Hit NameLength (aa)HSP LengthHSP ScoreHSP Significance
YIL050W (PCL7)28528113600.0
Scas_704.354482366199e-78
CAGL0M12342g4572046103e-76
YER059W (PCL6)4202735919e-74
Kwal_23.58074651975879e-73
ADL075W2071915512e-70
KLLA0C08305g4092415612e-69
Scas_715.513412354673e-56
KLLA0D01287g3451562011e-17
CAGL0E02541g3421602001e-17
ACR001C3461642001e-17
Sklu_2373.43071761912e-16
Kwal_56.224432801571804e-15
YOL001W (PHO80)2931871795e-15
Scas_392.13031571762e-14
YGL134W (PCL10)4331191453e-10
YPL219W (PCL8)4921351392e-09
Scas_706.34511241364e-09
Scas_720.474731301285e-08
KLLA0B02024g5271181213e-07
CAGL0E05918g4811351214e-07
CAGL0H08998g5471241091e-05
Kwal_56.241514801211072e-05
AFL115W386110992e-04
Scas_686.2210164910.001
Kwal_34.1599623162730.20
YHL022C (SPO11)39883720.43
Sklu_2028.343049671.9
Kwal_27.1059198146635.1
BLASTP 2.2.26 [Sep-21-2011]

Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, 
Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), 
"Gapped BLAST and PSI-BLAST: a new generation of protein database search
programs",  Nucleic Acids Res. 25:3389-3402.

Reference for compositional score matrix adjustment: Altschul, Stephen F., 
John C. Wootton, E. Michael Gertz, Richa Agarwala, Aleksandr Morgulis,
Alejandro A. Schaffer, and Yi-Kuo Yu (2005) "Protein database searches
using compositionally adjusted substitution matrices", FEBS J. 272:5101-5109.

Query= YIL050W
         (281 letters)

Database: blastdb 
           34,618 sequences; 16,596,109 total letters

Searching..................................................done

                                                                 Score    E
Sequences producing significant alignments:                      (bits) Value

YIL050W (PCL7) [2617] chr9 (258912..259769) Cyclin, associates w...   528   0.0  
Scas_704.35                                                           243   9e-78
CAGL0M12342g complement(1232642..1234015) weakly similar to sp|P...   239   3e-76
YER059W (PCL6) [1489] chr5 (272622..273884) Cyclin that associat...   232   9e-74
Kwal_23.5807                                                          230   9e-73
ADL075W [1666] [Homologous to ScYIL050W (PCL7) - SH; ScYER059W (...   216   2e-70
KLLA0C08305g complement(728996..730225) some similarities with s...   220   2e-69
Scas_715.51                                                           184   3e-56
KLLA0D01287g 112866..113903 some similarities with sp|P20052 Sac...    82   1e-17
CAGL0E02541g 244577..245605 similar to sp|P20052 Saccharomyces c...    82   1e-17
ACR001C [1049] [Homologous to ScYOL001W (PHO80) - SH] (357962..3...    82   1e-17
Sklu_2373.4 YOL001W, Contig c2373 11960-12883                          78   2e-16
Kwal_56.22443                                                          74   4e-15
YOL001W (PHO80) [4815] chr15 (325249..326130) Cyclin that intera...    74   5e-15
Scas_392.1                                                             72   2e-14
YGL134W (PCL10) [1853] chr7 (255666..256967) Cyclin that associa...    60   3e-10
YPL219W (PCL8) [5230] chr16 (136749..138227) Cyclin that associa...    58   2e-09
Scas_706.3                                                             57   4e-09
Scas_720.47                                                            54   5e-08
KLLA0B02024g 176585..178168 some similarities with sp|P53124 Sac...    51   3e-07
CAGL0E05918g complement(585723..587168) some similarities with t...    51   4e-07
CAGL0H08998g 877952..879595 weakly similar to tr|Q08966 Saccharo...    47   1e-05
Kwal_56.24151                                                          46   2e-05
AFL115W [3080] [Homologous to ScYPL219W (PCL8) - SH; ScYGL134W (...    43   2e-04
Scas_686.2                                                             40   0.001
Kwal_34.15996                                                          33   0.20 
YHL022C (SPO11) [2264] chr8 complement(62958..64154) Catalytic s...    32   0.43 
Sklu_2028.3 YHL014C, Contig c2028 4688-5980 reverse complement         30   1.9  
Kwal_27.10591                                                          29   5.1  

>YIL050W (PCL7) [2617] chr9 (258912..259769) Cyclin, associates with
           the Pho85p cyclin-dependent kinase, involved in
           utilization of alternate carbon sources [858 bp, 285 aa]
          Length = 285

 Score =  528 bits (1360), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 261/281 (92%), Positives = 261/281 (92%)

Query: 1   MELXXXXXXXXXXXINIPGGNRDNLIIGPHSHSFKTDPFXXXXXXXXXKISTNPSLESPF 60
           MEL           INIPGGNRDNLIIGPHSHSFKTDPF         KISTNPSLESPF
Sbjct: 1   MELSSPSKKTTTSPINIPGGNRDNLIIGPHSHSFKTDPFSSNNSSLLSKISTNPSLESPF 60

Query: 61  SSKSLLDCSPVQAVKKSLESEAKTHSLDEETNEQTDVKILNIADFPTDELILMISALLNR 120
           SSKSLLDCSPVQAVKKSLESEAKTHSLDEETNEQTDVKILNIADFPTDELILMISALLNR
Sbjct: 61  SSKSLLDCSPVQAVKKSLESEAKTHSLDEETNEQTDVKILNIADFPTDELILMISALLNR 120

Query: 121 IITANDETTDVSQQVSDETEDELLTPILAFYGKNVPEIAVVQYLERIQKYCPTTNDIFLS 180
           IITANDETTDVSQQVSDETEDELLTPILAFYGKNVPEIAVVQYLERIQKYCPTTNDIFLS
Sbjct: 121 IITANDETTDVSQQVSDETEDELLTPILAFYGKNVPEIAVVQYLERIQKYCPTTNDIFLS 180

