKEKWAVATSGTRDMA
Sbjct: 61  AKFAPDYADEEYVNKLEGEIPEKYGEHSIEVPGAVKLCTDLNKLPKEKWAVATSGTRDMA 120

Query: 144 KKWFDILKIKRPEYFITANDVKQGKPHPEPYLKGRNGLGFPINEQDPSKSKVVVFEDXXX 203
           +KWF IL I+RPEYFITANDVKQGKP PEPYLKGR GLGFPIN++DPSKSKVVVFED   
Sbjct: 121 QKWFKILNIERPEYFITANDVKQGKPFPEPYLKGREGLGFPINKEDPSKSKVVVFEDAPA 180

Query: 204 XXXXXXXXXXXXXXXXTTFDLDFLKEKGCDIIVKNHESIRVGEYNAETDEVELIFDDYLY 263
                           TTFD+DFLKEKGCDIIVKNHESIRVG YN ETDEVE IFDDYLY
Sbjct: 181 GIAAGKAAGCKIIGIATTFDVDFLKEKGCDIIVKNHESIRVGGYNPETDEVEFIFDDYLY 240

Query: 264 AKDD 267
           AKDD
Sbjct: 241 AKDD 244

>CAGL0M12430g complement(1238150..1238899) highly similar to
           sp|P41277 Saccharomyces cerevisiae YIL053w RHR2 or
           sp|P40106 Saccharomyces cerevisiae YER062c GPP2,
           hypothetical start
          Length = 249

 Score =  411 bits (1057), Expect = e-147,   Method: Compositional matrix adjust.
 Identities = 201/242 (83%), Positives = 210/242 (86%)

Query: 26  TKPLSLKINAALFDVDGTIIISQPAIAAFWRDFGKDKPYFDAEHVIHISHGWRTYDAIAK 85
            KP+SLK+NAALFDVDGTIIISQPAIAAFWRDFGKDKPYFDAEHVIHISHGWRTYDAIAK
Sbjct: 4   AKPVSLKVNAALFDVDGTIIISQPAIAAFWRDFGKDKPYFDAEHVIHISHGWRTYDAIAK 63

Query: 86  FAPDFADEEYVNKLEGEIPEKYGEHSIEVPGAVKLCNALNALPKEKWAVATSGTRDMAKK 145
           FAPD+ADEEYVNKLEGEIPEKYGEHSIEVPGAVKLC  LN LPKEKWAVATSGTRDMA+K
Sbjct: 64  FAPDYADEEYVNKLEGEIPEKYGEHSIEVPGAVKLCTDLNKLPKEKWAVATSGTRDMAQK 123

Query: 146 WFDILKIKRPEYFITANDVKQGKPHPEPYLKGRNGLGFPINEQDPSKSKVVVFEDXXXXX 205
           WF  L I RPEYFITANDVKQGKP PEPY+KGR GLG+PIN++DPSKSKVVVFED     
Sbjct: 124 WFKFLNIDRPEYFITANDVKQGKPFPEPYIKGREGLGYPINKEDPSKSKVVVFEDAPAGI 183

Query: 206 XXXXXXXXXXXXXXTTFDLDFLKEKGCDIIVKNHESIRVGEYNAETDEVELIFDDYLYAK 265
                         TTFD+DFLKEKGCDIIVKNHESIRVG YN ETDEVE IFDDYLYAK
Sbjct: 184 AAGQAAGCKIIGIATTFDVDFLKEKGCDIIVKNHESIRVGGYNPETDEVEFIFDDYLYAK 243

Query: 266 DD 267
           DD
Sbjct: 244 DD 245

>Kwal_23.5831
          Length = 249

 Score =  404 bits (1039), Expect = e-144,   Method: Compositional matrix adjust.
 Identities = 198/242 (81%), Positives = 209/242 (86%)

Query: 26  TKPLSLKINAALFDVDGTIIISQPAIAAFWRDFGKDKPYFDAEHVIHISHGWRTYDAIAK 85
           +KPLS K+NAALFDVDGTIIISQPAIAAFWRDFGKDKPYFDAEHVIH SHGWRTYDAIAK
Sbjct: 4   SKPLSFKVNAALFDVDGTIIISQPAIAAFWRDFGKDKPYFDAEHVIHESHGWRTYDAIAK 63

Query: 86  FAPDFADEEYVNKLEGEIPEKYGEHSIEVPGAVKLCNALNALPKEKWAVATSGTRDMAKK 145
           FAPDFADE+Y  +LE EIPEKYGEHSIEVPGAVKLC  LNALPKEKWAVATSGTR MA K
Sbjct: 64  FAPDFADEDYATQLEAEIPEKYGEHSIEVPGAVKLCKDLNALPKEKWAVATSGTRPMASK 123

