Hit NameLength (aa)HSP LengthHSP ScoreHSP Significance
YIL051C (MMF1)1451447551e-105
Scas_704.341481446101e-82
KLLA0C08349g1401295259e-70
Sklu_2193.31281275203e-69
ADL077C1421365197e-69
Kwal_23.58041411445181e-68
Scas_715.531281264971e-65
CAGL0M12386g1421314772e-62
YER057C (HMF1)1291274414e-57
Kwal_23.28071291071556e-14
Kwal_55.212471341001357e-11
Kwal_47.165901261001331e-10
Scas_506.36891291355e-10
KLLA0B14817g1311201295e-10
KLLA0E03894g1371141209e-09
CAGL0M04521g688891152e-07
YLR143W685821082e-06
Kwal_27.11310688821055e-06
AGL164W686971003e-05
KLLA0D16984g696961003e-05
Scas_690.333347680.32
CAGL0M04191g60171650.88
ADR212C82180641.1
Scas_712.458659604.5
Scas_715.33101854594.9
YNL163C (RIA1)111033595.5
YNL018C61236586.8
BLASTP 2.2.26 [Sep-21-2011]

Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, 
Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), 
"Gapped BLAST and PSI-BLAST: a new generation of protein database search
programs",  Nucleic Acids Res. 25:3389-3402.

Reference for compositional score matrix adjustment: Altschul, Stephen F., 
John C. Wootton, E. Michael Gertz, Richa Agarwala, Aleksandr Morgulis,
Alejandro A. Schaffer, and Yi-Kuo Yu (2005) "Protein database searches
using compositionally adjusted substitution matrices", FEBS J. 272:5101-5109.

Query= YIL051C
         (144 letters)

Database: blastdb 
           34,618 sequences; 16,596,109 total letters

Searching..................................................done

                                                                 Score    E
Sequences producing significant alignments:                      (bits) Value

YIL051C (MMF1) [2616] chr9 complement(257842..258279) Protein im...   295   e-105
Scas_704.34                                                           239   1e-82
KLLA0C08349g 731629..732051 highly similar to sp|P40185 Saccharo...   206   9e-70
Sklu_2193.3 YIL051C, Contig c2193 5846-6232 reverse complement        204   3e-69
ADL077C [1664] [Homologous to ScYIL051C (MMF1) - SH; ScYER057C (...   204   7e-69
Kwal_23.5804                                                          204   1e-68
Scas_715.53                                                           196   1e-65
CAGL0M12386g 1234993..1235421 similar to sp|P40037 Saccharomyces...   188   2e-62
YER057C (HMF1) [1487] chr5 complement(270735..271124) Protein th...   174   4e-57
Kwal_23.2807                                                           64   6e-14
Kwal_55.21247                                                          57   7e-11
Kwal_47.16590                                                          56   1e-10
Scas_506.3                                                             57   5e-10
KLLA0B14817g 1301705..1302100 similar to sp|Q8XCD0 Escherichia c...    54   5e-10
KLLA0E03894g complement(364475..364888) some similarities with s...    51   9e-09
CAGL0M04521g 496157..498223 similar to tr|Q12429 Saccharomyces c...    49   2e-07
YLR143W (YLR143W) [3552] chr12 (427330..429387) Protein containi...    46   2e-06
Kwal_27.11310                                                          45   5e-06
AGL164W [4148] [Homologous to ScYLR143W - SH] complement(388842....    43   3e-05
KLLA0D16984g 1439669..1441759 similar to sgd|S0004133 Saccharomy...    43   3e-05
Scas_690.3                                                             31   0.32 
CAGL0M04191g complement(461446..463251) similar to sp|P32329 Sac...    30   0.88 
ADR212C [1953] [Homologous to ScYKR079C - SH] (1074196..1076661)...    29   1.1  
Scas_712.4                                                             28   4.5  
Scas_715.33                                                            27   4.9  
YNL163C (RIA1) [4433] chr14 complement(326741..330073) GTPase re...    27   5.5  
YNL018C (YNL018C) [4569] chr14 complement(599934..601772) Protei...    27   6.8  

>YIL051C (MMF1) [2616] chr9 complement(257842..258279) Protein
           important for maintenance of mitochondrial DNA, may be
           involved in isoleucine-dependent transaminase activity,
           member of the p14.5 family [438 bp, 145 aa]
          Length = 145