Query: 181 LLVYFDRISKNYGHSSERNGCAKQLFVMDSGNIHRLLITGVTICTKFLSDFFYSNSRYAK 240
           LLVYFDRISKNYGHSSERNGCAKQLFVMDSGNIHRLLITGVTICTKFLSDFFYSNSRYAK
Sbjct: 181 LLVYFDRISKNYGHSSERNGCAKQLFVMDSGNIHRLLITGVTICTKFLSDFFYSNSRYAK 240

Query: 241 VGGISLQELNHLELQFLILCDFKLLVSVEEMQKYANLLYKF 281
           VGGISLQELNHLELQFLILCDFKLLVSVEEMQKYANLLYKF
Sbjct: 241 VGGISLQELNHLELQFLILCDFKLLVSVEEMQKYANLLYKF 281

>Scas_704.35
          Length = 448

 Score =  243 bits (619), Expect = 9e-78,   Method: Compositional matrix adjust.
 Identities = 123/236 (52%), Positives = 166/236 (70%), Gaps = 18/236 (7%)

Query: 64  SLLDCSPVQAVKKSLESEAKTHSLDEETN-----EQTDVKILNIADFPTDELILMISALL 118
           S  + SP  +  K      +  ++D ETN      + D + +NIA+FPT++L+ M++ALL
Sbjct: 183 SRTEPSPQLSNSKDTTPSNQMDTIDSETNMANKTTEDDNESINIAEFPTNKLLEMLTALL 242

Query: 119 NRIITAND---------ETTDVSQQVSDETEDELLTPILAFYGKNVPEIAVVQYLERIQK 169
           ++I+ +ND         E+ D   +  D + +  +  ILAF GK+VP+I++ QY +RIQK
Sbjct: 243 DKIVKSNDKLNVSSSNSESIDDILRSEDNSNNAYVGSILAFRGKHVPQISLHQYFQRIQK 302

Query: 170 YCPTTNDIFLSLLVYFDRISKNYGHSSERNGCA----KQLFVMDSGNIHRLLITGVTICT 225
           YCPTTND+FLSLLVYFDRISK   +S    G +     QLFVMDS NIHRL+I GVT+CT
Sbjct: 303 YCPTTNDVFLSLLVYFDRISKRCNNSVTSQGDSPTNKSQLFVMDSYNIHRLIIAGVTVCT 362

Query: 226 KFLSDFFYSNSRYAKVGGISLQELNHLELQFLILCDFKLLVSVEEMQKYANLLYKF 281
           KF SDFFYSNSRYA+VGG+SLQELNHLELQFL+LCDF+L++  EE+Q+YA+LL +F
Sbjct: 363 KFFSDFFYSNSRYARVGGVSLQELNHLELQFLVLCDFELMIPTEELQRYADLLSRF 418

>CAGL0M12342g complement(1232642..1234015) weakly similar to
           sp|P40038 Saccharomyces cerevisiae YER059w PCL6 cyclin
           like protein interacting with PHO85P, hypothetical start
          Length = 457

 Score =  239 bits (610), Expect = 3e-76,   Method: Compositional matrix adjust.
 Identities = 120/204 (58%), Positives = 148/204 (72%), Gaps = 22/204 (10%)

Query: 100 LNIADFPTDELILMISALLNRIITANDE-------------------TTDVSQQVSDETE 140
           LNIA+FPTD+L+ M++ALLN+II +ND+                   T      V    +
Sbjct: 236 LNIAEFPTDKLLEMLTALLNKIIKSNDQMEPYKDKDKDEDHDDDESLTDSKLMSVKGTDK 295

Query: 141 DELLTPILAFYGKNVPEIAVVQYLERIQKYCPTTNDIFLSLLVYFDRISKNYGHS---SE 197
           ++ L  IL+F GK+VP+I + QY +RIQKYCPTTND+FLSLLVYFDRISK    S   S 
Sbjct: 296 EKYLKSILSFKGKHVPQITLYQYFQRIQKYCPTTNDVFLSLLVYFDRISKKCNSSDSESA 355

Query: 198 RNGCAKQLFVMDSGNIHRLLITGVTICTKFLSDFFYSNSRYAKVGGISLQELNHLELQFL 257
               A QLFVMDS NIHRL+I GVT+CTKF SDFFYSNSRYA+VGGISL ELNHLELQFL
Sbjct: 356 DTSPADQLFVMDSYNIHRLVIAGVTVCTKFFSDFFYSNSRYARVGGISLSELNHLELQFL 415

Query: 258 ILCDFKLLVSVEEMQKYANLLYKF 281
           +LCDF+LL+SV+++Q+YANLL +F
Sbjct: 416 VLCDFELLISVDKLQRYANLLLRF 439

>YER059W (PCL6) [1489] chr5 (272622..273884) Cyclin that associates
           with the Pho85p cyclin-dependent kinase, involved in
           utilization of alternative carbon and nitrogen sources
           [1263 bp, 420 aa]
          Length = 420

 Score =  232 bits (591), Expect = 9e-74,   Method: Compositional matrix adjust.
 Identities = 127/273 (46%), Positives = 162/273 (59%), Gaps = 62/273 (22%)

Query: 71  VQAVKKSLESEAKTHSLDEETNEQTDVKILNIADFPTDELILMISALLNRIITANDETTD 130
           VQ       S  +   LD +T+       LNIA+FPTD+L+ M++ALL +II +ND T  
Sbjct: 133 VQGTHTVQSSTQEDKILDGDTSNSQVTPSLNIAEFPTDKLLKMLTALLTKIIKSNDRTAA 192

Query: 131 VSQQVSDETED-----------ELLTPILAFYGKNVPEIAVVQYLERIQKYCPTTNDIFL 179
            +  ++ E E+           + L+P+L F GK+VP+I + QY +RIQKYCPTTND+FL
Sbjct: 193 TNPSLTQEIENGRCLALSDNEKKYLSPVLGFRGKHVPQIGLDQYFQRIQKYCPTTNDVFL 252

