Hit NameLength (aa)HSP LengthHSP ScoreHSP Significance
YIL048W (NEO1)1151113157420.0
Scas_704.381161108945990.0
CAGL0L00715g1144108144950.0
Sklu_2193.11143110143930.0
Kwal_23.5789113398241620.0
KLLA0C08393g1148102241350.0
ADL079C116698641010.0
Scas_89.127125512301e-161
KLLA0A04015g134399311481e-136
CAGL0G06270g1328103411301e-134
YAL026C (DRS2)1355101011301e-133
Kwal_26.70701315100811051e-130
ADR350W131187410551e-123
YER166W (DNF1)15718929021e-101
CAGL0L11814g15769909001e-101
KLLA0C17644g15768948855e-99
Scas_576.815919608831e-98
YDR093W (DNF2)16129908831e-98
AGR120C154710038793e-98
CAGL0G08085g15788998784e-98
Scas_636.1615549598732e-97
KLLA0E01650g15504065641e-58
CAGL0H04477g16263965596e-58
Kwal_23.355615975125516e-57
AFL191W15753885363e-55
YMR162C (DNF3)16564395321e-54
Scas_669.316384275105e-52
Scas_505.410252943451e-32
YDR040C (ENA1)10917632744e-24
YDR039C (ENA2)10918252744e-24
YDR038C (ENA5)10918252745e-24
KLLA0B08217g14397762648e-23
Scas_665.3014396682639e-23
Kwal_23.316011008402621e-22
Kwal_26.920714696242631e-22
KLLA0A08910g12807752558e-22
AFR567W14497872522e-21
YOR291W14726062522e-21
CAGL0A00517g11227462494e-21
CAGL0K12034g10878292371e-19
AFL011W12427112352e-19
YGL006W (PMC1)11737752298e-19
KLLA0F20658g10825042262e-18
CAGL0I04312g9517572234e-18
CAGL0M11308g14527892244e-18
Kwal_47.1754712407922191e-17
YGL167C (PMR1)9506622153e-17
KLLA0E14630g10825622129e-17
Kwal_14.14989396692046e-16
AEL301W9576532011e-15
Scas_707.48*7416691965e-15
KLLA0A03157g9386971967e-15
AGL097C10967611941e-14
CAGL0J01870g9467431833e-13
AFR354C12106841582e-10
CAGL0L01419g12144231412e-08
Scas_583.14*8754351384e-08
KLLA0E22352g12062901394e-08
Scas_688.19134701332e-07
YGL008C (PMA1)9181571295e-07
YEL031W (SPF1)12154271261e-06
KLLA0A09031g8994791172e-05
YPL036W (PMA2)9471571143e-05
AGL085C9092711081e-04
Scas_710.41904291990.002
Kwal_47.17522899350980.002
KLLA0F07447g97590970.003
CAGL0A00495g902271920.011
Scas_227.0d307255910.012
Scas_297.1800190920.012
Scas_569.0d468120900.019
KLLA0D04092g115241860.065
AGL041C123371840.10
Kwal_55.2157598947840.11
CAGL0M08602g101283770.65
YBR295W (PCA1)121643741.6
AGR259C79860722.8
YDL079C (MRK1)501123713.1
YDL024C (DIA3)468169704.1
YMR139W (RIM11)37090704.2
YKL139W (CTK1)52866704.5
Scas_709.3358557695.5
BLASTP 2.2.26 [Sep-21-2011]

Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, 
Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), 
"Gapped BLAST and PSI-BLAST: a new generation of protein database search
programs",  Nucleic Acids Res. 25:3389-3402.

Reference for compositional score matrix adjustment: Altschul, Stephen F., 
John C. Wootton, E. Michael Gertz, Richa Agarwala, Aleksandr Morgulis,
Alejandro A. Schaffer, and Yi-Kuo Yu (2005) "Protein database searches
using compositionally adjusted substitution matrices", FEBS J. 272:5101-5109.

Query= YIL048W
         (1131 letters)

Database: blastdb 
           34,618 sequences; 16,596,109 total letters

Searching..................................................done

                                                                 Score    E
Sequences producing significant alignments:                      (bits) Value

