Hit NameLength (aa)HSP LengthHSP ScoreHSP Significance
YIL049W (DFG10)25325013040.0
Scas_704.372512477701e-103
CAGL0L00693g2492476484e-85
Sklu_1893.32812754872e-60
ADL073W2772444863e-60
Kwal_23.58252432384285e-52
KLLA0C08261g2332253398e-39
Sklu_2083.556464643.1
AGR126C1013165643.2
Scas_417.427390615.9
BLASTP 2.2.26 [Sep-21-2011]

Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, 
Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), 
"Gapped BLAST and PSI-BLAST: a new generation of protein database search
programs",  Nucleic Acids Res. 25:3389-3402.

Reference for compositional score matrix adjustment: Altschul, Stephen F., 
John C. Wootton, E. Michael Gertz, Richa Agarwala, Aleksandr Morgulis,
Alejandro A. Schaffer, and Yi-Kuo Yu (2005) "Protein database searches
using compositionally adjusted substitution matrices", FEBS J. 272:5101-5109.

Query= YIL049W
         (250 letters)

Database: blastdb 
           34,618 sequences; 16,596,109 total letters

Searching..................................................done

                                                                 Score    E
Sequences producing significant alignments:                      (bits) Value

YIL049W (DFG10) [2618] chr9 (260157..260918) Protein involved in...   506   0.0  
Scas_704.37                                                           301   e-103
CAGL0L00693g 85333..86082 similar to sp|P40526 Saccharomyces cer...   254   4e-85
Sklu_1893.3 YIL049W, Contig c1893 3492-4337                           192   2e-60
ADL073W [1668] [Homologous to ScYIL049W (DFG10) - SH] complement...   191   3e-60
Kwal_23.5825                                                          169   5e-52
KLLA0C08261g complement(724399..725100) similar to sp|P40526 Sac...   135   8e-39
Sklu_2083.5 YLR047C, Contig c2083 8894-10588 reverse complement        29   3.1  
AGR126C [4437] [Homologous to ScYLL031C (GPI13) - SH] (989241..9...    29   3.2  
Scas_417.4                                                             28   5.9  

>YIL049W (DFG10) [2618] chr9 (260157..260918) Protein involved in
           filamentous growth, cell polarity, and cellular
           elongation [762 bp, 253 aa]
          Length = 253

 Score =  506 bits (1304), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 250/250 (100%), Positives = 250/250 (100%)

Query: 1   MYFDEEQLLKYTIYAYRLSFFVGICSLFIAKSCLPEFLQYGKTYRPKENSKYSSILERIK 60
           MYFDEEQLLKYTIYAYRLSFFVGICSLFIAKSCLPEFLQYGKTYRPKENSKYSSILERIK
Sbjct: 1   MYFDEEQLLKYTIYAYRLSFFVGICSLFIAKSCLPEFLQYGKTYRPKENSKYSSILERIK 60

Query: 61  KFTVPKAYFSHFYYLATFLSLVTLYFYPKFPIVWIIFGHSLRRLYETLYVLHYTSNSRMN 120
           KFTVPKAYFSHFYYLATFLSLVTLYFYPKFPIVWIIFGHSLRRLYETLYVLHYTSNSRMN
Sbjct: 61  KFTVPKAYFSHFYYLATFLSLVTLYFYPKFPIVWIIFGHSLRRLYETLYVLHYTSNSRMN 120

Query: 121 WSHYLVGIWFYSVLLLILNISLYKNSIPNTLNMNAFIIFCIASWDQYKNHVILANLVKYS 180
           WSHYLVGIWFYSVLLLILNISLYKNSIPNTLNMNAFIIFCIASWDQYKNHVILANLVKYS
Sbjct: 121 WSHYLVGIWFYSVLLLILNISLYKNSIPNTLNMNAFIIFCIASWDQYKNHVILANLVKYS 180

Query: 181 LPTGRLFRLVCCPHYLDEIIIYSTLLPYEQEFYLTLVWVITSLTISALETKNYYRHKFKD 240
           LPTGRLFRLVCCPHYLDEIIIYSTLLPYEQEFYLTLVWVITSLTISALETKNYYRHKFKD
Sbjct: 181 LPTGRLFRLVCCPHYLDEIIIYSTLLPYEQEFYLTLVWVITSLTISALETKNYYRHKFKD 240