Query: 180 SLLVYFDRISKN------------YGHSSERN---------GCAK--------------- 203
           SLLVYFDRISK               H S  N         G  K               
Sbjct: 253 SLLVYFDRISKRCNSVTTTPKTNTAKHESPSNESSLDKANRGADKMSACNSNENNENDDS 312

Query: 204 ---------------QLFVMDSGNIHRLLITGVTICTKFLSDFFYSNSRYAKVGGISLQE 248
                          Q+FVMDS NIHRL+I G+T+ TKFLSDFFYSNSRY++VGGISLQE
Sbjct: 313 DDENTGVQRDSRAHPQMFVMDSHNIHRLIIAGITVSTKFLSDFFYSNSRYSRVGGISLQE 372

Query: 249 LNHLELQFLILCDFKLLVSVEEMQKYANLLYKF 281
           LNHLELQFL+LCDF+LL+SV E+Q+YA+LLY+F
Sbjct: 373 LNHLELQFLVLCDFELLISVNELQRYADLLYRF 405

>Kwal_23.5807
          Length = 465

 Score =  230 bits (587), Expect = 9e-73,   Method: Compositional matrix adjust.
 Identities = 110/197 (55%), Positives = 146/197 (74%), Gaps = 19/197 (9%)

Query: 98  KILNIADFPTDELILMISALLNRIITANDE-------------TTDVSQQVSDETEDELL 144
           +++ IA FPTD L+ M++ALL++I+ +ND+              +  ++   ++T   + 
Sbjct: 259 ELIQIATFPTDRLLSMLTALLDKIVKSNDQLNRDRPFDEDQFLASARTEDADNDTRPNIA 318

Query: 145 TPILAFYGKNVPEIAVVQYLERIQKYCPTTNDIFLSLLVYFDRISKNYGHSSERNGCAKQ 204
           + IL+F GK+VP I + QY +RIQKYCPTTND+FLSLLVYFDRI+K   H  E      Q
Sbjct: 319 SEILSFRGKHVPAITLQQYFQRIQKYCPTTNDVFLSLLVYFDRIAKTCNHGKE------Q 372

Query: 205 LFVMDSGNIHRLLITGVTICTKFLSDFFYSNSRYAKVGGISLQELNHLELQFLILCDFKL 264
           LFVMDS NIHRL+I+ VT+ TKF SDFFYSNSRYA+VGGISL+ELNHLELQFL+LCDF+L
Sbjct: 373 LFVMDSYNIHRLIISAVTVSTKFFSDFFYSNSRYARVGGISLKELNHLELQFLVLCDFEL 432

Query: 265 LVSVEEMQKYANLLYKF 281
           ++SVEE+QKY++LL  F
Sbjct: 433 IISVEELQKYSDLLRDF 449

>ADL075W [1666] [Homologous to ScYIL050W (PCL7) - SH; ScYER059W
           (PCL6) - SH] complement(550944..551567) [624 bp, 207 aa]
          Length = 207

 Score =  216 bits (551), Expect = 2e-70,   Method: Compositional matrix adjust.
 Identities = 109/191 (57%), Positives = 140/191 (73%), Gaps = 9/191 (4%)

Query: 93  EQTDVKI--LNIADFPTDELILMISALLNRIITANDETTDVSQQVSDETEDELLTPILAF 150
           E  D +I  ++IA FPTD+L+ M++ LL +II +ND      Q+  D   ++ +  +L+F
Sbjct: 7   EGVDQRIGHMDIAQFPTDKLLEMLTGLLYKIIKSNDRLKPFDQEKHD-INNKYVAHVLSF 65

Query: 151 YGKNVPEIAVVQYLERIQKYCPTTNDIFLSLLVYFDRISKNYGHSSERNGCAKQLFVMDS 210
            GK++P I +  Y  RIQKYCP TND+FLSLLVYFDRI+K        N    QLFVMDS
Sbjct: 66  RGKHIPTITLGDYFARIQKYCPITNDVFLSLLVYFDRIAKRC------NALDPQLFVMDS 119

Query: 211 GNIHRLLITGVTICTKFLSDFFYSNSRYAKVGGISLQELNHLELQFLILCDFKLLVSVEE 270
            NIHRL+I  VT+ TKF SDFFYSNSRYA+VGGISL+ELN LELQF ILCDF+L+VS++E
Sbjct: 120 YNIHRLIIAAVTVSTKFFSDFFYSNSRYARVGGISLEELNRLELQFSILCDFELIVSIQE 179

Query: 271 MQKYANLLYKF 281
           +Q+YA+LLYKF
Sbjct: 180 LQRYADLLYKF 190

>KLLA0C08305g complement(728996..730225) some similarities with
           sp|P40038 Saccharomyces cerevisiae YER059w PCL6 cyclin
           like protein interacting with PHO85P, hypothetical start
          Length = 409

 Score =  220 bits (561), Expect = 2e-69,   Method: Compositional matrix adjust.
 Identities = 118/241 (48%), Positives = 156/241 (64%), Gaps = 29/241 (12%)

Query: 70  PVQAVKK-----SLESEAKTHSLDEETNEQTDVKI------LNIADFPTDELILMISALL 118
           PV+AV +          + T   D  +N++T   +      ++IA FPT +L+ M++ LL
Sbjct: 148 PVKAVSELRIDDEQTGSSSTSQPDHHSNDETQHSLNNNNHHMDIATFPTYKLLDMLTGLL 207

Query: 119 NRIITANDETTDVSQ-QVSDETEDELLTPILAFYGKNVPEIAVVQYLERIQKYCPTTNDI 177
            +II +ND        + S      L+  IL+F GK VP I + QY +RIQKYCPTTND+
Sbjct: 208 TKIIKSNDSLGSTPNFETSQGKNIPLMREILSFRGKQVPGITLKQYFQRIQKYCPTTNDV 267