YIL048W (NEO1) [2619] chr9 (261436..264891) Member of the Drs2p-...  2216   0.0  
Scas_704.38                                                          1776   0.0  
CAGL0L00715g 86810..90244 highly similar to sp|P40527 Saccharomy...  1736   0.0  
Sklu_2193.1 YIL048W, Contig c2193 334-3765 reverse complement        1696   0.0  
Kwal_23.5789                                                         1607   0.0  
KLLA0C08393g 734655..738101 highly similar to sp|P40527 Saccharo...  1597   0.0  
ADL079C [1662] [Homologous to ScYIL048W (NEO1) - SH] (544854..54...  1584   0.0  
Scas_89.1                                                             478   e-161
KLLA0A04015g complement(355624..359655) similar to sp|P39524 Sac...   446   e-136
CAGL0G06270g 598357..602343 highly similar to sp|P39524 Saccharo...   439   e-134
YAL026C (DRS2) [42] chr1 complement(95633..99700) Membrane-spann...   439   e-133
Kwal_26.7070                                                          430   e-130
ADR350W [2091] [Homologous to ScYAL026C (DRS2) - SH] complement(...   410   e-123
YER166W (DNF1) [1594] chr5 (512739..517454) Member of the haloac...   352   e-101
CAGL0L11814g 1262124..1266854 highly similar to sp|P32660 Saccha...   351   e-101
KLLA0C17644g 1557138..1561868 similar to sp|P32660 Saccharomyces...   345   5e-99
Scas_576.8                                                            344   1e-98
YDR093W (DNF2) [945] chr4 (631276..636114) Member of the haloaci...   344   1e-98
AGR120C [4431] [Homologous to ScYER166W (DNF1) - SH; ScYDR093W (...   343   3e-98
CAGL0G08085g 763185..767921 highly similar to sp|Q12675 Saccharo...   342   4e-98
Scas_636.16                                                           340   2e-97
KLLA0E01650g complement(155975..160627) similar to sp|Q12674 Sac...   221   1e-58
CAGL0H04477g 421857..426737 similar to sp|Q12674 Saccharomyces c...   219   6e-58
Kwal_23.3556                                                          216   6e-57
AFL191W [3004] [Homologous to ScYMR162C (DNF3) - SH] complement(...   211   3e-55
YMR162C (DNF3) [4117] chr13 complement(578950..583920) Member of...   209   1e-54
Scas_669.3                                                            201   5e-52
Scas_505.4                                                            137   1e-32
YDR040C (ENA1) [893] chr4 complement(535187..538462) P-type ATPa...   110   4e-24
YDR039C (ENA2) [892] chr4 complement(531302..534577) Member of t...   110   4e-24
YDR038C (ENA5) [891] chr4 complement(527417..530692) Member of t...   110   5e-24
KLLA0B08217g complement(724364..728683) similar to sp|Q12697 Sac...   106   8e-23
Scas_665.30                                                           105   9e-23
Kwal_23.3160                                                          105   1e-22
Kwal_26.9207                                                          105   1e-22
KLLA0A08910g complement(779526..783368) similar to sp|P38929 Sac...   102   8e-22
AFR567W [3759] [Homologous to ScYOR291W - SH] complement(1455295...   101   2e-21
YOR291W (YOR291W) [5075] chr15 (861172..865590) Member of the ca...   101   2e-21
CAGL0A00517g 58830..62198 similar to sp|P38929 Saccharomyces cer...   100   4e-21
CAGL0K12034g complement(1161299..1164562) highly similar to sp|P...    96   1e-19
AFL011W [3182] [Homologous to ScYGL006W (PMC1) - SH] complement(...    95   2e-19
YGL006W (PMC1) [1966] chr7 (485923..489444) Vacuolar Ca2+-transp...    93   8e-19
KLLA0F20658g 1919851..1923099 similar to sp|Q12691 Saccharomyces...    92   2e-18
CAGL0I04312g complement(382354..385209) highly similar to sp|P13...    91   4e-18
CAGL0M11308g 1110211..1114569 similar to sp|Q12697 Saccharomyces...    91   4e-18
Kwal_47.17547                                                          89   1e-17
YGL167C (PMR1) [1823] chr7 complement(187620..190472) Ca2+-trans...    87   3e-17
KLLA0E14630g complement(1297636..1300884) similar to sp|Q01896 S...    86   9e-17
Kwal_14.1498                                                           83   6e-16
AEL301W [2204] [Homologous to ScYGL167C (PMR1) - SH] complement(...    82   1e-15
Scas_707.48*                                                           80   5e-15
KLLA0A03157g complement(281313..284129) gi|3288523|emb|CAA04476....    80   7e-15
AGL097C [4215] [Homologous to ScYDR039C (ENA2 ) - NSH] (520915.....    79   1e-14
CAGL0J01870g 181666..184506 highly similar to sp|P13586 Saccharo...    75   3e-13
AFR354C [3546] [Homologous to ScYEL031W (SPF1) - SH] (1078275..1...    65   2e-10
CAGL0L01419g 156123..159767 highly similar to sp|P39986 Saccharo...    59   2e-08
Scas_583.14*                                                           58   4e-08
KLLA0E22352g 1984522..1988142 highly similar to sp|P39986 Saccha...    58   4e-08
Scas_688.1                                                             56   2e-07
YGL008C (PMA1) [1965] chr7 complement(479913..482669) H+-transpo...    54   5e-07
YEL031W (SPF1) [1394] chr5 (90258..93905) Putative Ca2+-transpor...    53   1e-06
KLLA0A09031g 787768..790467 gi|1346734|sp|P49380|PMA1_KLULA Kluy...    50   2e-05
YPL036W (PMA2) [5403] chr16 (482839..485682) H[+]-transporting P...    49   3e-05
AGL085C [4226] [Homologous to ScYGL008C (PMA1) - SH; ScYPL036W (...    46   1e-04
Scas_710.41                                                            43   0.002
Kwal_47.17522                                                          42   0.002
KLLA0F07447g 700685..703612 similar to sp|P38995 Saccharomyces c...    42   0.003
CAGL0A00495g complement(55014..57722) highly similar to sp|P0503...    40   0.011
Scas_227.0d                                                            40   0.012
Scas_297.1                                                             40   0.012
Scas_569.0d                                                            39   0.019
KLLA0D04092g complement(344666..348124) some similarities with s...    38   0.065
AGL041C [4270] [Homologous to ScYDR270W - NSH] (628428..632129) ...    37   0.10 
Kwal_55.21575                                                          37   0.11 
CAGL0M08602g complement(856349..859387) similar to sp|P38995 Sac...    34   0.65 
YBR295W (PCA1) [472] chr2 (792805..796455) P-type copper-transpo...    33   1.6  
AGR259C [4570] [Homologous to ScYOR168W (GLN4) - SH] (1227069..1...    32   2.8  
YDL079C (MRK1) [789] chr4 complement(312951..314044,314337..3147...    32   3.1  
YDL024C (DIA3) [837] chr4 complement(408448..409854) Protein inv...    32   4.1  
YMR139W (RIM11) [4096] chr13 (546124..547236) Member of the GSK3...    32   4.2  
YKL139W (CTK1) [3128] chr11 (182963..184549) C-terminal domain (...    32   4.5  
Scas_709.33                                                            31   5.5  