Query: 241 NHVAPYAIIP 250
           NHVAPYAIIP
Sbjct: 241 NHVAPYAIIP 250

>Scas_704.37
          Length = 251

 Score =  301 bits (770), Expect = e-103,   Method: Compositional matrix adjust.
 Identities = 147/247 (59%), Positives = 187/247 (75%)

Query: 4   DEEQLLKYTIYAYRLSFFVGICSLFIAKSCLPEFLQYGKTYRPKENSKYSSILERIKKFT 63
             + +L   +  YR SFF+G+ SL IAK  LP+FLQYGKT    ++    ++ ++I  FT
Sbjct: 2   STDTILNLLVIGYRSSFFLGLLSLAIAKFYLPDFLQYGKTLNTAQSGDVMTLWDKIIHFT 61

Query: 64  VPKAYFSHFYYLATFLSLVTLYFYPKFPIVWIIFGHSLRRLYETLYVLHYTSNSRMNWSH 123
           VPK+YFSHFYYL+  LS+ TLY YPK+P+VW++  HSLRRLYETL+V  YTS SRMNWSH
Sbjct: 62  VPKSYFSHFYYLSAILSVSTLYVYPKYPVVWLLAFHSLRRLYETLFVCKYTSKSRMNWSH 121

Query: 124 YLVGIWFYSVLLLILNISLYKNSIPNTLNMNAFIIFCIASWDQYKNHVILANLVKYSLPT 183
           Y+VGIWFY+VL LILNI LY   I  T+N++A  I  +ASWDQYKNH +LA+L KYSLPT
Sbjct: 122 YVVGIWFYTVLHLILNICLYFERISPTINISALFILILASWDQYKNHRVLAHLRKYSLPT 181

Query: 184 GRLFRLVCCPHYLDEIIIYSTLLPYEQEFYLTLVWVITSLTISALETKNYYRHKFKDNHV 243
            RLF++VCCPHYLDE+IIYST L Y  EF   L+WV+ SL+ISA+ETKN+Y+ KF + +V
Sbjct: 182 QRLFKIVCCPHYLDEMIIYSTFLSYNAEFIWPLIWVVVSLSISAIETKNFYKSKFVEENV 241

Query: 244 APYAIIP 250
             Y+IIP
Sbjct: 242 PDYSIIP 248

>CAGL0L00693g 85333..86082 similar to sp|P40526 Saccharomyces
           cerevisiae YIL049w DFG10, hypothetical start
          Length = 249

 Score =  254 bits (648), Expect = 4e-85,   Method: Compositional matrix adjust.
 Identities = 129/247 (52%), Positives = 171/247 (69%), Gaps = 3/247 (1%)

Query: 4   DEEQLLKYTIYAYRLSFFVGICSLFIAKSCLPEFLQYGKTYRPKENSKYSSILERIKKFT 63
           D   +L+      RLS  VG+ SL IAK  LP+FL+YGKT+   +N    +I ++IK F+
Sbjct: 3   DNSNILQLITICLRLSNIVGLMSLIIAKYYLPDFLRYGKTFTFAKNGN-ENIWDKIKNFS 61

Query: 64  VPKAYFSHFYYLATFLSLVTLYFYPKFPIVWIIFGHSLRRLYETLYVLHYTSNSRMNWSH 123
           VPK+YF+HFY L++ L+LVTL  YP   +VW +F HS RRLYETLY+  YT  S+MNWSH
Sbjct: 62  VPKSYFAHFYILSSVLALVTLASYPTDILVWQLFLHSSRRLYETLYISKYTEKSKMNWSH 121

Query: 124 YLVGIWFYSVLLLILNISLYKNSIPNTLNMNAFIIFCIASWDQYKNHVILANLVKYSLPT 183
           Y VG+WFYS L +++ + + + +   T  +   ++  +ASWDQYKNHV+L+ L KYSLP 
Sbjct: 122 YAVGLWFYSQLNILVYLRVQREN--TTARVLPILVMVLASWDQYKNHVVLSKLKKYSLPR 179

Query: 184 GRLFRLVCCPHYLDEIIIYSTLLPYEQEFYLTLVWVITSLTISALETKNYYRHKFKDNHV 243
            RLF LVCCPHYLDE+IIY +L+ Y  EF   L+WVI SL+ISALE++ +Y  KFKD  V
Sbjct: 180 SRLFELVCCPHYLDEMIIYGSLVSYGHEFVWPLIWVIASLSISALESRKFYLSKFKDTEV 239