Query: 146 WFDILKIKRPEYFITANDVKQGKPHPEPYLKGRNGLGFPINEQDPSKSKVVVFEDXXXXX 205
           WF+ L I++PEYFITANDVKQGKP PEPYLKGRNGLGFPINEQDPSKSKV+VFED     
Sbjct: 124 WFEHLGIEKPEYFITANDVKQGKPFPEPYLKGRNGLGFPINEQDPSKSKVIVFEDAPAGI 183

Query: 206 XXXXXXXXXXXXXXTTFDLDFLKEKGCDIIVKNHESIRVGEYNAETDEVELIFDDYLYAK 265
                         TTFDLDFLKEKGCDIIVK+HESIRVG Y+AETDEVE IFDD+LYAK
Sbjct: 184 AAGKAAGCKIVGIATTFDLDFLKEKGCDIIVKDHESIRVGGYDAETDEVEFIFDDFLYAK 243

Query: 266 DD 267
           DD
Sbjct: 244 DD 245

>ADL071C [1670] [Homologous to ScYIL053W (RHR2) - SH; ScYER062C
           (HOR2) - SH] (556136..556897) [762 bp, 253 aa]
          Length = 253

 Score =  376 bits (965), Expect = e-133,   Method: Compositional matrix adjust.
 Identities = 177/241 (73%), Positives = 199/241 (82%)

Query: 27  KPLSLKINAALFDVDGTIIISQPAIAAFWRDFGKDKPYFDAEHVIHISHGWRTYDAIAKF 86
           +P+SLK+N ALFDVDGTIIISQPA+AAFWR+FGKDKPYFDAEHVI  +HGWRTYDAIA F
Sbjct: 9   QPISLKVNGALFDVDGTIIISQPALAAFWREFGKDKPYFDAEHVISATHGWRTYDAIATF 68

Query: 87  APDFADEEYVNKLEGEIPEKYGEHSIEVPGAVKLCNALNALPKEKWAVATSGTRDMAKKW 146
           APD+  EEYV +LEGEIP+KYG+ S+EVPGAV LCNALN LPKEKWAV TSGT +MA KW
Sbjct: 69  APDYLSEEYVTRLEGEIPDKYGKFSVEVPGAVTLCNALNELPKEKWAVGTSGTFEMAHKW 128

Query: 147 FDILKIKRPEYFITANDVKQGKPHPEPYLKGRNGLGFPINEQDPSKSKVVVFEDXXXXXX 206
           FD+L IKRP  FITANDVKQGKPHPEPY+KGRN LGFPINEQ+P  SKV+VFED      
Sbjct: 129 FDVLGIKRPSTFITANDVKQGKPHPEPYIKGRNALGFPINEQNPKGSKVIVFEDAPAGIA 188

Query: 207 XXXXXXXXXXXXXTTFDLDFLKEKGCDIIVKNHESIRVGEYNAETDEVELIFDDYLYAKD 266
                        TTFD+++LKE+GCDIIVK+H SIRVG YN ETDEVE +FDDYLYAKD
Sbjct: 189 AGKAAGCKIVGVATTFDVEYLKERGCDIIVKDHRSIRVGGYNPETDEVEFVFDDYLYAKD 248

Query: 267 D 267
           D
Sbjct: 249 D 249

>CAGL0I05874g complement(558102..558845) highly similar to sp|P41277
           Saccharomyces cerevisiae YIL053w RHR2 or sp|P40106
           Saccharomyces cerevisiae YER062c GPP2, hypothetical
           start
          Length = 247

 Score =  364 bits (935), Expect = e-128,   Method: Compositional matrix adjust.
 Identities = 172/241 (71%), Positives = 197/241 (81%)

Query: 27  KPLSLKINAALFDVDGTIIISQPAIAAFWRDFGKDKPYFDAEHVIHISHGWRTYDAIAKF 86
           +P++L++NAALFDVDGTIIISQPA+AAFWRDFGKDKPYFDAEHVIH+SHGWRTYDAIAKF
Sbjct: 3   EPITLRVNAALFDVDGTIIISQPALAAFWRDFGKDKPYFDAEHVIHVSHGWRTYDAIAKF 62

Query: 87  APDFADEEYVNKLEGEIPEKYGEHSIEVPGAVKLCNALNALPKEKWAVATSGTRDMAKKW 146
           APDFADEE V KLEGEIP+KYG+ +IEV GAVKLCN+ N LPKEKWAVATSGTR+MA KW
Sbjct: 63  APDFADEETVTKLEGEIPDKYGKEAIEVAGAVKLCNSFNELPKEKWAVATSGTREMASKW 122

Query: 147 FDILKIKRPEYFITANDVKQGKPHPEPYLKGRNGLGFPINEQDPSKSKVVVFEDXXXXXX 206
           F +L IK+P YFITANDVK+GKP+PEPYLKGR GLG+PIN   P KSKVVVFED      
Sbjct: 123 FAVLGIKKPTYFITANDVKKGKPNPEPYLKGREGLGYPINTHYPEKSKVVVFEDAPAGIA 182