>YIL048W (NEO1) [2619] chr9 (261436..264891) Member of the Drs2p-like
            ATPases family in the superfamily of P-type ATPases,
            overproduction confers neomycin resistance [3456 bp, 1151
            aa]
          Length = 1151

 Score = 2216 bits (5742), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 1078/1131 (95%), Positives = 1078/1131 (95%)

Query: 1    MPNPPSFKSHKQNLFNSNNNQHANXXXXXXXXXXXXXXXXXXXXQINNNPEPLSKHNTVG 60
            MPNPPSFKSHKQNLFNSNNNQHAN                    QINNNPEPLSKHNTVG
Sbjct: 1    MPNPPSFKSHKQNLFNSNNNQHANSVDSFDLHLDDSFDAALDSLQINNNPEPLSKHNTVG 60

Query: 61   DRESFEMRTVDDLDNFXXXXXXXXXXXXXTDTHPLMYDNRLSQDDNFKFTNIAXXXXXXX 120
            DRESFEMRTVDDLDNF             TDTHPLMYDNRLSQDDNFKFTNIA       
Sbjct: 61   DRESFEMRTVDDLDNFSNHSSDSHRKSSNTDTHPLMYDNRLSQDDNFKFTNIASSPPSSS 120

Query: 121  XXIFSKALSYLKVSNTKNWSKFGSPIELSDQHIEREIHPDTTPVYDRNRYVSNELSNAKY 180
              IFSKALSYLKVSNTKNWSKFGSPIELSDQHIEREIHPDTTPVYDRNRYVSNELSNAKY
Sbjct: 121  NNIFSKALSYLKVSNTKNWSKFGSPIELSDQHIEREIHPDTTPVYDRNRYVSNELSNAKY 180

Query: 181  NAVTFVPTLLYEQFKFFYNLYFLVVALSQAVPALRIGYLSSYIVPLAFVLTVTMAKEAXX 240
            NAVTFVPTLLYEQFKFFYNLYFLVVALSQAVPALRIGYLSSYIVPLAFVLTVTMAKEA  
Sbjct: 181  NAVTFVPTLLYEQFKFFYNLYFLVVALSQAVPALRIGYLSSYIVPLAFVLTVTMAKEAID 240

Query: 241  XXXXXXXXXESNNELYHVITRNRSIPSKDLKVGDLIKVHKGDRIPADLVLLQSSEPSGES 300
                     ESNNELYHVITRNRSIPSKDLKVGDLIKVHKGDRIPADLVLLQSSEPSGES
Sbjct: 241  DIQRRRRDRESNNELYHVITRNRSIPSKDLKVGDLIKVHKGDRIPADLVLLQSSEPSGES 300

Query: 301  FIKTDQLDGETDWKLRVACPLTQNLSENDLINRISITASAPEKSIHKFLGKVTYKDSTSN 360
            FIKTDQLDGETDWKLRVACPLTQNLSENDLINRISITASAPEKSIHKFLGKVTYKDSTSN
Sbjct: 301  FIKTDQLDGETDWKLRVACPLTQNLSENDLINRISITASAPEKSIHKFLGKVTYKDSTSN 360

Query: 361  PLSVDNTLWANTVLASSGFCIACVVYTGRDTRQAMNTTTAKVKTGLLELEINSISKILCA 420
            PLSVDNTLWANTVLASSGFCIACVVYTGRDTRQAMNTTTAKVKTGLLELEINSISKILCA
Sbjct: 361  PLSVDNTLWANTVLASSGFCIACVVYTGRDTRQAMNTTTAKVKTGLLELEINSISKILCA 420