Query: 178 FLSLLVYFDRISK-----------------NYGHSSERNGCAKQLFVMDSGNIHRLLITG 220
            LSLLV+FDRI+K                 +   +S  +  + QLFVMDS NIHRL+I  
Sbjct: 268 LLSLLVHFDRIAKKCNAIAQEYMVSVVSTPDKTTASLAHQSSPQLFVMDSHNIHRLIIAA 327

Query: 221 VTICTKFLSDFFYSNSRYAKVGGISLQELNHLELQFLILCDFKLLVSVEEMQKYANLLYK 280
           +T+ TKF+SDFFYSNSRYA+VGGISLQELNHLELQFLILCDF+L++SVEE+Q+YA+LLYK
Sbjct: 328 ITVSTKFISDFFYSNSRYARVGGISLQELNHLELQFLILCDFRLIISVEELQRYADLLYK 387

Query: 281 F 281
           F
Sbjct: 388 F 388

>Scas_715.51
          Length = 341

 Score =  184 bits (467), Expect = 3e-56,   Method: Compositional matrix adjust.
 Identities = 103/235 (43%), Positives = 145/235 (61%), Gaps = 24/235 (10%)

Query: 71  VQAVKKSLESEAKTHSLDEETNEQTDVK-ILNIADFPTDELILMISALLNRIITANDE-- 127
           +   +K +E    +  L+   +E   V   ++I    T +LI MIS +L ++I +NDE  
Sbjct: 97  IAITRKQIEKIPLSTRLNSSYDENASVNDFIDITKLSTKKLIKMISTILEKLIKSNDELR 156

Query: 128 ---TTDVSQQVSDETEDE--LLTPILAFYGKNVPEIAVVQYLERIQKYCPTTNDIFLSLL 182
               T ++ +  D+  DE  L+  I +F GK++P I + QY  RIQKYCPT N + L++L
Sbjct: 157 ERNETSLNDRTDDDNSDESKLVRSIKSFRGKHIPPIKLEQYFHRIQKYCPTNNLVLLAIL 216

Query: 183 VYFDRISKNYGHSSE--------------RNGCAK--QLFVMDSGNIHRLLITGVTICTK 226
           +YFDRISK    S E              RN   K    F++DS NIHRL+I+ +T+ TK
Sbjct: 217 IYFDRISKVLNGSKENESDPNISTHHHLLRNYDCKIEDKFLLDSYNIHRLIISAITVSTK 276

Query: 227 FLSDFFYSNSRYAKVGGISLQELNHLELQFLILCDFKLLVSVEEMQKYANLLYKF 281
           F SDFFYSNSRYAKVGGISL E+N+LELQFL++ +F L++S EE+Q+Y+ LL KF
Sbjct: 277 FWSDFFYSNSRYAKVGGISLDEMNYLELQFLLISNFDLIISSEEIQRYSGLLSKF 331

>KLLA0D01287g 112866..113903 some similarities with sp|P20052
           Saccharomyces cerevisiae YOL001w PHO80 cyclin,
           hypothetical start
          Length = 345

 Score = 82.0 bits (201), Expect = 1e-17,   Method: Compositional matrix adjust.
 Identities = 50/156 (32%), Positives = 79/156 (50%), Gaps = 21/156 (13%)

Query: 110 LILMISALLNRIITANDETTDVSQQVSDETEDELLTPILAFYGKNVPEIAVVQYLERIQK 169
           L+++IS +L+ +I  ND     +Q +           +  F+ K  P I V QYL R+ K
Sbjct: 33  LVVIISRMLSFLIQINDANNAGNQTME----------LTRFHSKAAPSITVYQYLIRLTK 82

Query: 170 YCPTTNDIFLSLLVYFDRISKNYGHSSERNGCAKQLFVMDSGNIHRLLITGVTICTKFLS 229
           Y    + + LS + Y D +S  Y             F ++S  +HR L+T  TI +K L 
Sbjct: 83  YSSLEHSVLLSAVYYIDLLSAVYPE-----------FTLNSLTVHRFLLTATTIASKGLC 131

Query: 230 DFFYSNSRYAKVGGISLQELNHLELQFLILCDFKLL 265
           D F +N+ Y+KVGG+   ELN LE +FL    ++++
Sbjct: 132 DSFCTNTHYSKVGGVQCSELNILENEFLERVRYRII 167

>CAGL0E02541g 244577..245605 similar to sp|P20052 Saccharomyces
           cerevisiae YOL001w PHO80 cyclin, start by similarity
          Length = 342

 Score = 81.6 bits (200), Expect = 1e-17,   Method: Compositional matrix adjust.
 Identities = 51/160 (31%), Positives = 81/160 (50%), Gaps = 20/160 (12%)

Query: 106 PTDELILMISALLNRIITANDETTDVSQQVSDETEDELLTPILAFYGKNVPEIAVVQYLE 165
           P  +L+++I+ +L  II  ND         S+  E+E    +  F+ K  P I+V  Y  
Sbjct: 27  PKGDLVILIARMLQFIIQIND---------SNIKENERKYGLTRFHSKIAPNISVFNYFT 77

Query: 166 RIQKYCPTTNDIFLSLLVYFDRISKNYGHSSERNGCAKQLFVMDSGNIHRLLITGVTICT 225
           R+ KY    + + LS + Y D +S  Y             F ++S   HR L+T  TI +
Sbjct: 78  RLTKYSLLEHSVLLSAVYYIDLLSNVYP-----------AFNLNSLTAHRFLLTATTIAS 126

Query: 226 KFLSDFFYSNSRYAKVGGISLQELNHLELQFLILCDFKLL 265
           K L D F +N+ Y+KVGG+   ELN LE +FL   +++++
Sbjct: 127 KGLCDSFCTNTHYSKVGGVQCNELNVLENEFLRKVNYRII 166

>ACR001C [1049] [Homologous to ScYOL001W (PHO80) - SH]
           (357962..359002) [1041 bp, 346 aa]
          Length = 346

 Score = 81.6 bits (200), Expect = 1e-17,   Method: Compositional matrix adjust.
 Identities = 49/164 (29%), Positives = 84/164 (51%), Gaps = 21/164 (12%)