 Score =  295 bits (755), Expect = e-105,   Method: Compositional matrix adjust.
 Identities = 144/144 (100%), Positives = 144/144 (100%)

Query: 1   MFLRNSVLRTAPVLRRGITTLTPVSTKLAPPAAASYSQAMKANNFVYVSGQIPYTPDNKP 60
           MFLRNSVLRTAPVLRRGITTLTPVSTKLAPPAAASYSQAMKANNFVYVSGQIPYTPDNKP
Sbjct: 1   MFLRNSVLRTAPVLRRGITTLTPVSTKLAPPAAASYSQAMKANNFVYVSGQIPYTPDNKP 60

Query: 61  VQGSISEKAEQVFQNVKNILAESNSSLDNIVKVNVFLADMKNFAEFNSVYAKHFHTHKPA 120
           VQGSISEKAEQVFQNVKNILAESNSSLDNIVKVNVFLADMKNFAEFNSVYAKHFHTHKPA
Sbjct: 61  VQGSISEKAEQVFQNVKNILAESNSSLDNIVKVNVFLADMKNFAEFNSVYAKHFHTHKPA 120

Query: 121 RSCVGVASLPLNVDLEMEVIAVEK 144
           RSCVGVASLPLNVDLEMEVIAVEK
Sbjct: 121 RSCVGVASLPLNVDLEMEVIAVEK 144

>Scas_704.34
          Length = 148

 Score =  239 bits (610), Expect = 1e-82,   Method: Compositional matrix adjust.
 Identities = 114/144 (79%), Positives = 129/144 (89%)

Query: 1   MFLRNSVLRTAPVLRRGITTLTPVSTKLAPPAAASYSQAMKANNFVYVSGQIPYTPDNKP 60
           MFLRN++LR+   + R +TTLTPVSTKLAPPAAASYSQAMKANNFVYVSGQIPYTP+NKP
Sbjct: 1   MFLRNTILRSRQPIVRSLTTLTPVSTKLAPPAAASYSQAMKANNFVYVSGQIPYTPENKP 60

Query: 61  VQGSISEKAEQVFQNVKNILAESNSSLDNIVKVNVFLADMKNFAEFNSVYAKHFHTHKPA 120
           V+G+IS+KAEQVFQN+KNIL ES SS+D IVKVNVFLAD+ NF EFN VYAK+F+ HKPA
Sbjct: 61  VEGTISDKAEQVFQNIKNILKESGSSMDKIVKVNVFLADINNFKEFNGVYAKYFNVHKPA 120

Query: 121 RSCVGVASLPLNVDLEMEVIAVEK 144
           RSCV V  LPLNVDLE+EVIAVEK
Sbjct: 121 RSCVAVKDLPLNVDLEVEVIAVEK 144

>KLLA0C08349g 731629..732051 highly similar to sp|P40185
           Saccharomyces cerevisiae YIL051c MMD1 required for
           maintenance of mitochondrial DNA, start by similarity
          Length = 140

 Score =  206 bits (525), Expect = 9e-70,   Method: Compositional matrix adjust.
 Identities = 97/129 (75%), Positives = 113/129 (87%)

Query: 16  RGITTLTPVSTKLAPPAAASYSQAMKANNFVYVSGQIPYTPDNKPVQGSISEKAEQVFQN 75
           R + TLTPV T+LAPP AASYSQA+K NN ++VSGQIPYT +NKPV+GSI++KAEQV QN
Sbjct: 11  RRMNTLTPVKTQLAPPPAASYSQAIKVNNLIFVSGQIPYTAENKPVEGSIADKAEQVIQN 70

Query: 76  VKNILAESNSSLDNIVKVNVFLADMKNFAEFNSVYAKHFHTHKPARSCVGVASLPLNVDL 135
           VKNIL E+NS LD IVKVN+FLAD+ +FAEFNSVYAK+F+ HKPARSCV   +LPLNVDL
Sbjct: 71  VKNILVEANSDLDKIVKVNIFLADINSFAEFNSVYAKYFNVHKPARSCVAAKALPLNVDL 130

Query: 136 EMEVIAVEK 144
           EMEVIAVEK
Sbjct: 131 EMEVIAVEK 139

>Sklu_2193.3 YIL051C, Contig c2193 5846-6232 reverse complement
          Length = 128

 Score =  204 bits (520), Expect = 3e-69,   Method: Compositional matrix adjust.
 Identities = 99/127 (77%), Positives = 114/127 (89%)