Query: 207 XXXXXXXXXXXXXTTFDLDFLKEKGCDIIVKNHESIRVGEYNAETDEVELIFDDYLYAKD 266
                        TTF    L+EKGCDI++K+H S+RV  Y+ ETDEV L+FDDYLY +D
Sbjct: 183 AGKAAGCKIIGIATTFSASSLREKGCDIVIKDHRSVRVAGYDKETDEVILVFDDYLYVRD 242

Query: 267 D 267
           D
Sbjct: 243 D 243

>KLLA0C08217g 721753..722523 highly similar to sp|P41277
           Saccharomyces cerevisiae YIL053w RHR2 DL-glycerol
           phosphatase, start by similarity
          Length = 256

 Score =  364 bits (934), Expect = e-128,   Method: Compositional matrix adjust.
 Identities = 170/241 (70%), Positives = 197/241 (81%)

Query: 27  KPLSLKINAALFDVDGTIIISQPAIAAFWRDFGKDKPYFDAEHVIHISHGWRTYDAIAKF 86
           +P+SL++NAALFDVDGT+IISQPAIA FWRDFGKDKPYFD++HVI ISHGWRTYD I +F
Sbjct: 12  QPISLRVNAALFDVDGTLIISQPAIAEFWRDFGKDKPYFDSQHVIDISHGWRTYDVIKQF 71

Query: 87  APDFADEEYVNKLEGEIPEKYGEHSIEVPGAVKLCNALNALPKEKWAVATSGTRDMAKKW 146
           APD+A+EEYV KLEGEIPEK+G+H+IEVPGA KLC  LN LPKEKWAVATSGT +MA KW
Sbjct: 72  APDYANEEYVTKLEGEIPEKFGQHAIEVPGASKLCGELNKLPKEKWAVATSGTYEMAHKW 131

Query: 147 FDILKIKRPEYFITANDVKQGKPHPEPYLKGRNGLGFPINEQDPSKSKVVVFEDXXXXXX 206
           FDIL IKRP  FITANDVK GKPHPEPYLKGRNGL +PIN+++P+ SKV+VFED      
Sbjct: 132 FDILGIKRPSNFITANDVKNGKPHPEPYLKGRNGLSYPINKENPAASKVIVFEDAPAGIL 191

Query: 207 XXXXXXXXXXXXXTTFDLDFLKEKGCDIIVKNHESIRVGEYNAETDEVELIFDDYLYAKD 266
                        TTFD +FL EKGCDI++K+H  +RV  Y+ ETDEVE IFD+YLYAKD
Sbjct: 192 AGKAAGCKIVGIATTFDKEFLIEKGCDIVIKDHTKLRVAAYHPETDEVEFIFDEYLYAKD 251

Query: 267 D 267
           D
Sbjct: 252 D 252

>Scas_704.32
          Length = 247

 Score =  355 bits (912), Expect = e-125,   Method: Compositional matrix adjust.
 Identities = 166/240 (69%), Positives = 197/240 (82%)

Query: 28  PLSLKINAALFDVDGTIIISQPAIAAFWRDFGKDKPYFDAEHVIHISHGWRTYDAIAKFA 87
           P++L++NAALFDVDGTIIISQPA+AAFW+ FG+DKPYFDA+ V H +HGWRTYDAI KFA
Sbjct: 4   PIALRVNAALFDVDGTIIISQPALAAFWKHFGEDKPYFDADLVTHATHGWRTYDAIEKFA 63

Query: 88  PDFADEEYVNKLEGEIPEKYGEHSIEVPGAVKLCNALNALPKEKWAVATSGTRDMAKKWF 147
           PD+AD EYV +LEGEIP K+G+H++EVPGAVKLCN  N LPKE+WAVATSGT +MA KWF
Sbjct: 64  PDWADREYVTQLEGEIPTKFGQHALEVPGAVKLCNEFNKLPKERWAVATSGTFEMASKWF 123

Query: 148 DILKIKRPEYFITANDVKQGKPHPEPYLKGRNGLGFPINEQDPSKSKVVVFEDXXXXXXX 207
           ++LKI+RP  FITANDV++GKPHP+PYLKGRNGLGFPIN  +PSKSKVVVFED       
Sbjct: 124 ELLKIERPTNFITANDVERGKPHPDPYLKGRNGLGFPINATNPSKSKVVVFEDAPAGIES 183

Query: 208 XXXXXXXXXXXXTTFDLDFLKEKGCDIIVKNHESIRVGEYNAETDEVELIFDDYLYAKDD 267
                       TTFD +FLKEKGCD+IV NHESI++  Y  ETDE+EL+F DYL+AKDD
Sbjct: 184 GKAAGCKIVGVATTFDEEFLKEKGCDLIVSNHESIKLNGYYPETDEIELVFHDYLFAKDD 243