Query: 244 APYAIIP 250
             YA IP
Sbjct: 240 PRYAAIP 246

>Sklu_1893.3 YIL049W, Contig c1893 3492-4337
          Length = 281

 Score =  192 bits (487), Expect = 2e-60,   Method: Compositional matrix adjust.
 Identities = 112/275 (40%), Positives = 161/275 (58%), Gaps = 30/275 (10%)

Query: 4   DEEQLLKYTIYAYRLSFFVGICSLFIAKSCLPEFLQYGKTYRPKENSKYSS--------- 54
           D ++ +K        SF V I  + +AK  L  FL+YGKT    ++ K+           
Sbjct: 6   DMDRAIKCITLLIDASFVVAISCVLLAKWKLTGFLKYGKTLLSVDDKKHDGNEKEKREMT 65

Query: 55  ----ILERIKKFTVPKAYFSHFYYLATFLSLVTLYFYPKFPIVWIIFGHSLRRLYETLYV 110
               IL+  +   VP+A+FSHFY ++TF SLV   +YP   I W+   HSLRRLYE+  +
Sbjct: 66  NVLQILDFFESIVVPRAWFSHFYIISTFFSLVNGIWYPGHLIAWLPLFHSLRRLYESYCI 125

Query: 111 LHYTSNSRMNWSHYLVGIWFYSVLLLILNISLYKNSIPNTLNMN------AFIIFCIASW 164
             + + S+MN SHYLVGIWFY+ L LI +I L K++   +L+ N      A  +F  +S+
Sbjct: 126 SKFGAESKMNISHYLVGIWFYTSLNLIFSIGLSKDNKITSLSSNSAFQLIALFVFLASSY 185

Query: 165 DQYKNHVILANLVKYSLPTGRLFRLVCCPHYLDEIIIYSTLLPYEQ---------EFYLT 215
           +QY+NHV L+ LVKY+ P   LF+ V C HY DEI+IYS+L  Y +              
Sbjct: 186 NQYQNHVYLSQLVKYTNPKKGLFKWVSCAHYFDEILIYSSLFGYARVSRYGYLADGLKYC 245

Query: 216 LVWVITSLTISALETKNYYRHKFKDNHVAPYAIIP 250
           L+WV  +L++SA+ET+NYY H+++D  VAP+AIIP
Sbjct: 246 LLWVGINLSVSAIETRNYYSHRYQD--VAPHAIIP 278

>ADL073W [1668] [Homologous to ScYIL049W (DFG10) - SH]
           complement(553708..554541) [834 bp, 277 aa]
          Length = 277

 Score =  191 bits (486), Expect = 3e-60,   Method: Compositional matrix adjust.
 Identities = 107/244 (43%), Positives = 151/244 (61%), Gaps = 16/244 (6%)

Query: 19  SFFVGICSLFIAKSCLPEFLQYGKTYRPKENSKYSSILER-IKKFTVPKAYFSHFYYLAT 77
           S+ +G+ SL++AK  LP+ LQYGKT       K   ++E       VP+ YFSHFY L+ 
Sbjct: 35  SYGIGLFSLWLAKYRLPKLLQYGKT----RQKKLVGVIEPWYTSIAVPRRYFSHFYVLSF 90

Query: 78  FLSLVTLYFYPKFPIVWIIFGHSLRRLYETLYVLHYTSNSRMNWSHYLVGIWFYSVLLLI 137
            L+   LY++P+  I   IF HSLRRL E+  V  + S SRM+ +HYLVG+WFYSVL L 
Sbjct: 91  VLATANLYWFPEDVITSCIFFHSLRRLVESARVTKWGSESRMHAAHYLVGLWFYSVLNLS 150

Query: 138 LNISL---YKNSIPNTLN----MNAFIIFCIASWDQYKNHVILANLVKYSLPTGRLFRLV 190
           + + L    +   P+T+N        + F +ASWDQ +NH+ LA+++KY+LP   LF++V
Sbjct: 151 VYLQLNSRQRTRSPSTVNKVFGAVGAVGFLLASWDQARNHIHLAHMIKYTLPRRGLFKIV 210

Query: 191 CCPHYLDEIIIYSTLLPYEQ----EFYLTLVWVITSLTISALETKNYYRHKFKDNHVAPY 246
            C HY DEI+IY++L   E        + ++WV  +L +SA+ETK YY  KFK   VAPY
Sbjct: 211 ACAHYFDEIVIYASLAAMEATTRWSLTVAVIWVCANLGVSAVETKRYYDAKFKGQAVAPY 270