Query: 110 LILMISALLNRIITANDETTDVSQQVSDETEDELLTPILAFYGKNVPEIAVVQYLERIQK 169
           L+++IS +L  +I  ND   D S+ +           +  F+ +  P I+V  YL R+ K
Sbjct: 30  LVVLISRMLTSLIGMNDAQGDKSKPIK----------LTRFHSRVPPAISVYNYLIRLTK 79

Query: 170 YCPTTNDIFLSLLVYFDRISKNYGHSSERNGCAKQLFVMDSGNIHRLLITGVTICTKFLS 229
           Y    + + L+ + Y D ++  Y             F +DS  +HR L+T  T+ +K L 
Sbjct: 80  YSSLEHCVLLASVYYIDLLTNVYPE-----------FRLDSLTVHRFLLTATTVASKGLC 128

Query: 230 DFFYSNSRYAKVGGISLQELNHLELQFLILCDFKLLVSVEEMQK 273
           D F +N+ YAKVGG+   ELN LE +FL   ++++L   + +++
Sbjct: 129 DSFCTNTHYAKVGGVQCSELNVLENEFLERVNYRILPRDDNIRR 172

>Sklu_2373.4 YOL001W, Contig c2373 11960-12883
          Length = 307

 Score = 78.2 bits (191), Expect = 2e-16,   Method: Compositional matrix adjust.
 Identities = 53/176 (30%), Positives = 88/176 (50%), Gaps = 25/176 (14%)

Query: 93  EQTDVKILNIADF---PTDELILMISALLNRIITANDETTDVSQQVSDETEDELLTPILA 149
           EQT  +I+   +F       L+++IS +L+ +I  ND             +D+ L  +  
Sbjct: 41  EQTSSQIMLPDEFLKCSRTALVVLISRMLSSLIQMNDSMC----------KDKNLK-LTR 89

Query: 150 FYGKNVPEIAVVQYLERIQKYCPTTNDIFLSLLVYFDRISKNYGHSSERNGCAKQLFVMD 209
           F+ +  P I+V  YL R+ KY      + ++ + Y D +S  Y             F ++
Sbjct: 90  FHSRVPPGISVYNYLIRLAKYSSLEPAVLIAAVYYIDLLSSVYPS-----------FTLN 138

Query: 210 SGNIHRLLITGVTICTKFLSDFFYSNSRYAKVGGISLQELNHLELQFLILCDFKLL 265
           S  +HR L+T  T+ +K LSD F +N  YAKVGG+   ELN LE +FL   +++++
Sbjct: 139 SLTVHRFLLTATTVASKGLSDSFCTNVHYAKVGGVQCSELNVLETEFLKRVNYRII 194

>Kwal_56.22443
          Length = 280

 Score = 73.9 bits (180), Expect = 4e-15,   Method: Compositional matrix adjust.
 Identities = 46/157 (29%), Positives = 80/157 (50%), Gaps = 22/157 (14%)

Query: 109 ELILMISALLNRIITANDETTDVSQQVSDETEDELLTPILAFYGKNVPEIAVVQYLERIQ 168
           +L+++IS +L+ +   ND        V  +   EL      F+ +  P+I+V  Y+ R+ 
Sbjct: 45  DLVILISRMLSFLTRIND-------SVPKDDAKELTR----FHSRVPPQISVYDYMMRLT 93

Query: 169 KYCPTTNDIFLSLLVYFDRISKNYGHSSERNGCAKQLFVMDSGNIHRLLITGVTICTKFL 228
           +Y      + ++ + Y D +S  Y             F ++S  +HR L+T  T+ +K L
Sbjct: 94  RYSSLEPAVLVASVYYIDLLSAMYPS-----------FSLNSLTVHRFLLTATTVASKGL 142

Query: 229 SDFFYSNSRYAKVGGISLQELNHLELQFLILCDFKLL 265
            D F +NS YAKVGG+   EL+ LE +FL   ++++L
Sbjct: 143 CDSFCTNSHYAKVGGVQCSELHVLESEFLKKVNYRIL 179

>YOL001W (PHO80) [4815] chr15 (325249..326130) Cyclin that interacts
           with Pho85p cyclin-dependent kinase, regulates the
           phosphate pathway through phosphorylation of Pho4p [882
           bp, 293 aa]
          Length = 293

 Score = 73.6 bits (179), Expect = 5e-15,   Method: Compositional matrix adjust.
 Identities = 52/187 (27%), Positives = 93/187 (49%), Gaps = 30/187 (16%)

Query: 98  KILNIADF---PTDELILMISALLNRIITANDETTDVSQQVSDETEDELLTPILAFYGKN 154
           K++  ADF      +L+++IS +L  +I  N+ +       + +++D++   +  ++ K 
Sbjct: 20  KVILPADFNKCSRTDLVVLISRMLVSLIAINENS------ATKKSDDQIT--LTRYHSKI 71

Query: 155 VPEIAVVQYLERIQKYCPTTNDIFLSLLVYFDRISKNYGHSSERNGCAKQLFVMDSGNIH 214
            P I++  Y  R+ K+    + + ++ L Y D +   Y             F ++S   H
Sbjct: 72  PPNISIFNYFIRLTKFSSLEHCVLMTSLYYIDLLQTVYPD-----------FTLNSLTAH 120

Query: 215 RLLITGVTICTKFLSDFFYSNSRYAKVGGISLQELNHLELQFLILCDFKL--------LV 266
           R L+T  T+ TK L D F +N+ YAKVGG+   ELN LE  FL   ++++        L 
Sbjct: 121 RFLLTATTVATKGLCDSFSTNAHYAKVGGVRCHELNILENDFLKRVNYRIIPRDHNITLC 180

Query: 267 SVEEMQK 273
           S+E+ QK
Sbjct: 181 SIEQKQK 187

>Scas_392.1
          Length = 303

 Score = 72.4 bits (176), Expect = 2e-14,   Method: Compositional matrix adjust.
 Identities = 47/157 (29%), Positives = 84/157 (53%), Gaps = 16/157 (10%)