>Sklu_2394.3 YHR043C, Contig c2394 2120-2851 reverse complement
          Length = 243

 Score =  115 bits (289), Expect = 4e-31,   Method: Compositional matrix adjust.
 Identities = 84/238 (35%), Positives = 119/238 (50%), Gaps = 18/238 (7%)

Query: 31  LKINAALFDVDGTIIISQPAIAAFWRDFGKDKPYFDAEHVIHISHGWRTYDAIAKFAP-- 88
            K+N  LFD+DGTI+ +  A  + W++  K K   D E +   SHG RT +  +KF P  
Sbjct: 4   FKVNLCLFDLDGTIVSTTIAAESAWKELCK-KHGVDPEELFKCSHGARTSEIFSKFFPSI 62

Query: 89  DFADEEYVNKLEGEIPEKYGEHSIEVPGAVKLCNALNA--------LPKEKWAVATSGTR 140
           D  D + V KLE  I   Y +    +PGA +L  +L+           K KWA+ TSG+ 
Sbjct: 63  DNTDNQAVKKLELAIAHDYLDSVGLIPGASELLLSLDKCSDPPFDNFSKRKWAIVTSGSS 122

Query: 141 DMAKKWFDIL--KIKRPEYFITANDVKQGKPHPEPYLKGRNGLGFPINEQDPSKSKVVVF 198
           D+A  WFD +   I +P+ FITA DV +GKP PE Y K R+ L    + + P   ++VVF
Sbjct: 123 DLAFSWFDTILQHIGKPDVFITAFDVVKGKPDPEGYSKARDQLSKIWSLEFP---EIVVF 179

Query: 199 EDXXXXXXXXXXXXXXXXXXXTTFDLDFLKEKGCDIIVKNHESIRVGEYNAETDEVEL 256
           ED                   +T+  D L E G D +V +  ++ V E N   DE+ L
Sbjct: 180 EDAPVGIKAGKEIGAITVGITSTYSKDVLFEAGADYVVSDLTNVIV-ERNTR-DEIVL 235

>CAGL0D04092g 405613..406368 similar to sp|P38773 Saccharomyces
           cerevisiae YHR043c DOG2 2-deoxyglucose-6-phosphate
           phosphatase, hypothetical start
          Length = 251

 Score =  109 bits (272), Expect = 1e-28,   Method: Compositional matrix adjust.
 Identities = 78/236 (33%), Positives = 115/236 (48%), Gaps = 15/236 (6%)

Query: 33  INAALFDVDGTIIISQPAIAAFWRDFGKDKPYFDAEHVIHISHGWRTYDAIAKFAP--DF 90
           ++  LFD+DGTI+ +  A  + WR     K   D E +   SHG RT + +AKF P  D 
Sbjct: 11  VDVCLFDLDGTIVSTTVAAESAWRMLCA-KEGVDPEELFKFSHGVRTSEVLAKFFPNIDN 69

Query: 91  ADEEYVNKLEGEIPEKYGEHSIEVPGAVKLCNALNA--------LPKEKWAVATSGTRDM 142
            D +   +LE  +   + +    +PGA  L   L+           + KWA+ TSG+ D+
Sbjct: 70  TDNKMTRELELSMANNFLDTVSLIPGAKDLLLTLDKDTARQGAKFNERKWAIVTSGSPDL 129

Query: 143 AKKWF-DILK-IKRPEYFITANDVKQGKPHPEPYLKGRNGLGFPINEQDPSKSKVVVFED 200
           A  WF  ILK + +P+ FITA DV +GKP PE Y K +  L   +  +  S +  VVFED
Sbjct: 130 AFSWFKTILKEVGKPDVFITAFDVTKGKPDPEGYAKAKKLLCERLQYESASATS-VVFED 188

Query: 201 XXXXXXXXXXXXXXXXXXXTTFDLDFLKEKGCDIIVKNHESIRVGEYNAETDEVEL 256
                              +T+DL  L + G D +VK+   + V + N E D++ L
Sbjct: 189 APAGIKAGKAMGAITVGITSTYDLQTLIDAGADYVVKDLTQVEVLK-NTEGDQITL 243

>CAGL0M12925g 1274919..1275659 similar to sp|P38773 Saccharomyces
           cerevisiae YHR043c DOG2 2-deoxyglucose-6-phosphate
           phosphatase, hypothetical start
          Length = 246

 Score =  104 bits (260), Expect = 8e-27,   Method: Compositional matrix adjust.
 Identities = 73/225 (32%), Positives = 106/225 (47%), Gaps = 14/225 (6%)