Query: 421  CVFALSILLVAFAGFHNDDWYIDILRYLILFSTIIPVSLRVNLDLAKSVYAHQIEHDKTI 480
            CVFALSILLVAFAGFHNDDWYIDILRYLILFSTIIPVSLRVNLDLAKSVYAHQIEHDKTI
Sbjct: 421  CVFALSILLVAFAGFHNDDWYIDILRYLILFSTIIPVSLRVNLDLAKSVYAHQIEHDKTI 480

Query: 481  PETIVRTSTIPEDLGRIEYLLSDKTGTLTQNDMQLKKIHLGTVSYTSETLDIVSDYVQSL 540
            PETIVRTSTIPEDLGRIEYLLSDKTGTLTQNDMQLKKIHLGTVSYTSETLDIVSDYVQSL
Sbjct: 481  PETIVRTSTIPEDLGRIEYLLSDKTGTLTQNDMQLKKIHLGTVSYTSETLDIVSDYVQSL 540

Query: 541  VSSKNDSLNNSKVALSTTRKDMSFRVRDMILTLAICHNVTPTFEDDELTYQAASPDEIAI 600
            VSSKNDSLNNSKVALSTTRKDMSFRVRDMILTLAICHNVTPTFEDDELTYQAASPDEIAI
Sbjct: 541  VSSKNDSLNNSKVALSTTRKDMSFRVRDMILTLAICHNVTPTFEDDELTYQAASPDEIAI 600

Query: 601  VKFTESVGLSLFKRDRHSISLLHEHSGKTLNYEILQVFPFNSDSKRMGIIVRDEQLDEYW 660
            VKFTESVGLSLFKRDRHSISLLHEHSGKTLNYEILQVFPFNSDSKRMGIIVRDEQLDEYW
Sbjct: 601  VKFTESVGLSLFKRDRHSISLLHEHSGKTLNYEILQVFPFNSDSKRMGIIVRDEQLDEYW 660

Query: 661  FMQKGADTVMSKIVESNDWLEEETGNMAREGLRTLVIGRKKLNKKIYEQFQKEYNDASLS 720
            FMQKGADTVMSKIVESNDWLEEETGNMAREGLRTLVIGRKKLNKKIYEQFQKEYNDASLS
Sbjct: 661  FMQKGADTVMSKIVESNDWLEEETGNMAREGLRTLVIGRKKLNKKIYEQFQKEYNDASLS 720

Query: 721  MLNRDQQMSQVITKYLEHDLELLGLTGVEDKLQKDVKSSIELLRNAGIKIWMLTGDKVET 780
            MLNRDQQMSQVITKYLEHDLELLGLTGVEDKLQKDVKSSIELLRNAGIKIWMLTGDKVET
Sbjct: 721  MLNRDQQMSQVITKYLEHDLELLGLTGVEDKLQKDVKSSIELLRNAGIKIWMLTGDKVET 780

Query: 781  ARCVSISAKLISRGQYVHTITKVTRPEGAFNQLEYLKINRNACLLIDGESLGMFLKHYEQ 840
            ARCVSISAKLISRGQYVHTITKVTRPEGAFNQLEYLKINRNACLLIDGESLGMFLKHYEQ
Sbjct: 781  ARCVSISAKLISRGQYVHTITKVTRPEGAFNQLEYLKINRNACLLIDGESLGMFLKHYEQ 840

Query: 841  EFFDVVVHLPTVIACRCTPQQKADVALVIRKMTGKRVCCIGDGGNDVSMIQCADVGVGIV 900
            EFFDVVVHLPTVIACRCTPQQKADVALVIRKMTGKRVCCIGDGGNDVSMIQCADVGVGIV
Sbjct: 841  EFFDVVVHLPTVIACRCTPQQKADVALVIRKMTGKRVCCIGDGGNDVSMIQCADVGVGIV 900

Query: 901  GKEGKQASLAADFSITQFCHLTELLLWHGRNSYKRSAKLAQFVMHRGLIIAICQAVYSIC 960
            GKEGKQASLAADFSITQFCHLTELLLWHGRNSYKRSAKLAQFVMHRGLIIAICQAVYSIC
Sbjct: 901  GKEGKQASLAADFSITQFCHLTELLLWHGRNSYKRSAKLAQFVMHRGLIIAICQAVYSIC 960

Query: 961  SLFEPIALYQGWLMVGYATCYTMAPVFSLTLDHDIEESLTKIYPELYKELTEGKSLSYKT 1020
            SLFEPIALYQGWLMVGYATCYTMAPVFSLTLDHDIEESLTKIYPELYKELTEGKSLSYKT
Sbjct: 961  SLFEPIALYQGWLMVGYATCYTMAPVFSLTLDHDIEESLTKIYPELYKELTEGKSLSYKT 1020

Query: 1021 FFVWVLLSLFQGSVIQLFSQAFTSLLDTDFTRMVAISFTALVVNELIMVALEIYTWNKTM 1080
            FFVWVLLSLFQGSVIQLFSQAFTSLLDTDFTRMVAISFTALVVNELIMVALEIYTWNKTM
Sbjct: 1021 FFVWVLLSLFQGSVIQLFSQAFTSLLDTDFTRMVAISFTALVVNELIMVALEIYTWNKTM 1080