Query: 109 ELILMISALLNRIITANDETTDVSQQVSDETEDELLTPILAFYGKNVPEIAVVQYLERIQ 168
           +L++++S +L  +I +ND T++ S   SD         +  F+ +  P I++  YL R+ 
Sbjct: 64  DLVVLVSRMLVLLIQSNDMTSNTSNSSSDSNMH-----LTRFHSRIPPNISIFNYLFRLT 118

Query: 169 KYCPTTNDIFLSLLVYFDRISKNYGHSSERNGCAKQLFVMDSGNIHRLLITGVTICTKFL 228
           KYC   + + LS++ Y D  +  Y             F  +S   HR L+T +T+  K L
Sbjct: 119 KYCYVEHCVLLSIIYYIDLFTAAY-----------PTFTFNSLTAHRFLLTAITVAGKGL 167

Query: 229 SDFFYSNSRYAKVGGISLQELNHLELQFLILCDFKLL 265
            D F + ++YAK+GG+  +ELN LE  FL + +++++
Sbjct: 168 CDSFCTTAQYAKIGGVQNEELNILETYFLRIVNYRII 204

>YGL134W (PCL10) [1853] chr7 (255666..256967) Cyclin that associates
           with the Pho85p cyclin-dependent kinase, involved in
           glycogen accumulation [1302 bp, 433 aa]
          Length = 433

 Score = 60.5 bits (145), Expect = 3e-10,   Method: Compositional matrix adjust.
 Identities = 37/119 (31%), Positives = 62/119 (52%), Gaps = 5/119 (4%)

Query: 150 FYGKNVPEIAVVQYLERIQKYCPTTNDIFLSLLVYFDRISKNYGHSSERNGCAKQLFVMD 209
           FY K+ P ++   +L+RIQ  C     ++L      D +      + + N   +    + 
Sbjct: 300 FYMKSKPTLSSADFLKRIQDKCEYQPTVYLVATFLIDTLFL----TRDGNNILQLKLNLQ 355

Query: 210 SGNIHRLLITGVTICTKFLSDFFYSNSRYAKVGGISLQELNHLELQFLI-LCDFKLLVS 267
              +HR++I  V + TK L DF +S+  ++KV GIS + L  LE+  LI +C+ KL+VS
Sbjct: 356 EKEVHRMIIAAVRLSTKLLEDFVHSHEYFSKVCGISKRLLTKLEVSLLICVCNTKLMVS 414

>YPL219W (PCL8) [5230] chr16 (136749..138227) Cyclin that associates
           with the Pho85p cyclin-dependent kinase, involved in
           control of glycogen accumulation [1479 bp, 492 aa]
          Length = 492

 Score = 58.2 bits (139), Expect = 2e-09,   Method: Compositional matrix adjust.
 Identities = 39/135 (28%), Positives = 67/135 (49%), Gaps = 14/135 (10%)

Query: 150 FYGKNVPEIAVVQYLERIQKYCPTTNDIFLSL-----LVYFDRISKNYGHSSERNGCAKQ 204
           F  KN P ++   +++RIQ  C     ++L       LV+  R         E +G  K 
Sbjct: 356 FVMKNPPSLSFRDFIDRIQNKCMFGAVVYLGATYLLQLVFLTR--------DEMDGPIKL 407

Query: 205 LFVMDSGNIHRLLITGVTICTKFLSDFFYSNSRYAKVGGISLQELNHLELQFLILCDFK- 263
              +     HR++I+ + I TK L DF +S +   KV GIS + L  LE+ F+   +F  
Sbjct: 408 KAKLQEDQAHRIIISTIRIATKLLEDFVHSQNYICKVFGISKRLLTKLEISFMASVNFDG 467

Query: 264 LLVSVEEMQKYANLL 278
           L+++ E+++K  ++L
Sbjct: 468 LMITCEKLEKTLHIL 482

>Scas_706.3
          Length = 451

 Score = 57.0 bits (136), Expect = 4e-09,   Method: Compositional matrix adjust.
 Identities = 35/124 (28%), Positives = 63/124 (50%), Gaps = 14/124 (11%)

Query: 154 NVPEIAVVQYLERIQKYCPTTNDIFLSLLVYF-----DRISKNYGHSSERNGCAKQLFVM 208
           NVP ++   ++ RIQ  C     +++S    F     DR         ER+G  K    +
Sbjct: 322 NVPSLSYTDFINRIQSKCMFGAIVYMSATYLFQILLLDR--------DERDGPIKLKHKL 373

Query: 209 DSGNIHRLLITGVTICTKFLSDFFYSNSRYAKVGGISLQELNHLELQFLI-LCDFKLLVS 267
               +HR++I  + + TK + DF +S+  + KV G+S + L+ LE+  L+ L   K++++
Sbjct: 374 QENEVHRMIIATIRVGTKLVEDFVHSHQYFCKVCGVSRKLLSKLEVTLLLCLKHDKIIIT 433

Query: 268 VEEM 271
            EE+
Sbjct: 434 TEEL 437

>Scas_720.47
          Length = 473

 Score = 53.9 bits (128), Expect = 5e-08,   Method: Compositional matrix adjust.
 Identities = 39/130 (30%), Positives = 64/130 (49%), Gaps = 21/130 (16%)

Query: 141 DELLTPILAFYG---KNVPEIAVVQYLERIQKYCPTTNDIFL-------SLLVYFDRISK 190
           DE L  ++AF     K+ P ++   +++RIQ  C     ++L       +LL+  +  S+
Sbjct: 328 DEPLDEMIAFSNFKMKSPPSLSYADFIQRIQNKCEYDPHVYLIATYLLQTLLLIREEHSR 387

Query: 191 NYGHSSERNGCAKQLFVMDSGNIHRLLITGVTICTKFLSDFFYSNSRYAKVGGISLQELN 250
                       K  F  +  ++HRL+I  V I TK L D  +S+  + KV GIS + L+
Sbjct: 388 KL----------KLRFKFEKSDVHRLIIATVRIATKLLEDHVHSHEYFCKVSGISKKLLS 437