Query: 18  ITTLTPVSTKLAPPAAASYSQAMKANNFVYVSGQIPYTPDNKPVQGSISEKAEQVFQNVK 77
           ++TLTPV T+LAPP AASYSQA+K NN V+VSGQIPYT +NKPV+GSI++KAEQV QNVK
Sbjct: 1   MSTLTPVRTQLAPPPAASYSQAIKVNNMVFVSGQIPYTHENKPVEGSIADKAEQVIQNVK 60

Query: 78  NILAESNSSLDNIVKVNVFLADMKNFAEFNSVYAKHFHTHKPARSCVGVASLPLNVDLEM 137
           NIL E+NSSL+ IVKVNVFLAD+ +FAEFN VYAK+F+ HKPARSCV V SLPLNVDLEM
Sbjct: 61  NILEEANSSLNKIVKVNVFLADINDFAEFNGVYAKYFNEHKPARSCVAVKSLPLNVDLEM 120

Query: 138 EVIAVEK 144
           EVIAVEK
Sbjct: 121 EVIAVEK 127

>ADL077C [1664] [Homologous to ScYIL051C (MMF1) - SH; ScYER057C
           (HMF1) - SH] (549526..549954) [429 bp, 142 aa]
          Length = 142

 Score =  204 bits (519), Expect = 7e-69,   Method: Compositional matrix adjust.
 Identities = 96/136 (70%), Positives = 113/136 (83%)

Query: 9   RTAPVLRRGITTLTPVSTKLAPPAAASYSQAMKANNFVYVSGQIPYTPDNKPVQGSISEK 68
           +TA VL R +++LTPV T  APP AASYSQAM+AN  V+VSGQIPYTPDNKPV+GS+++K
Sbjct: 6   QTATVLARSMSSLTPVRTTAAPPPAASYSQAMRANGMVFVSGQIPYTPDNKPVEGSVADK 65

Query: 69  AEQVFQNVKNILAESNSSLDNIVKVNVFLADMKNFAEFNSVYAKHFHTHKPARSCVGVAS 128
            EQV  NV+N+L  SNS LD + KVNVFLADM  FAEFNSVYAK+F  HKPARSCV V +
Sbjct: 66  TEQVIANVRNVLEASNSGLDRVAKVNVFLADMAYFAEFNSVYAKYFGEHKPARSCVAVRA 125

Query: 129 LPLNVDLEMEVIAVEK 144
           LPLNVDLEMEVIA+E+
Sbjct: 126 LPLNVDLEMEVIALER 141

>Kwal_23.5804
          Length = 141

 Score =  204 bits (518), Expect = 1e-68,   Method: Compositional matrix adjust.
 Identities = 97/144 (67%), Positives = 119/144 (82%), Gaps = 4/144 (2%)

Query: 1   MFLRNSVLRTAPVLRRGITTLTPVSTKLAPPAAASYSQAMKANNFVYVSGQIPYTPDNKP 60
           MFLRN+   T     R ++TLTPV T+L+PP AASYSQAM+ N  V+VSGQIPYT +NK 
Sbjct: 1   MFLRNAARNTF----RSMSTLTPVRTQLSPPPAASYSQAMRVNKMVFVSGQIPYTAENKR 56

Query: 61  VQGSISEKAEQVFQNVKNILAESNSSLDNIVKVNVFLADMKNFAEFNSVYAKHFHTHKPA 120
           V+G+I++KAEQV QNV+NIL E+NS LD IVKVN+FLAD+K+FAEFN VY K+F+ HKPA
Sbjct: 57  VEGTIADKAEQVIQNVRNILEEANSGLDKIVKVNIFLADIKDFAEFNGVYGKYFNEHKPA 116

Query: 121 RSCVGVASLPLNVDLEMEVIAVEK 144
           RSCV V +LPL+VDLEMEV+AVEK
Sbjct: 117 RSCVAVKALPLDVDLEMEVVAVEK 140

>Scas_715.53
          Length = 128

 Score =  196 bits (497), Expect = 1e-65,   Method: Compositional matrix adjust.
 Identities = 92/126 (73%), Positives = 111/126 (88%)

Query: 18  ITTLTPVSTKLAPPAAASYSQAMKANNFVYVSGQIPYTPDNKPVQGSISEKAEQVFQNVK 77
           +TTLTPV+ K AP AAASYS AMKANN +++SGQIP T +NKPV+GSI++KAEQV QN+K
Sbjct: 1   MTTLTPVTCKNAPSAAASYSHAMKANNLIFLSGQIPMTAENKPVEGSIADKAEQVIQNIK 60