Query: 33  INAALFDVDGTIIISQPAIAAFWRDFGKDKPYFDAEHVIHISHGWRTYDAIAKFAPDF-- 90
           ++  LFD+DGTI+ +  A+   W+    +    D E +   SHG RT +  AKF PD   
Sbjct: 7   VDLCLFDLDGTIVSTTRAVEMTWKKLCAEHD-VDPEELFRFSHGTRTGEVFAKFFPDIDN 65

Query: 91  ADEEYVNKLEGEIPEKYGEHSIEVPGAVKLCNALN-------ALPKEKWAVATSGTRDMA 143
                    E  I +     S+ +PGA +L   L+       A+ + KWA+ TSG+ ++ 
Sbjct: 66  TGNRAAVAFELSIADDLSLISL-IPGAQELLLKLDKNTTDGSAVGERKWAIVTSGSPELT 124

Query: 144 KKWFD-ILK-IKRPEYFITANDVKQGKPHPEPYLKGRNGLGFPINEQDPSKSKVVVFEDX 201
             WFD +LK + RP  FI+  DV +GKP PE Y  GRN L   +   D S ++ VVFED 
Sbjct: 125 LSWFDNVLKEVGRPPVFISGADVAKGKPDPEGYYTGRNLLCQKLG-LDASHARTVVFEDA 183

Query: 202 XXXXXXXXXXXXXXXXXXTTFDLDFLKEKGCDIIVKNHESIRVGE 246
                              T+D D L   G D +V +   ++V E
Sbjct: 184 PVGIMAGKAIGAITVGIAGTYDKDLLYSAGADYVVSDLNQVKVIE 228

>YHR043C (DOG2) [2331] chr8 complement(192797..193537)
           2-Deoxyglucose-6-phosphate phosphatase, converts
           2-deoxy-D-glucose 6-phosphate to 2-deoxy-D-glucose and
           orthophosphate [741 bp, 246 aa]
          Length = 246

 Score = 99.8 bits (247), Expect = 5e-25,   Method: Compositional matrix adjust.
 Identities = 71/227 (31%), Positives = 109/227 (48%), Gaps = 12/227 (5%)

Query: 33  INAALFDVDGTIIISQPAIAAFWRDFGKDKPYFDAEHVIHISHGWRTYDAIAKFAP--DF 90
           ++  LFD+DGTI+ +  A  + W+   +       E   H SHG R+ + + KF P  D 
Sbjct: 6   VDLCLFDLDGTIVSTTTAAESAWKKLCRQHGVDPVELFKH-SHGARSQEMMKKFFPKLDN 64

Query: 91  ADEEYVNKLEGEIPEKYGEHSIEVPGAVKLCNALNA-------LPKEKWAVATSGTRDMA 143
            D + V  LE ++ + Y +    +PGA  L  +L+        LP+ KWA+ TSG+  +A
Sbjct: 65  TDNKGVLALEKDMADNYLDTVSLIPGAENLLLSLDVDTETQKKLPERKWAIVTSGSPYLA 124

Query: 144 KKWFD-ILK-IKRPEYFITANDVKQGKPHPEPYLKGRNGLGFPINEQDPSKSKVVVFEDX 201
             WF+ ILK + +P+ FIT  DVK GKP PE Y + R+ L   +        K VVFED 
Sbjct: 125 FSWFETILKNVGKPKVFITGFDVKNGKPDPEGYSRARDLLRQDLQLTGKQDLKYVVFEDA 184

Query: 202 XXXXXXXXXXXXXXXXXXTTFDLDFLKEKGCDIIVKNHESIRVGEYN 248
                             +++D   L + G D +V +   + V + N
Sbjct: 185 PVGIKAGKAMGAITVGITSSYDKSVLFDAGADYVVCDLTQVSVVKNN 231

>KLLA0C11143g 956474..957280 similar to sp|P38773 Saccharomyces
           cerevisiae YHR043c DOG2 2-deoxyglucose-6-phosphate
           phosphatase, start by similarity
          Length = 268

 Score =  100 bits (248), Expect = 8e-25,   Method: Compositional matrix adjust.
 Identities = 79/244 (32%), Positives = 114/244 (46%), Gaps = 17/244 (6%)

Query: 30  SLKINAALFDVDGTIIISQPAIAAFWRDFGKDKPYFDAEHVIHISHGWRTYDAIAKFAP- 88
           S+ ++  LFD+DGT++ S  A    W     DK   D   +  +SHG RT + +AKF P 
Sbjct: 3   SIAVDYVLFDLDGTLVSSTDAAEEAWNKLC-DKYGVDYSTLSKVSHGSRTAEILAKFFPN 61

Query: 89  -DFADEEYVNKLEGEIPEKYGEHSIEVPGAVKLCNALN----ALPKE-----KWAVATSG 138
            D  + + V + E  I   Y +    +PG++ L  +L+    A P E     KWAV TSG
Sbjct: 62  VDNTNNQAVKEFELSIANDYMDIVCLIPGSIDLLISLDRPTGAHPGEVFHHRKWAVVTSG 121