Query: 251 HLELQFLILC 260
            LE+  L+LC
Sbjct: 438 KLEVS-LLLC 446

>KLLA0B02024g 176585..178168 some similarities with sp|P53124
           Saccharomyces cerevisiae YGL134w PCL10 cyclin like
           protein interacting with PHO85P, hypothetical start
          Length = 527

 Score = 51.2 bits (121), Expect = 3e-07,   Method: Compositional matrix adjust.
 Identities = 39/118 (33%), Positives = 59/118 (50%), Gaps = 13/118 (11%)

Query: 150 FYGKNVPEIAVVQYLERIQKYCPTTNDIFLS----LLVYFD-RISKNYGHSSERNGCAKQ 204
           F  K+ P +++ QYL+RI+  C     I+L+    L+ Y D +     G     N   + 
Sbjct: 392 FQMKSAPTLSISQYLDRIESKCSFPPIIYLTASFLLVTYCDIKFDTGSGKFHLENPITES 451

Query: 205 LFVMDSGNIHRLLITGVTICTKFLSDFFYSNSRYAKVGGISLQELNHLELQF-LILCD 261
           +        HRLLI  + +  K L D  +S+S ++KV GIS + L+ LEL   LIL D
Sbjct: 452 M-------THRLLIAFIRLAAKLLEDHVHSHSYFSKVCGISKKLLSKLELNLVLILQD 502

>CAGL0E05918g complement(585723..587168) some similarities with
           tr|Q08966 Saccharomyces cerevisiae YPL219w PCL8,
           hypothetical start
          Length = 481

 Score = 51.2 bits (121), Expect = 4e-07,   Method: Compositional matrix adjust.
 Identities = 40/135 (29%), Positives = 68/135 (50%), Gaps = 14/135 (10%)

Query: 150 FYGKNVPEIAVVQYLERIQKYCPTTNDIFLS----LLVYFDRISKNYGHSSERNGCAKQL 205
           F  K+ P I+   +++RIQ  C   + I+L     L + F  +++ Y      +G  +  
Sbjct: 346 FSMKSAPSISHHDFIQRIQNKCMFGSIIYLGATYLLQILF--LTREY-----NDGPLRLK 398

Query: 206 FVMDSGNIHRLLITGVTICTKFLSDFFYSNSRYAKVGGISLQELNHLELQFLILC--DFK 263
             +    +HR+++  + I TK L DF +S+    KV GIS + +  LEL  LI C  D  
Sbjct: 399 HKLQQNEVHRVIVGTIRIATKLLEDFVHSHQYICKVCGISKKLMTKLELA-LIFCLKDNN 457

Query: 264 LLVSVEEMQKYANLL 278
           LL++ E++   A +L
Sbjct: 458 LLINSEKLSATACIL 472

>CAGL0H08998g 877952..879595 weakly similar to tr|Q08966
           Saccharomyces cerevisiae YPL219w PCL8, hypothetical
           start
          Length = 547

 Score = 46.6 bits (109), Expect = 1e-05,   Method: Compositional matrix adjust.
 Identities = 37/124 (29%), Positives = 65/124 (52%), Gaps = 13/124 (10%)

Query: 142 ELLTPI-LAFYGKNVPEIAVVQYLERIQKYCPTTNDIFLS----LLVYFDRISKNYGHSS 196
           E+ +P  L F  K+ P ++   +L RIQ  C     I+L+    L + F  ++++   S+
Sbjct: 405 EIESPAALNFTMKSKPSVSAEIFLGRIQNKCEFGPIIYLAAAYLLQILF--LTRDNPDSN 462

Query: 197 ERNGCAKQLFVMDSGNIHRLLITGVTICTKFLSDFFYSNSRYAKVGGISLQELNHLELQF 256
            R         +    IHRL+I+ V +  K + DF +S+  ++KV G+S + L+ LE+  
Sbjct: 463 IR-----VRLKLRENEIHRLIISTVRVSAKLVEDFVHSHEYFSKVCGVSKKLLSKLEVS- 516

Query: 257 LILC 260
           LI+C
Sbjct: 517 LIMC 520

>Kwal_56.24151
          Length = 480

 Score = 45.8 bits (107), Expect = 2e-05,   Method: Compositional matrix adjust.
 Identities = 32/121 (26%), Positives = 61/121 (50%), Gaps = 6/121 (4%)

Query: 146 PILA-FYGKNVPEIAVVQYLERIQKYCPTTNDIFLSLLVYFDRISKNYGHSSERNGCAKQ 204
           P LA F   + P +A  +YL+R+         ++L+       +   +    +   C K 
Sbjct: 343 PQLATFNMDSTPTLAYEEYLQRLHCKFSFAPIVYLTAAHLLQSL---FLTRKDNKLCCK- 398

Query: 205 LFVMDSGNIHRLLITGVTICTKFLSDFFYSNSRYAKVGGISLQELNHLELQFLILCDFKL 264
            + +D+  +HRL+I  + + TK L D  +S++ ++++ GIS + L  LE+ FL   +F+ 
Sbjct: 399 -YHLDNCQVHRLIIASIRLATKLLEDCVHSHTCFSRICGISKKLLTKLEIAFLNCINFEG 457

Query: 265 L 265
           L
Sbjct: 458 L 458

>AFL115W [3080] [Homologous to ScYPL219W (PCL8) - SH; ScYGL134W
           (PCL10) - SH] complement(221235..222395) [1161 bp, 386
           aa]
          Length = 386

 Score = 42.7 bits (99), Expect = 2e-04,   Method: Compositional matrix adjust.
 Identities = 27/110 (24%), Positives = 52/110 (47%), Gaps = 2/110 (1%)