Query: 78  NILAESNSSLDNIVKVNVFLADMKNFAEFNSVYAKHFHTHKPARSCVGVASLPLNVDLEM 137
           N+L  SNSSL+ IVKVN+FLAD+ +FAEFN+VYAK+F+ HKPARSCV VA+LPLN DLEM
Sbjct: 61  NVLEASNSSLEKIVKVNIFLADINSFAEFNTVYAKYFNVHKPARSCVAVAALPLNADLEM 120

Query: 138 EVIAVE 143
           EVIAVE
Sbjct: 121 EVIAVE 126

>CAGL0M12386g 1234993..1235421 similar to sp|P40037 Saccharomyces
           cerevisiae YER057c HIG1 Heat-shock induceable Inhibiter
           of cell Growth, hypothetical start
          Length = 142

 Score =  188 bits (477), Expect = 2e-62,   Method: Compositional matrix adjust.
 Identities = 96/131 (73%), Positives = 111/131 (84%)

Query: 13  VLRRGITTLTPVSTKLAPPAAASYSQAMKANNFVYVSGQIPYTPDNKPVQGSISEKAEQV 72
           ++ R ++ LTPV +  APPAAASYS AMK NN +YVSGQIPYT DNKPV+GSIS+KAEQV
Sbjct: 10  IMTRQLSKLTPVISANAPPAAASYSHAMKVNNLIYVSGQIPYTKDNKPVEGSISDKAEQV 69

Query: 73  FQNVKNILAESNSSLDNIVKVNVFLADMKNFAEFNSVYAKHFHTHKPARSCVGVASLPLN 132
            QNV+NIL +SNS L+ IVKVN+FLADM NFAEFN VYAK+F+ HKPARSCV VA+LPL 
Sbjct: 70  IQNVQNILKDSNSDLNRIVKVNIFLADMNNFAEFNKVYAKYFNVHKPARSCVAVAALPLG 129

Query: 133 VDLEMEVIAVE 143
           VDLEMEVIA E
Sbjct: 130 VDLEMEVIATE 140

>YER057C (HMF1) [1487] chr5 complement(270735..271124) Protein that
           inhibits cell growth and contributes to cell death at
           high temperature, member of the p14.5 family [390 bp,
           129 aa]
          Length = 129

 Score =  174 bits (441), Expect = 4e-57,   Method: Compositional matrix adjust.
 Identities = 90/127 (70%), Positives = 109/127 (85%)

Query: 18  ITTLTPVSTKLAPPAAASYSQAMKANNFVYVSGQIPYTPDNKPVQGSISEKAEQVFQNVK 77
           +TTLTPV  + AP AAASYS AMK NN +++SGQIP TPDNK V+GSI++KAEQV QN+K
Sbjct: 2   VTTLTPVICESAPAAAASYSHAMKVNNLIFLSGQIPVTPDNKLVEGSIADKAEQVIQNIK 61

Query: 78  NILAESNSSLDNIVKVNVFLADMKNFAEFNSVYAKHFHTHKPARSCVGVASLPLNVDLEM 137
           N+L  SNSSLD +VKVN+FLAD+ +FAEFNSVYAK+F+THKPARSCV VA+LPL VD+EM
Sbjct: 62  NVLEASNSSLDRVVKVNIFLADINHFAEFNSVYAKYFNTHKPARSCVAVAALPLGVDMEM 121

Query: 138 EVIAVEK 144
           E IA E+
Sbjct: 122 EAIAAER 128

>Kwal_23.2807
          Length = 129

 Score = 64.3 bits (155), Expect = 6e-14,   Method: Compositional matrix adjust.
 Identities = 39/107 (36%), Positives = 63/107 (58%), Gaps = 9/107 (8%)

Query: 39  AMKANNFVYVSGQIPYTPDNKPVQGSISEKAEQ----VFQNVKNILAESNSSLDNIVKVN 94
           A K+N+ V+ SG +       PV G++ E  EQ      +N+KN+L  S SSL+ ++KV 
Sbjct: 25  ASKSNDLVFTSGCV----GTDPVTGNLPEDLEQQIINALENLKNVLHASGSSLERVLKVL 80