Query: 139 TRDMAKKWFDIL--KIKRPEYFITANDVKQGKPHPEPYLKGRNGLGFPINEQDPSKSKVV 196
           +  +A  WFD L   IK+PE FITA DV +GKP P  +      L   I + D  + + V
Sbjct: 122 SPWVAHAWFDNLLKSIKKPEVFITAFDVSKGKPDPAGFALATKRLK-EIWQDDRKEVRTV 180

Query: 197 VFEDXXXXXXXXXXXXXXXXXXXTTFDLDFLKEKGCDIIVKNHESIRVGEYNAETDEVEL 256
           VFED                   +T+D + L   G D +V++   + +   N   DE  L
Sbjct: 181 VFEDAPVGVQAGKANGSIVVALTSTYDKELLFAAGADYVVEDLSQVCLQSNN--KDETVL 238

Query: 257 IFDD 260
              D
Sbjct: 239 TITD 242

>Scas_690.30
          Length = 259

 Score = 99.4 bits (246), Expect = 9e-25,   Method: Compositional matrix adjust.
 Identities = 71/226 (31%), Positives = 108/226 (47%), Gaps = 13/226 (5%)

Query: 30  SLKINAALFDVDGTIIISQPAIAAFWRDFGKDKPYFDAEHVIHISHGWRTYDAIAKFAP- 88
           S  ++  LFD+DGT++ +  A  A W D   +      E   H SHG +T + +A++ P 
Sbjct: 5   SFNVDVCLFDLDGTLVNTIKASEAVWTDLCNEHGVNPQELFKH-SHGVKTSEVLAEWFPM 63

Query: 89  -DFADEEYVNKLEGEIPEKYGEHSIEVPGAVKLCNALN-------ALPKEKWAVATSGTR 140
            D  D++ V  LE  +   +      VPGA+ L   L+           +KWA+ TSG+ 
Sbjct: 64  LDNTDDKAVKYLEESMGRDHLSSVFAVPGAIDLLKQLDIDTDTGKKFKDKKWAIVTSGST 123

Query: 141 DMAKKWFD--ILKIKRPEYFITANDVKQGKPHPEPYLKGRNGLGFPINEQDPSKSKVVVF 198
            +A  WF   + ++++PE F+TA DVK GKP PE Y K R+ L    N  D   +K VVF
Sbjct: 124 YIAFGWFKSILSELEKPEVFVTAFDVKNGKPDPEGYSKARDELCKTWN-FDVKTAKSVVF 182

Query: 199 EDXXXXXXXXXXXXXXXXXXXTTFDLDFLKEKGCDIIVKNHESIRV 244
           ED                   +T+D   L + G D +V++   I +
Sbjct: 183 EDAPVGIQAGKAMGAITVGITSTYDKKVLFDAGADYVVRDLSQITI 228

>AAL123W [64] [Homologous to ScYHR043C (DOG2) - SH; ScYHR044C (DOG1)
           - SH] complement(131449..132318) [870 bp, 289 aa]
          Length = 289

 Score =  100 bits (248), Expect = 1e-24,   Method: Compositional matrix adjust.
 Identities = 67/226 (29%), Positives = 106/226 (46%), Gaps = 16/226 (7%)

Query: 31  LKINAALFDVDGTIIISQPAIAAFWRDFGKDKPYFDAEHVIHISHGWRTYDAIAKFAPDF 90
           + ++  LFD+DGTI+ +  A+ A W+  G+     DA  +   SHG R  +   ++ PD 
Sbjct: 4   ITVDVCLFDLDGTIVDTTDAVEAAWQKVGR-AHQVDAAKIRRNSHGRRASETFKQYFPDA 62

Query: 91  ADEEYVNKLEGEIPEKYGEHSIE-VPGAVKL---------CNALNALPKEKWAVATSGTR 140
            ++  V + E  +  +   H +  +PGA  L         CN        +WA+ TS T 
Sbjct: 63  DNDAAVKEFEHALVSQ--SHYVGLIPGANDLLLTLDRPSGCNPGEVFRDNRWAIVTSATP 120

Query: 141 DMAKKWFDIL--KIKRPEYFITANDVKQGKPHPEPYLKGRNGLGFPINEQDPSKSKVVVF 198
            +A+ WF+ L  K+K P+ FIT+ DV +GKP PE Y K ++ L   I   +  K + VVF
Sbjct: 121 SLARSWFNTLLKKVKPPKVFITSADVAKGKPDPEGYQKAKDQLA-DILGLNKDKVRAVVF 179