Query: 1081 LVTEIATLLFYIVSVPFLGDYFDLGYMTTVNYYAGLLVILLISIFPVWTAK 1131
            LVTEIATLLFYIVSVPFLGDYFDLGYMTTVNYYAGLLVILLISIFPVWTAK
Sbjct: 1081 LVTEIATLLFYIVSVPFLGDYFDLGYMTTVNYYAGLLVILLISIFPVWTAK 1131

>Scas_704.38
          Length = 1161

 Score = 1776 bits (4599), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 855/1089 (78%), Positives = 954/1089 (87%), Gaps = 8/1089 (0%)

Query: 47   NNNPEPLSKHNTVGDRESFEMRTVDDLDNFXXXXXXXXXXXXXTDTHPLMYDNRLSQDDN 106
            N N    S  N    +ESFEM+++    N               D  PLM+D+  + D +
Sbjct: 57   NQNINKASSENKDKLQESFEMKSL----NARNGGLGHSRNSSNGDRQPLMHDSASNPDGS 112

Query: 107  -FKFTNIAXXXXXX-XXXIFSKALSYLKVSNTKNWSKFGS--PIELSDQHIEREIHPDTT 162
             +K+TN++           FS  ++ LK+   + W KF +   +EL D+H+EREIHP TT
Sbjct: 113  PYKYTNVSESALNLHSNNRFSNWITKLKMVGAQKWKKFHTMGSVELDDRHMEREIHPSTT 172

Query: 163  PVYDRNRYVSNELSNAKYNAVTFVPTLLYEQFKFFYNLYFLVVALSQAVPALRIGYLSSY 222
            PVYDRNRY  NE+SNAKYNA TF+PTLLYEQFKFFYNLYFLVVALSQA+PALRIGYLSSY
Sbjct: 173  PVYDRNRYPGNEISNAKYNAFTFIPTLLYEQFKFFYNLYFLVVALSQAIPALRIGYLSSY 232

Query: 223  IVPLAFVLTVTMAKEAXXXXXXXXXXXESNNELYHVITRNRSIPSKDLKVGDLIKVHKGD 282
            +VPLAFVLTVTM+KEA           ESN+ELYHV+ +++ +PSKDLKVGDLIK+ KGD
Sbjct: 233  VVPLAFVLTVTMSKEAMDDIQRRRRDNESNSELYHVLNQSKLVPSKDLKVGDLIKISKGD 292

Query: 283  RIPADLVLLQSSEPSGESFIKTDQLDGETDWKLRVACPLTQNLSENDLINRISITASAPE 342
            R+PADLVLLQSSEPSGE+FIKTDQLDGETDWKLR+A  LTQNL+E DL+N++SITASAPE
Sbjct: 293  RLPADLVLLQSSEPSGETFIKTDQLDGETDWKLRIAPALTQNLTEPDLMNKVSITASAPE 352

Query: 343  KSIHKFLGKVTYKDSTSNPLSVDNTLWANTVLASSGFCIACVVYTGRDTRQAMNTTTAKV 402
            K+IH FLGKVTYKD++SNPLS+DNTLWANTVLAS+GFCI CVVYTGRDTRQAMNTTTA V
Sbjct: 353  KAIHNFLGKVTYKDTSSNPLSIDNTLWANTVLASTGFCIGCVVYTGRDTRQAMNTTTATV 412

Query: 403  KTGLLELEINSISKILCACVFALSILLVAFAGFHNDDWYIDILRYLILFSTIIPVSLRVN 462
            KTGLLELEINSISKILCA VFALSI+LV FAGFHN DWY+D++RYLILFSTIIPVSLRVN
Sbjct: 413  KTGLLELEINSISKILCASVFALSIILVVFAGFHNSDWYLDVMRYLILFSTIIPVSLRVN 472

Query: 463  LDLAKSVYAHQIEHDKTIPETIVRTSTIPEDLGRIEYLLSDKTGTLTQNDMQLKKIHLGT 522
            LDLAKSVYAHQIEHD TIPETIVRTSTIPEDLGRIEYLLSDKTGTLTQNDMQLKKIHLGT
Sbjct: 473  LDLAKSVYAHQIEHDDTIPETIVRTSTIPEDLGRIEYLLSDKTGTLTQNDMQLKKIHLGT 532

Query: 523  VSYTSETLDIVSDYVQSLVSSKNDSLNNSKVALSTTRKDMSFRVRDMILTLAICHNVTPT 582
            VSYTSETLDIVSDYV +LV+S N +  + K   ST+RKD+S RVRDM++TLAICHNVTPT
Sbjct: 533  VSYTSETLDIVSDYVDALVNSSNSANPSGKSVPSTSRKDLSARVRDMVVTLAICHNVTPT 592

Query: 583  FEDDELTYQAASPDEIAIVKFTESVGLSLFKRDRHSISLLHEHSGKTLNYEILQVFPFNS 642
            FEDDELTYQAASPDEIAIVKFTESVGLSLFKRDRHSISLLH HSG  L YEILQVFPFNS
Sbjct: 593  FEDDELTYQAASPDEIAIVKFTESVGLSLFKRDRHSISLLHGHSGSILTYEILQVFPFNS 652