Query: 95  VFLADMKNFAEFNSVYAKHFHTHKPARSCVGVASLPLNVDLEMEVIA 141
           +F++D    +  N VY+++F  + PARSC+ VA     + +E+E IA
Sbjct: 81  LFVSDASYASTVNEVYSRYF-PNAPARSCIVVAFPAPALKVELECIA 126

>Kwal_55.21247
          Length = 134

 Score = 56.6 bits (135), Expect = 7e-11,   Method: Compositional matrix adjust.
 Identities = 32/100 (32%), Positives = 57/100 (57%), Gaps = 3/100 (3%)

Query: 43  NNFVYVSGQIPYTPDNKPVQGSISEKAEQVFQNVKNILAESNSSLDNIVKVNVFLADMKN 102
           ++ V+ SG +   P    +   + ++     +N+KN+L  S SSL+ ++KV +F++D   
Sbjct: 28  SDLVFTSGCVGTDPVTGELPTDLEQQVRNALENLKNVLRASGSSLEQVIKVLLFVSDGSY 87

Query: 103 FAEFNSVYAKHFHTHKPARSCVGVASLP-LNVDLEMEVIA 141
               N VY+++F    PARSC+ V S P  ++ +E+E IA
Sbjct: 88  APAVNKVYSEYF-PGAPARSCI-VVSFPNASLKVELECIA 125

>Kwal_47.16590
          Length = 126

 Score = 55.8 bits (133), Expect = 1e-10,   Method: Compositional matrix adjust.
 Identities = 32/100 (32%), Positives = 49/100 (49%), Gaps = 1/100 (1%)

Query: 42  ANNFVYVSGQIPYTPDNKPVQGSISEKAEQVFQNVKNILAESNSSLDNIVKVNVFLADMK 101
           +N  V+ SG I        V   I ++     +N++ +L    SSL  + KV +F++   
Sbjct: 25  SNGHVFTSGIIGANYGTGEVPHEIEDQVHLAIKNLETVLVAGGSSLSKVFKVTMFISHAD 84

Query: 102 NFAEFNSVYAKHFHTHKPARSCVGVASLPLNVDLEMEVIA 141
                N +Y  H+  HKPARSCV VA +   +  E+E IA
Sbjct: 85  YSKVVNEIYG-HYFPHKPARSCVVVAFMDAAIKYELEAIA 123

>Scas_506.3
          Length = 689

 Score = 56.6 bits (135), Expect = 5e-10,   Method: Composition-based stats.
 Identities = 40/129 (31%), Positives = 66/129 (51%), Gaps = 14/129 (10%)

Query: 16  RGITTLTPVSTKLAPPAAASYSQAMKANNFVYVSGQIPYTPDNKPVQGSISEKAEQVFQN 75
           + +T  T +ST    P     +   K  N +Y+S   P     K  + ++ ++A+QVFQ 
Sbjct: 297 KSVTKTTQLSTI---PECKYRNSVNKVGNLLYISNLCP-----KDSELNVEQQAKQVFQQ 348

Query: 76  VKNILAESNSSLDNIVKVNVFLADMKNFAEFNSVYAKHFHTHK-----PARSCVGVASLP 130
           +  I+ E++     I+  ++ LA+M NFA  N VY   F  +K     P+R+CVG + L 
Sbjct: 349 LDKIMKENSLFPSQILFSSLILANMSNFATVNQVYNDFFRINKWGPLPPSRACVG-SVLS 407

Query: 131 LNVDLEMEV 139
            NV L++ V
Sbjct: 408 NNVQLQLSV 416

>KLLA0B14817g 1301705..1302100 similar to sp|Q8XCD0 Escherichia coli
           O157:H7 Orf, hypothetical protein, start by similarity
          Length = 131

 Score = 54.3 bits (129), Expect = 5e-10,   Method: Compositional matrix adjust.
 Identities = 38/120 (31%), Positives = 61/120 (50%), Gaps = 14/120 (11%)

Query: 26  TKLAPPAAASYSQAMKANNFVYVSGQIPYTPDNKPVQGSISEKAEQ----VFQNVKNILA 81
           T LAP    S     K    VY SG +     +  + G I E  E+       N+  +L 
Sbjct: 17  TFLAPAYVTS-----KDTELVYTSGCV----GSDLLTGEIPEDLEKQVRNALDNLGRVLK 67