Query: 199 EDXXXXXXXXXXXXXXXXXXXTTFDLDFLKEKGCDIIVKNHESIRV 244
           ED                   +T+  D L   G D +V++   + V
Sbjct: 180 EDSALGIRAAKAMGAIAVGITSTYSKDVLYRSGADYVVEDLAQVCV 225

>YHR044C (DOG1) [2332] chr8 complement(194060..194800)
           2-Deoxyglucose-6-phosphate phosphatase [741 bp, 246 aa]
          Length = 246

 Score = 96.3 bits (238), Expect = 1e-23,   Method: Compositional matrix adjust.
 Identities = 72/224 (32%), Positives = 105/224 (46%), Gaps = 12/224 (5%)

Query: 36  ALFDVDGTIIISQPAIAAFWRDFGKDKPYFDAEHVIHISHGWRTYDAIAKFAP--DFADE 93
            LFD+DGTI+ +  A    W     +     +E   H SHG RT + + +F P  D  D 
Sbjct: 9   CLFDLDGTIVSTTVAAEKAWTKLCYEYGVDPSELFKH-SHGARTQEVLRRFFPKLDDTDN 67

Query: 94  EYVNKLEGEIPEKYGEHSIEVPGAVKLCNALNA-------LPKEKWAVATSGTRDMAKKW 146
           + V  LE +I   Y +    +PGA  L  +L+        LP+ KWA+ TSG+  +A  W
Sbjct: 68  KGVLALEKDIAHSYLDTVSLIPGAENLLLSLDVDTETQKKLPERKWAIVTSGSPYLAFSW 127

Query: 147 FD-ILK-IKRPEYFITANDVKQGKPHPEPYLKGRNGLGFPINEQDPSKSKVVVFEDXXXX 204
           F+ ILK + +P+ FIT  DVK GKP PE Y + R+ L   +        K VVFED    
Sbjct: 128 FETILKNVGKPKVFITGFDVKNGKPDPEGYSRARDLLRQDLQLTGKQDLKYVVFEDAPVG 187

Query: 205 XXXXXXXXXXXXXXXTTFDLDFLKEKGCDIIVKNHESIRVGEYN 248
                          +++D   L + G D +V +   + V + N
Sbjct: 188 IKAGKAMGAITVGITSSYDKSVLFDAGADYVVCDLTQVSVVKNN 231

>Scas_690.31
          Length = 244

 Score = 95.9 bits (237), Expect = 2e-23,   Method: Compositional matrix adjust.
 Identities = 73/224 (32%), Positives = 109/224 (48%), Gaps = 11/224 (4%)

Query: 30  SLKINAALFDVDGTIIISQPAIAAFWRDFGKDKPYFDAEHVIHISHGWRTYDAIAKFAP- 88
           +  ++  LFD+DGTI+ +  A+   W  F K K   +AE +   SHG R+ + +A+F P 
Sbjct: 3   TFTVDLCLFDLDGTIVSTTIAVERAWIKFCK-KHNVNAEELFEHSHGARSGEIMARFFPH 61

Query: 89  -DFADEEYVNKLEGEIPEKYGEHSIEVPGAVKLCNALNALP-----KEKWAVATSGTRDM 142
            D  D +   +LE  +     +    +PG+ KL  AL+        K KWA+ TSG+  +
Sbjct: 62  VDNTDNKATKELELSMAYDNIDTVSLIPGSEKLLLALDKATTKDATKRKWAIVTSGSPYL 121

Query: 143 AKKWFD-ILK-IKRPEYFITANDVKQGKPHPEPYLKGRNGLGFPINEQDPSKSKVVVFED 200
           A  WFD ILK + +P+ FIT  DV++GKP PE Y K R+ L       D    + VVFED
Sbjct: 122 AFSWFDTILKDVGKPDVFITGFDVEKGKPDPEGYGKARDQLCKNWG-PDNKHVRTVVFED 180

Query: 201 XXXXXXXXXXXXXXXXXXXTTFDLDFLKEKGCDIIVKNHESIRV 244
                               T+D + L + G D +V +   + V
Sbjct: 181 APVGIKAGKAIGAITVGITFTYDKNLLFDAGADYVVADLTHVSV 224

>Scas_694.40
          Length = 597

 Score = 30.8 bits (68), Expect = 1.2,   Method: Compositional matrix adjust.
 Identities = 12/31 (38%), Positives = 18/31 (58%)

Query: 107 YGEHSIEVPGAVKLCNALNALPKEKWAVATS 137
           +GEH I V  A+ +CN +N    E + + TS
Sbjct: 271 FGEHDILVKNAMSICNTINTSDLEHYCLFTS 301

>Kwal_55.20214
          Length = 1275

 Score = 29.3 bits (64), Expect = 4.0,   Method: Composition-based stats.
 Identities = 20/67 (29%), Positives = 30/67 (44%), Gaps = 3/67 (4%)