Query: 643  DSKRMGIIVRDEQLDEYWFMQKGADTVMSKIVESNDWLEEETGNMAREGLRTLVIGRKKL 702
            DSKRMGIIV DEQ DEYWFMQKGADTVM++IVE+NDWLEEETGNMAREGLRTLV+GRKKL
Sbjct: 653  DSKRMGIIVHDEQKDEYWFMQKGADTVMARIVENNDWLEEETGNMAREGLRTLVVGRKKL 712

Query: 703  NKKIYEQFQKEYNDASLSMLNRDQQMSQVITKYLEHDLELLGLTGVEDKLQKDVKSSIEL 762
            ++ IY+QF+K+Y+DASLSM+NRDQQM+ VITKYLE+DLELLGLTGVEDKLQ DVKSSIEL
Sbjct: 713  SRNIYDQFKKDYDDASLSMVNRDQQMNAVITKYLEYDLELLGLTGVEDKLQNDVKSSIEL 772

Query: 763  LRNAGIKIWMLTGDKVETARCVSISAKLISRGQYVHTITKVTRPEGAFNQLEYLKINRNA 822
            LRNAGIKIWMLTGDKVETARCVSISAKLISRGQYVH ITK+T+PEGA NQLEYLK+N+ A
Sbjct: 773  LRNAGIKIWMLTGDKVETARCVSISAKLISRGQYVHIITKLTKPEGALNQLEYLKVNKGA 832

Query: 823  CLLIDGESLGMFLKHYEQEFFDVVVHLPTVIACRCTPQQKADVALVIRKMTGKRVCCIGD 882
            CLLIDGESLGMFL++Y++EFFDVV+ LPTV+ACRCTPQQKADVALVIR+ TGKRVCCIGD
Sbjct: 833  CLLIDGESLGMFLRYYKREFFDVVICLPTVVACRCTPQQKADVALVIREFTGKRVCCIGD 892

Query: 883  GGNDVSMIQCADVGVGIVGKEGKQASLAADFSITQFCHLTELLLWHGRNSYKRSAKLAQF 942
            GGNDVSMIQCADVGVGIVGKEGKQASLAADFSIT+FCHLTELLLWHGRNSYKRSAKLAQF
Sbjct: 893  GGNDVSMIQCADVGVGIVGKEGKQASLAADFSITEFCHLTELLLWHGRNSYKRSAKLAQF 952

Query: 943  VMHRGLIIAICQAVYSICSLFEPIALYQGWLMVGYATCYTMAPVFSLTLDHDIEESLTKI 1002
            +MHRGL+IAICQAVYSICS FEPI LYQG+LMVGYATCYTMAPVFS+TLDHDIEESLTKI
Sbjct: 953  IMHRGLVIAICQAVYSICSKFEPIGLYQGFLMVGYATCYTMAPVFSMTLDHDIEESLTKI 1012

Query: 1003 YPELYKELTEGKSLSYKTFFVWVLLSLFQGSVIQLFSQAFTSLLDTDFTRMVAISFTALV 1062
            YPELYK+LTEGKSLSYKTFFVW  LSLFQG VIQ  SQ F+SLL+ DFT+MVAI FTAL+
Sbjct: 1013 YPELYKDLTEGKSLSYKTFFVWCALSLFQGCVIQGCSQVFSSLLEVDFTKMVAIGFTALI 1072

Query: 1063 VNELIMVALEIYTWNKTMLVTEIATLLFYIVSVPFLGDYFDLGYMTTVNYYAGLLVILLI 1122
            +NELIMVALEIYTWNK M+ TEI T L Y++SVPFLG+YFDL YM T+ +Y  LL ILL+
Sbjct: 1073 LNELIMVALEIYTWNKIMVFTEILTFLCYVISVPFLGEYFDLKYMMTLRFYGELLFILLV 1132

Query: 1123 SIFPVWTAK 1131
            S+FPVW AK
Sbjct: 1133 SVFPVWAAK 1141

>CAGL0L00715g 86810..90244 highly similar to sp|P40527 Saccharomyces
            cerevisiae YIL048w NEO1 ATPase whose overproduction
            confers neomycin resistance, hypothetical start
          Length = 1144

 Score = 1736 bits (4495), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 831/1081 (76%), Positives = 933/1081 (86%), Gaps = 25/1081 (2%)

Query: 63   ESFEMRTV-DDLDNFXXXXXXXXXXXXXTDTHPLMYDNRLSQDDNF-----KFTNIAXXX 116
            E+FEMR+V +D ++F              D HPLM D   S          K+ N++   
Sbjct: 57   ENFEMRSVLEDEEHFD------------NDGHPLMRDRTRSNASTLNSRYNKYNNVSGSR 104

Query: 117  XXXXXXI------FSKALSYLKVSNTKNWSKFGSPIELSDQHIEREIHPDTTPVYDRNRY 170
                           K    +K + +  W  + + + L D+H ERE+HP TT VYDR+R+
Sbjct: 105  SVTGYTPSTIGVGLKKWFVNVKTAISSGWKDYSTSVALGDEHTEREVHPGTTQVYDRHRF 164