Query: 150 FYGKNVPEIAVVQYLERIQKYCPTTNDIFLSLLVYFDRISKNYGHSSERNGCAKQLFVMD 209
           F  K    +   QYL+RI   C     ++ +      R++  +  S    G  +  + + 
Sbjct: 244 FEMKAPASVTYTQYLDRINAKCMFAPIVYQTAGCLLLRLTLKWPPSE--TGPVQIRWPIA 301

Query: 210 SGNIHRLLITGVTICTKFLSDFFYSNSRYAKVGGISLQELNHLELQFLIL 259
              +HRL++  + + TK + D  +S+  ++KV GIS + L  LEL  +++
Sbjct: 302 ESYVHRLIVALIRVSTKIVEDTVHSHEYFSKVCGISKKLLMRLELALILV 351

>Scas_686.2
          Length = 210

 Score = 39.7 bits (91), Expect = 0.001,   Method: Compositional matrix adjust.
 Identities = 36/164 (21%), Positives = 73/164 (44%), Gaps = 21/164 (12%)

Query: 118 LNRIITANDETTDVSQQVSDETEDELLTPILAFYGKNVPEIAVVQ-YLERIQKYCPTTND 176
           ++ I+  +D  T V  Q++       L  I+  Y      +A +Q YL+ + K   +T  
Sbjct: 40  IDAILPPSDMNTIVLNQIT-----MFLASIIKKYSLETIGVADIQVYLKEVCKRSRSTKT 94

Query: 177 IFLSLLVYFDRISKNY----GHSSERNGCAKQLFVMDSGNIHRLLITGVTICTKFLSDFF 232
           +     +Y D+I  N+    G   +   C K++F           ++ + I  KF +D  
Sbjct: 95  VVFLAAIYLDKIYSNWEPMLGDIPKFARCVKRVF-----------LSCLIIAHKFANDKT 143

Query: 233 YSNSRYAKVGGISLQELNHLELQFLILCDFKLLVSVEEMQKYAN 276
           +S   ++ + G+  +EL  +E + L+  +++L V   E+  + N
Sbjct: 144 FSMRSWSSISGLGRKELTIMEKKCLLEINYELTVDKAELLSWQN 187

>Kwal_34.15996
          Length = 231

 Score = 32.7 bits (73), Expect = 0.20,   Method: Compositional matrix adjust.
 Identities = 15/62 (24%), Positives = 37/62 (59%)

Query: 215 RLLITGVTICTKFLSDFFYSNSRYAKVGGISLQELNHLELQFLILCDFKLLVSVEEMQKY 274
           R+ +  + +  KFL+D  +S + + ++ G+S ++L+ +E   L   D++LL++ E +  +
Sbjct: 127 RVYLCCLILAHKFLNDQTFSMNSWQRISGLSSKDLSTMERWCLSKLDYELLINDENLNSW 186

Query: 275 AN 276
           + 
Sbjct: 187 SR 188

>YHL022C (SPO11) [2264] chr8 complement(62958..64154) Catalytic
           subunit of the meiotic double strand break transesterase
           [1197 bp, 398 aa]
          Length = 398

 Score = 32.3 bits (72), Expect = 0.43,   Method: Compositional matrix adjust.
 Identities = 23/83 (27%), Positives = 38/83 (45%), Gaps = 8/83 (9%)

Query: 142 ELLTPILAFYGKNVPEIAVVQYLERIQKYCP---TTNDIFLSLLVYFDRISKNYGHSSER 198
           +L T  +   GK  P+     +L+++++YC    +   IF     Y   I+ NY HS+ER
Sbjct: 247 KLSTNTMLITGKGFPDFLTRLFLKKLEQYCSKLISDCSIFTDADPYGISIALNYTHSNER 306

Query: 199 NGCAKQLFVMDSGNIHRLLITGV 221
           N      ++    N   + IT V
Sbjct: 307 NA-----YICTMANYKGIRITQV 324

>Sklu_2028.3 YHL014C, Contig c2028 4688-5980 reverse complement
          Length = 430

 Score = 30.4 bits (67), Expect = 1.9,   Method: Compositional matrix adjust.
 Identities = 15/49 (30%), Positives = 25/49 (51%)

Query: 205 LFVMDSGNIHRLLITGVTICTKFLSDFFYSNSRYAKVGGISLQELNHLE 253
           L + D   + R    G  +  KFL+D  +++  Y  V G + QE+ H+E
Sbjct: 105 LTIYDIAGLTRGASQGEGLGNKFLNDIRHTDGIYQVVRGFTKQEITHIE 153

>Kwal_27.10591
          Length = 981

 Score = 28.9 bits (63), Expect = 5.1,   Method: Compositional matrix adjust.
 Identities = 15/46 (32%), Positives = 24/46 (52%), Gaps = 1/46 (2%)

Query: 185 FDRISKNYGHSSERNGCAKQLFVMDSGNIHRLLITGVTICTKFLSD 230
           FDR++  + +    NGC   + +  SG I+R+ + G T    F SD
Sbjct: 319 FDRVT-TFDYIPRNNGCTNFICMRQSGTIYRMSLKGGTSKAAFNSD 363

  Database: blastdb
    Posted date:  Apr 3, 2006  3:33 PM
  Number of letters in database: 16,596,109
  Number of sequences in database:  34,618
  
Lambda     K      H
   0.318    0.135    0.382 

Gapped
Lambda     K      H
   0.267   0.0410    0.140 

Matrix: BLOSUM62
Gap Penalties: Existence: 11, Extension: 1
Number of Sequences: 34618
Number of Hits to DB: 8,647,628
Number of extensions: 367462
Number of successful extensions: 1385
Number of sequences better than 10.0: 41
Number of HSP's gapped: 1358
Number of HSP's successfully gapped: 42
Length of query: 281
Length of database: 16,596,109
Length adjustment: 100
Effective length of query: 181
Effective length of database: 13,134,309
Effective search space: 2377309929
Effective search space used: 2377309929
Neighboring words threshold: 11
Window for multiple hits: 40
X1: 16 ( 7.3 bits)
X2: 38 (14.6 bits)
X3: 64 (24.7 bits)
S1: 41 (21.7 bits)
S2: 61 (28.1 bits)