Query: 82  ESNSSLDNIVKVNVFLADMKNFAEFNSVYAKHFHTHKPARSCVGVASLPLNVDLEMEVIA 141
            SNSS D+++K+ +F+AD    +  N+VY ++F   +PARSC+ V+     + +E+E +A
Sbjct: 68  ASNSSFDDVLKILLFVADGSYASTVNAVYKEYFP-ERPARSCIVVSFPDPTLKVELECVA 126

>KLLA0E03894g complement(364475..364888) some similarities with
           sp|Q87LF6 Vibrio parahaemolyticus Conserved hypothetical
           protein, hypothetical start
          Length = 137

 Score = 50.8 bits (120), Expect = 9e-09,   Method: Compositional matrix adjust.
 Identities = 34/114 (29%), Positives = 59/114 (51%), Gaps = 5/114 (4%)

Query: 28  LAPPAAASYSQAMKANNFVYVSGQIPYTPDNKPVQGSISEKAEQVFQNVKNILAESNSSL 87
           L  P  A+ S     N  ++ SG +   P    +   + ++A     N+K +L  S SS+
Sbjct: 18  LISPGFATES----GNQLLFSSGCVGTDPVTNELPEDLEQQARNSMINLKKVLEVSGSSV 73

Query: 88  DNIVKVNVFLADMKNFAEFNSVYAKHFHTHKPARSCVGVASLPLNVDLEMEVIA 141
           D+++K+ +F++D       N V+ K F  ++PARSC+ VA     + +E+E IA
Sbjct: 74  DSVLKILLFVSDGSYAGIVNKVF-KEFFPNQPARSCIVVAFPNNKLKVELECIA 126

>CAGL0M04521g 496157..498223 similar to tr|Q12429 Saccharomyces
           cerevisiae YLR143w, hypothetical start
          Length = 688

 Score = 48.9 bits (115), Expect = 2e-07,   Method: Composition-based stats.
 Identities = 27/89 (30%), Positives = 46/89 (51%), Gaps = 10/89 (11%)

Query: 41  KANNFVYVSGQIPYTPDNKPVQGSISEKAEQVFQNVKNILAESNSSLDNIVKVNVFLADM 100
           +  N +Y+S   P   D     G++ E+ + V Q + NIL +++ +  N++  ++ L DM
Sbjct: 318 RIGNLLYISNIQPQYKD-----GTVQEQVKDVLQQLDNILKDNHLTAKNVLYSSLLLTDM 372

Query: 101 KNFAEFNSVYAKHFHTHK-----PARSCV 124
             FA  N  Y+K F   K     PAR+C+
Sbjct: 373 SLFASVNQEYSKFFDIWKNGPLPPARACI 401

>YLR143W (YLR143W) [3552] chr12 (427330..429387) Protein containing
           an endoribonuclease L-PSP domain and a DUF71 domain of
           unknown function, has moderate similarity to
           uncharacterized C. albicans Orf6.3850p [2058 bp, 685 aa]
          Length = 685

 Score = 46.2 bits (108), Expect = 2e-06,   Method: Composition-based stats.
 Identities = 20/82 (24%), Positives = 45/82 (54%), Gaps = 5/82 (6%)

Query: 64  SISEKAEQVFQNVKNILAESNSSLDNIVKVNVFLADMKNFAEFNSVYAKHFHTHK----- 118
           ++ +++E +F  + +IL  +    ++I+  ++ + DM NF + N +Y +     K     
Sbjct: 334 TVEKQSEDIFTELADILHSNQIPRNHILSASLLIRDMSNFGKINKIYNEFLDLSKYGPLP 393

Query: 119 PARSCVGVASLPLNVDLEMEVI 140
           P+R+CVG   LP +  +++ V+
Sbjct: 394 PSRACVGSKCLPEDCHVQLSVV 415

>Kwal_27.11310
          Length = 688

 Score = 45.1 bits (105), Expect = 5e-06,   Method: Composition-based stats.
 Identities = 27/82 (32%), Positives = 44/82 (53%), Gaps = 5/82 (6%)

Query: 64  SISEKAEQVFQNVKNILAESNSSLDNIVKVNVFLADMKNFAEFNSVYAKHFHTHK----- 118
           S  EK + VF+ + +IL +   S   I+   V LADM +F++ N  Y + FH  +     
Sbjct: 331 SPDEKVQDVFRQLSDILRDYELSPAQILSSLVLLADMGDFSKVNEHYNEFFHVARNGPLP 390