Query: 171  VSNELSNAKYNAVTFVPTLLYEQFKFFYNLYFLVVALSQAVPALRIGYLSSYIVPLAFVL 230
             SNE+SNAKYNAVTF+PTLLYEQFKFF+NLYFL+VALSQA+PALRIGYLSSY+VPLAFVL
Sbjct: 165  PSNEVSNAKYNAVTFLPTLLYEQFKFFFNLYFLLVALSQAIPALRIGYLSSYVVPLAFVL 224

Query: 231  TVTMAKEAXXXXXXXXXXXESNNELYHVITRNRSIPSKDLKVGDLIKVHKGDRIPADLVL 290
            TVTMAKEA           ESN ELY V+ R R + SKDLKVGDLIK+ KG R+PADL+L
Sbjct: 225  TVTMAKEASDDIQRRRRDRESNMELYEVLGRPRPVASKDLKVGDLIKISKGARVPADLIL 284

Query: 291  LQSSEPSGESFIKTDQLDGETDWKLRVACPLTQNLSENDLINRISITASAPEKSIHKFLG 350
            LQSSEPSGE+FIKTDQLDGETDWKLR+AC LTQNL+E+DL+ +I+ITASAPEKSIH FLG
Sbjct: 285  LQSSEPSGEAFIKTDQLDGETDWKLRIACTLTQNLNEDDLLEKITITASAPEKSIHSFLG 344

Query: 351  KVTYKDSTSNPLSVDNTLWANTVLASSGFCIACVVYTGRDTRQAMNTTTAKVKTGLLELE 410
            +VTYKD+ ++ L++DNTLWANTVLASSGFCI CV+YTGRDTRQAMNTT+AKVKTGLLELE
Sbjct: 345  RVTYKDTNTSGLTIDNTLWANTVLASSGFCIGCVIYTGRDTRQAMNTTSAKVKTGLLELE 404

Query: 411  INSISKILCACVFALSILLVAFAGFHNDDWYIDILRYLILFSTIIPVSLRVNLDLAKSVY 470
            IN ISKILCACVF LSILLV FAG HNDDWY+DI+RYLILFSTIIPVSLRVNLDLAKSVY
Sbjct: 405  INDISKILCACVFILSILLVVFAGLHNDDWYVDIMRYLILFSTIIPVSLRVNLDLAKSVY 464

Query: 471  AHQIEHDKTIPETIVRTSTIPEDLGRIEYLLSDKTGTLTQNDMQLKKIHLGTVSYTSETL 530
            AHQIEHDKTIPETIVRTSTIPEDLGRIEYLLSDKTGTLTQNDMQLKK+HLG VSYT+ET 
Sbjct: 465  AHQIEHDKTIPETIVRTSTIPEDLGRIEYLLSDKTGTLTQNDMQLKKVHLGNVSYTTETA 524

Query: 531  DIVSDYVQSLVSSKNDSLNNSKVALSTTRKDMSFRVRDMILTLAICHNVTPTFEDDELTY 590
            DIVSDY+Q ++ SKNDS+ N     STTRKD +  V D+I TLAICHNVTPTFEDDELTY
Sbjct: 525  DIVSDYIQGMIESKNDSVTNLG-PRSTTRKDAATHVIDLITTLAICHNVTPTFEDDELTY 583

Query: 591  QAASPDEIAIVKFTESVGLSLFKRDRHSISLLHEHSGKTLNYEILQVFPFNSDSKRMGII 650
            QAASPDEIAIVKFTESVGLSLFKRDRHS+SLLHEHSG  LNY++L +FPFNSD+KRMGII
Sbjct: 584  QAASPDEIAIVKFTESVGLSLFKRDRHSMSLLHEHSGTILNYDVLTMFPFNSDTKRMGII 643

Query: 651  VRDEQLDEYWFMQKGADTVMSKIVESNDWLEEETGNMAREGLRTLVIGRKKLNKKIYEQF 710
            V D+Q D+YWF+QKGADTVM++IV +NDWLEEETGNMAREGLRTLVIGRKKL KKIYEQF
Sbjct: 644  VYDKQKDQYWFLQKGADTVMNRIVANNDWLEEETGNMAREGLRTLVIGRKKLTKKIYEQF 703

Query: 711  QKEYNDASLSMLNRDQQMSQVITKYLEHDLELLGLTGVEDKLQKDVKSSIELLRNAGIKI 770
            +KEY + S SM NR+Q+M+  I+KYLEHDLELLGLTGVEDKLQKDVKSSIELLRNAGIKI
Sbjct: 704  KKEYEEVSASMYNREQEMANTISKYLEHDLELLGLTGVEDKLQKDVKSSIELLRNAGIKI 763

Query: 771  WMLTGDKVETARCVSISAKLISRGQYVHTITKVTRPEGAFNQLEYLKINRNACLLIDGES 830
            WMLTGDKVETARCVSISAKLISRGQYVH +TK+++PEGAFNQLEYLK+N+NACLLIDGES
Sbjct: 764  WMLTGDKVETARCVSISAKLISRGQYVHVVTKLSKPEGAFNQLEYLKVNKNACLLIDGES 823