Query: 40  VDGTIIISQPAIAAFWRDFGKDKPYFDAEHVIHISHGWRTYDAIAKFAPDFADEEYVNKL 99
           +D +I+I  P    F   FG D  Y  A+ +I    G  +  +I KF  +  D  Y+  L
Sbjct: 926 IDDSIVIPAPLGTTFQLLFGNDTSY--AKQIIE-KQGNHSLSSIPKFRNNTRDFNYIKPL 982

Query: 100 EGEIPEK 106
            G +  K
Sbjct: 983 NGPVGPK 989

>KLLA0B05995g 535752..537224 some similarities with
           ca|CA0656|IPF12470 Candida albicans unknown function,
           hypothetical start
          Length = 490

 Score = 28.9 bits (63), Expect = 4.5,   Method: Compositional matrix adjust.
 Identities = 12/37 (32%), Positives = 20/37 (54%)

Query: 115 PGAVKLCNALNALPKEKWAVATSGTRDMAKKWFDILK 151
           PG  +L   +  +P E W V  S  +D  +K +D++K
Sbjct: 104 PGEYRLTMGVRPMPNEYWLVFESTLKDRIEKKWDVIK 140

>Scas_714.22
          Length = 221

 Score = 28.5 bits (62), Expect = 4.7,   Method: Compositional matrix adjust.
 Identities = 38/153 (24%), Positives = 63/153 (41%), Gaps = 31/153 (20%)

Query: 33  INAALFDVDGTIIISQPAIAAFWRDFGKDKPYFDAEHVIHISHGWRTYDAIAKFAPDFAD 92
           I A +FD+DGT+ + QP +    R+               I    ++ D +A +  D + 
Sbjct: 18  IKAVVFDMDGTLCLPQPWMFPAMRE--------------AIGLHDKSVDILA-YIDDMST 62

Query: 93  EEY---VNKLEGEIPEKYGEHSIEVPGAVKLCN--ALNALPKEKWAVATSGTRDMAKK-W 146
           EE     N+   E+ ++  +     PG V+L     LN + K         TR++ K   
Sbjct: 63  EEAKLEANRQLEEVEDRAMKQMEPQPGLVELLRFLTLNNMSK------NICTRNVIKPVQ 116

Query: 147 FDILKIKRPEY----FITANDVKQGKPHPEPYL 175
           + I      EY    +I   D +  KP+P+P L
Sbjct: 117 YLISNFVPKEYSNFEYIVTRDFRPAKPNPDPLL 149

>CAGL0A01386g 136693..140001 some similarities with sp|P08640
           Saccharomyces cerevisiae YIR019c STA1, hypothetical
           start
          Length = 1102

 Score = 28.9 bits (63), Expect = 4.9,   Method: Composition-based stats.
 Identities = 13/29 (44%), Positives = 15/29 (51%)

Query: 239 HESIRVGEYNAETDEVELIFDDYLYAKDD 267
           H    VG Y   T+E+   FD YLY  DD
Sbjct: 260 HSKFMVGFYPPNTEEITYDFDGYLYMLDD 288

>YDL107W (MSS2) [762] chr4 (268921..269976) Protein involved in
           translocation of the Cox2p C-terminal end across the
           mitochondrial inner membrane [1056 bp, 351 aa]
          Length = 351

 Score = 28.1 bits (61), Expect = 7.3,   Method: Compositional matrix adjust.
 Identities = 17/43 (39%), Positives = 23/43 (53%), Gaps = 1/43 (2%)

Query: 78  RTYDAIAKFAPDFADEEYVNKLEGEIPEKYGEHSI-EVPGAVK 119
           +TYD   K+  +F   E   KL GE+  K GE  I +V G +K
Sbjct: 169 KTYDKAEKYYQEFLKLENSTKLAGEVHGKLGEIQIKQVNGFLK 211

  Database: blastdb
    Posted date:  Apr 3, 2006  3:33 PM
  Number of letters in database: 16,596,109
  Number of sequences in database:  34,618
  
Lambda     K      H
   0.318    0.137    0.415 

Gapped
Lambda     K      H
   0.267   0.0410    0.140 

Matrix: BLOSUM62
Gap Penalties: Existence: 11, Extension: 1
Number of Sequences: 34618
Number of Hits to DB: 8,871,729
Number of extensions: 377373
Number of successful extensions: 903
Number of sequences better than 10.0: 27
Number of HSP's gapped: 864
Number of HSP's successfully gapped: 27
Length of query: 267
Length of database: 16,596,109
Length adjustment: 100
Effective length of query: 167
Effective length of database: 13,134,309
Effective search space: 2193429603
Effective search space used: 2193429603
Neighboring words threshold: 11
Window for multiple hits: 40
X1: 16 ( 7.3 bits)
X2: 38 (14.6 bits)
X3: 64 (24.7 bits)
S1: 41 (21.7 bits)
S2: 60 (27.7 bits)