Query: 119 PARSCVGVASLPLNVDLEMEVI 140
           P+R+CVG + +     L++ VI
Sbjct: 391 PSRACVGSSLVGSENILQLSVI 412

>AGL164W [4148] [Homologous to ScYLR143W - SH]
           complement(388842..390902) [2061 bp, 686 aa]
          Length = 686

 Score = 43.1 bits (100), Expect = 3e-05,   Method: Composition-based stats.
 Identities = 25/97 (25%), Positives = 46/97 (47%), Gaps = 6/97 (6%)

Query: 50  GQIPYTPDNKP-VQGSISEKAEQVFQNVKNILAESNSSLDNIVKVNVFLADMKNFAEFNS 108
           G + Y  + +P  +G + ++A  VF  +   L         ++   + LADM  FAE N+
Sbjct: 313 GGLLYVSNIQPRCRGPLEKQARDVFDQLNESLTRHGVVKAQVLSSVLLLADMGTFAEINT 372

Query: 109 VYAKHFHTHK-----PARSCVGVASLPLNVDLEMEVI 140
            Y  +F   +     P+R+C+   SL   + L++ V+
Sbjct: 373 AYNGYFSIQEIGPLPPSRACIESKSLAPGIGLQLSVV 409

>KLLA0D16984g 1439669..1441759 similar to sgd|S0004133 Saccharomyces
           cerevisiae YLR143w, start by similarity
          Length = 696

 Score = 43.1 bits (100), Expect = 3e-05,   Method: Composition-based stats.
 Identities = 32/96 (33%), Positives = 51/96 (53%), Gaps = 6/96 (6%)

Query: 50  GQIPYTPDNKPVQG-SISEKAEQVFQNVKNILAESNSSLDNIVKVNVFLADMKNFAEFNS 108
           G++ Y  +  P +G S+ EK   VF  + +IL+  +     I+  ++ L+DM NF E NS
Sbjct: 322 GKLLYISNIAPSKGESLKEKCLDVFSQLTSILSSRSIFACQILSSSLLLSDMNNFQEVNS 381

Query: 109 VYAKHFHTHK-----PARSCVGVASLPLNVDLEMEV 139
            Y ++F+  K     PAR+CV  + L   V L + V
Sbjct: 382 YYNEYFNVTKIGPLPPARACVESSFLKHPVQLSVVV 417

>Scas_690.3
          Length = 333

 Score = 30.8 bits (68), Expect = 0.32,   Method: Compositional matrix adjust.
 Identities = 17/47 (36%), Positives = 26/47 (55%), Gaps = 4/47 (8%)

Query: 47  YVSGQIPYTPDNKPVQGSISEKAEQVFQNVKNILAESNSSLDNIVKV 93
           +  GQ  + P N+ V+   +E+ EQ+    K  +AE   SLDN VK+
Sbjct: 279 FAMGQFKFVPANETVEKLTTEQIEQL----KKKVAEKYQSLDNNVKI 321

>CAGL0M04191g complement(461446..463251) similar to sp|P32329
           Saccharomyces cerevisiae YLR120c YAP3 or sp|P53379
           Saccharomyces cerevisiae YDR144c MKC7 or sp|Q12303
           Saccharomyces cerevisiae YLR121c YPS3, hypothetical
           start
          Length = 601

 Score = 29.6 bits (65), Expect = 0.88,   Method: Composition-based stats.
 Identities = 22/71 (30%), Positives = 34/71 (47%), Gaps = 6/71 (8%)

Query: 48  VSGQIPYTPDNKPV----QGSISEKAEQVFQNVKNILAESNSSLDNIVKVNVFLADMKNF 103
           VSGQ PY  DN P+     G+I   +  +F N  N  AE+ S L   V  + +L D+   
Sbjct: 276 VSGQRPYQYDNFPLVLLRNGAIKSNSYSLFLN--NASAETGSVLFGAVDHSKYLGDLYTI 333

Query: 104 AEFNSVYAKHF 114
              N+  ++ +
Sbjct: 334 PMVNTYASQGY 344

>ADR212C [1953] [Homologous to ScYKR079C - SH] (1074196..1076661)
           [2466 bp, 821 aa]
          Length = 821

 Score = 29.3 bits (64), Expect = 1.1,   Method: Composition-based stats.
 Identities = 22/80 (27%), Positives = 43/80 (53%), Gaps = 11/80 (13%)