Query: 247 AIIP 250
           A+IP
Sbjct: 271 ALIP 274

>Kwal_23.5825
          Length = 243

 Score =  169 bits (428), Expect = 5e-52,   Method: Compositional matrix adjust.
 Identities = 101/238 (42%), Positives = 143/238 (60%), Gaps = 7/238 (2%)

Query: 15  AYRLSFFVGICSLFIAKSCLPEFLQYGKTYRPKENSKYSSILERIKKFTVPKAYFSHFYY 74
           A+  SF VGI S+ +AK  LP  L+YGKT       K   +L   ++ TVPK +F+HFY 
Sbjct: 8   AFYASFLVGIASVHLAKWQLPALLKYGKTLEGSRTQK--GLLGFFEQLTVPKQWFTHFYV 65

Query: 75  LATFLSLVTLYFYPKFPIVWIIFGHSLRRLYETLYVLHYTSNSRMNWSHYLVGIWFYSVL 134
            +T L+++ +Y      +  +   HS RRLYET  V  Y  NSRM+ SHYLVG+WFYSV 
Sbjct: 66  YSTTLAILNVYCQRNL-VSLLFLIHSGRRLYETQCVTKYGENSRMHLSHYLVGLWFYSVA 124

Query: 135 LLILNISLYKNSIPNTLNMNAFIIFCIASWDQYKNHVILANLVKYSLPTGRLFRLVCCPH 194
              +  S  ++ +P  +   A ++F ++S DQY NH+ L+ LVKY++PT  LF +   PH
Sbjct: 125 NWAVFESKSRSQLP-LVRFLAVLVFALSSVDQYMNHLHLSKLVKYTMPTYGLFSITTSPH 183

Query: 195 YLDEIIIYSTLLPYEQ--EFYLTLVWVITSLTISALETKNYYRHKFKDNHVAPYAIIP 250
           Y DE+++Y +L  Y    + +  LVWVI +L+ SALET+ +Y  KF      PYAIIP
Sbjct: 184 YFDEVLLYLSLTAYTGSLKLFACLVWVIVNLSTSALETRAWYLKKFPQT-TPPYAIIP 240

>KLLA0C08261g complement(724399..725100) similar to sp|P40526
           Saccharomyces cerevisiae YIL049w DFG10 singleton, start
           by similarity
          Length = 233

 Score =  135 bits (339), Expect = 8e-39,   Method: Compositional matrix adjust.
 Identities = 84/225 (37%), Positives = 131/225 (58%), Gaps = 18/225 (8%)

Query: 19  SFFVGICSLFIAKSCLPEFLQYGKTYRPKENSKYSSILERIKKFTVPKAYFSHFYYLATF 78
           +F+VGI S+F+A+  +P+ L+YGKT+    N  YS         T PK+ F HFY L++ 
Sbjct: 11  TFYVGIISVFVAEFYIPQLLKYGKTWEASNNFWYS--------LTCPKSNFGHFYLLSSI 62

Query: 79  LSLVTLYFYPKFPIVWIIFGHSLRRLYETLYVLHYTSNSRMNWSHYLVGIWFYSVLLLIL 138
            S+  L  + +  +   +F HS+RRLYE  Y +     S+++ SHYLVGIWFY+ L   L
Sbjct: 63  FSIYNL-LWIRSLLTLSVFIHSVRRLYEC-YCVTKWGQSKIHLSHYLVGIWFYTTL--NL 118

Query: 139 NISLYKNSIPNTLNMNAFIIFCIASWDQYKNHVILANLVKYSLPTGRLFRLVCCPHYLDE 198
            I LY      +L   + I+F ++S DQ  NH  L+ L KYS P+  LF+ +C  HY DE
Sbjct: 119 GIMLYHGETQYSLI--SVILFIMSSLDQATNHDYLSKLKKYSQPSYGLFKYICSAHYFDE 176

Query: 199 IIIYSTLLPYEQEFYLTLV----WVITSLTISALETKNYYRHKFK 239
           ++IY++ +  ++   + L+    W++ +L  S+ ET N+Y+ KF 
Sbjct: 177 LLIYTSFMLMDKGSRMLLIHCILWILVNLGTSSFETGNWYQEKFG 221

>Sklu_2083.5 YLR047C, Contig c2083 8894-10588 reverse complement
          Length = 564

 Score = 29.3 bits (64), Expect = 3.1,   Method: Compositional matrix adjust.
 Identities = 15/64 (23%), Positives = 38/64 (59%), Gaps = 6/64 (9%)

Query: 63  TVPKAYFSHF------YYLATFLSLVTLYFYPKFPIVWIIFGHSLRRLYETLYVLHYTSN 116
           ++P+   +HF      +Y+AT+L+++ L+F+ + P+ W    +    +++  Y L++T  
Sbjct: 79  SLPRVRRTHFRVFYYVHYIATWLTVILLHFHARPPMSWYTLMNVSILVFQIGYRLYHTKR 138

Query: 117 SRMN 120
           +R++
Sbjct: 139 TRVS 142

>AGR126C [4437] [Homologous to ScYLL031C (GPI13) - SH]
           (989241..992282) [3042 bp, 1013 aa]
          Length = 1013

 Score = 29.3 bits (64), Expect = 3.2,   Method: Compositional matrix adjust.
 Identities = 36/165 (21%), Positives = 70/165 (42%), Gaps = 20/165 (12%)

Query: 75  LATFLSLVTLYFYP---KFPIVWII--FGHSLRRLYE-------TLYVLHYTSNSRMNWS 122
           LAT + ++  ++ P   ++ + W++  FG  L   +        TL+ L +TSNS   W 
Sbjct: 520 LATAVGIIIGFYVPIFDRYNLTWLVLRFGEELSDYWSRVAAFLITLHALIFTSNSFTIWE 579

Query: 123 HYLVGIWFYSVLLLILNISLYKNSIPNTLNMNAFIIFCIASWDQYKNHVILANLVKYSLP 182
             +V     ++ +L L   ++   +P   + +A +   +   +   + +        SLP
Sbjct: 580 DKIVSFSLTTLGMLTLYEFVF---LPKRHSTSAILAAALGEKEGTVSGISSGQANSDSLP 636

Query: 183 TGRLFRLVCCPHYLDEIIIYS-----TLLPYEQEFYLTLVWVITS 222
            GR  R+V   H +  I+        T+   EQ  Y T  + +T+
Sbjct: 637 LGRFARIVGGYHSIVLIVCTRLASLITICREEQGAYCTPTFTLTN 681

>Scas_417.4
          Length = 273

 Score = 28.1 bits (61), Expect = 5.9,   Method: Compositional matrix adjust.
 Identities = 19/90 (21%), Positives = 38/90 (42%), Gaps = 1/90 (1%)

Query: 22  VGICSLFIAKSCLPEFLQYGKTYRPKENSKYSSILERIKKFTVPKAYFSHFYYLATFLSL 81
           +G+C + + +  L E +Q GKT    + +  +  +  ++  T+            + + L
Sbjct: 98  LGLCMMELQRRLLQE-MQKGKTQDGVQRTGLNVSVTMVQPGTMRSPSLRRVISNGSIIVL 156

Query: 82  VTLYFYPKFPIVWIIFGHSLRRLYETLYVL 111
           + LY    +PI+W+      R     LY L
Sbjct: 157 IVLYCVILYPILWLFTKSGNRGAQSILYAL 186

  Database: blastdb
    Posted date:  Apr 3, 2006  3:33 PM
  Number of letters in database: 16,596,109
  Number of sequences in database:  34,618
  
Lambda     K      H
   0.329    0.143    0.457 

Gapped
Lambda     K      H
   0.267   0.0410    0.140 

Matrix: BLOSUM62
Gap Penalties: Existence: 11, Extension: 1
Number of Sequences: 34618
Number of Hits to DB: 8,946,835
Number of extensions: 390739
Number of successful extensions: 1304
Number of sequences better than 10.0: 26
Number of HSP's gapped: 1286
Number of HSP's successfully gapped: 26
Length of query: 250
Length of database: 16,596,109
Length adjustment: 99
Effective length of query: 151
Effective length of database: 13,168,927
Effective search space: 1988507977
Effective search space used: 1988507977
Neighboring words threshold: 11
Window for multiple hits: 40
X1: 15 ( 7.1 bits)
X2: 38 (14.6 bits)
X3: 64 (24.7 bits)
S1: 40 (21.8 bits)
S2: 60 (27.7 bits)