Query: 23  PVSTKLAPPAAASYSQAMKANN-FVY---VSGQI-PYTPDNKPVQGSISEKA------EQ 71
           PV   +   + + +S  ++++  F+Y   V+  I PYTP ++P++ +I+E        E+
Sbjct: 364 PVDAVVDNTSESPFSSTIESSRVFIYSTRVTASIEPYTPGDEPLKINITESPDRYQSWEE 423

Query: 72  VFQNVKNILAESNSSLDNIV 91
           V+Q     L   NS+L ++V
Sbjct: 424 VYQKRIEPLKIENSNLHDVV 443

>Scas_712.4
          Length = 586

 Score = 27.7 bits (60), Expect = 4.5,   Method: Composition-based stats.
 Identities = 14/59 (23%), Positives = 28/59 (47%), Gaps = 12/59 (20%)

Query: 33  AASYSQAMKANNFVYVSGQIPYTPDNK------------PVQGSISEKAEQVFQNVKNI 79
           + SY + +  ++F+++ G+IP +P+ K            P  G +   A + F  +K I
Sbjct: 269 SCSYDEFVAVSDFLFLKGRIPGSPEKKIFKVTEAKAKQLPTVGFLMNAAFESFPKIKTI 327

>Scas_715.33
          Length = 1018

 Score = 27.3 bits (59), Expect = 4.9,   Method: Composition-based stats.
 Identities = 15/54 (27%), Positives = 26/54 (48%), Gaps = 2/54 (3%)

Query: 31  PAAASYSQAM--KANNFVYVSGQIPYTPDNKPVQGSISEKAEQVFQNVKNILAE 82
           P   SYS+A+    N+ +  + ++P   + +  QG     AE V   +KN+  E
Sbjct: 341 PIKQSYSKAIFNYTNSLLIATAELPEIDEIRVSQGGTESNAENVVTTLKNLSFE 394

>YNL163C (RIA1) [4433] chr14 complement(326741..330073) GTPase
           required for maturation of 60S ribosomal subunits in the
           cytoplasm, has similarity to eukaryotic and
           archaebacterial EF-2 proteins [3333 bp, 1110 aa]
          Length = 1110

 Score = 27.3 bits (59), Expect = 5.5,   Method: Composition-based stats.
 Identities = 11/33 (33%), Positives = 21/33 (63%)

Query: 60  PVQGSISEKAEQVFQNVKNILAESNSSLDNIVK 92
           P+ G +++   Q   ++KNIL  S SS+D +++
Sbjct: 791 PLSGKVTDFLSQHQNSIKNILKTSTSSMDPVIE 823

>YNL018C (YNL018C) [4569] chr14 complement(599934..601772) Protein
           of unknown function, nearly identical to Ynl034p [1839
           bp, 612 aa]
          Length = 612

 Score = 26.9 bits (58), Expect = 6.8,   Method: Compositional matrix adjust.
 Identities = 14/36 (38%), Positives = 21/36 (58%), Gaps = 1/36 (2%)

Query: 93  VNVFLADMKNFAEFNSVYAKHFHTHKPARSCVGVAS 128
           V+ F  D+KN   +N VY ++   H  A +C GV+S
Sbjct: 66  VSNFFYDVKNAPLWN-VYKRNHSGHSSAEACSGVSS 100

  Database: blastdb
    Posted date:  Apr 3, 2006  3:33 PM
  Number of letters in database: 16,596,109
  Number of sequences in database:  34,618
  
Lambda     K      H
   0.316    0.129    0.356 

Gapped
Lambda     K      H
   0.267   0.0410    0.140 

Matrix: BLOSUM62
Gap Penalties: Existence: 11, Extension: 1
Number of Sequences: 34618
Number of Hits to DB: 4,343,383
Number of extensions: 166993
Number of successful extensions: 645
Number of sequences better than 10.0: 41
Number of HSP's gapped: 637
Number of HSP's successfully gapped: 42
Length of query: 144
Length of database: 16,596,109
Length adjustment: 92
Effective length of query: 52
Effective length of database: 13,411,253
Effective search space: 697385156
Effective search space used: 697385156
Neighboring words threshold: 11
Window for multiple hits: 40
X1: 16 ( 7.3 bits)
X2: 38 (14.6 bits)
X3: 64 (24.7 bits)
S1: 41 (21.7 bits)
S2: 56 (26.2 bits)