Query: 831  LGMFLKHYEQEFFDVVVHLPTVIACRCTPQQKADVALVIRKMTGKRVCCIGDGGNDVSMI 890
            LGMFLK+Y QEFFDVVVHLPTVIACRCTPQQKADVAL+IR++TGKRVCCIGDGGNDVSMI
Sbjct: 824  LGMFLKYYRQEFFDVVVHLPTVIACRCTPQQKADVALIIRELTGKRVCCIGDGGNDVSMI 883

Query: 891  QCADVGVGIVGKEGKQASLAADFSITQFCHLTELLLWHGRNSYKRSAKLAQFVMHRGLII 950
            QCADVGVGIVGKEGKQASLAADFSITQFCHLTELLLWHGRNSYKRSAKLAQFVMHRGLII
Sbjct: 884  QCADVGVGIVGKEGKQASLAADFSITQFCHLTELLLWHGRNSYKRSAKLAQFVMHRGLII 943

Query: 951  AICQAVYSICSLFEPIALYQGWLMVGYATCYTMAPVFSLTLDHDIEESLTKIYPELYKEL 1010
            AICQAV+S+CS FEPIALYQGWLMVGYATCYTMAPVFSLTLDHDI+ESLTK+YPELYK+L
Sbjct: 944  AICQAVFSVCSQFEPIALYQGWLMVGYATCYTMAPVFSLTLDHDIDESLTKMYPELYKDL 1003

Query: 1011 TEGKSLSYKTFFVWVLLSLFQGSVIQLFSQAFTSLLDTDFTRMVAISFTALVVNELIMVA 1070
            TEGKSLSYKTFFVWV LS +QG VIQ FSQ FTSL + DFT+MVAI FTAL+ NELIMVA
Sbjct: 1004 TEGKSLSYKTFFVWVALSFYQGLVIQGFSQTFTSLAEIDFTKMVAIGFTALIFNELIMVA 1063

Query: 1071 LEIYTWNKTMLVTEIATLLFYIVSVPFLGDYFDLGYMTTVNYYAGLLVILLISIFPVWTA 1130
            LEIYTWNKTM++TEI TL  Y+ SVPFLG+YFDL Y++T+ +   L++IL++SIFPVW  
Sbjct: 1064 LEIYTWNKTMIITEIVTLAIYVFSVPFLGEYFDLKYISTLKFITELILILVVSIFPVWLT 1123

Query: 1131 K 1131
            K
Sbjct: 1124 K 1124

>Sklu_2193.1 YIL048W, Contig c2193 334-3765 reverse complement
          Length = 1143

 Score = 1696 bits (4393), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 822/1101 (74%), Positives = 934/1101 (84%), Gaps = 35/1101 (3%)

Query: 45   QINNNPEPLSKHNTVGDRESFEMRTVD----DLDNFXXXXXXXXXXXXXT-------DTH 93
            QINN+       NT G  E+FEMRT+D    D  +F                     DT 
Sbjct: 44   QINNS------LNTSG--ENFEMRTIDQDGDDTQSFKHSRVSSLNDSAKNTHLSSGRDTQ 95

Query: 94   PLMYDNRLSQDDNFKFTNIAXXXXXXXXXIFSKALSYLKVSNTKNWSKF---GSPIELSD 150
            PL+   +    +N + +N +          +SK +  +K   T + SK+    S IEL+D
Sbjct: 96   PLIGTTQEPWSNNQQGSNQSP---------WSKFIRLIKTPTTTDLSKYRSTNSSIELTD 146

Query: 151  QHIEREIHPDTTPVYDRNRYVSNELSNAKYNAVTFVPTLLYEQFKFFYNLYFLVVALSQA 210
            QH+EREIHPDTTP+YD+N+Y SN +SNAKYN +TF+P +LYEQFKFF+NLYFL+VALSQA
Sbjct: 147  QHVEREIHPDTTPIYDKNKYPSNAISNAKYNPITFIPIILYEQFKFFFNLYFLLVALSQA 206

Query: 211  VPALRIGYLSSYIVPLAFVLTVTMAKEAXXXXXXXXXXXESNNELYHVITRNRSIPSKDL 270
            +PALRIGYLSSYIVPLAFVL VTM+KEA           ESNNELY V+ + + +PSKDL
Sbjct: 207  IPALRIGYLSSYIVPLAFVLMVTMSKEAMDDIQRRQRDKESNNELYEVLNKAQLVPSKDL 266

Query: 271  KVGDLIKVHKGDRIPADLVLLQSSEPSGESFIKTDQLDGETDWKLRVACPLTQNLSENDL 330
            KVGDLIK+HKG RIPADLVLLQSSEPSGESFIKTDQLDGETDWKLRVAC LTQNLS +DL
Sbjct: 267  KVGDLIKIHKGTRIPADLVLLQSSEPSGESFIKTDQLDGETDWKLRVACSLTQNLSTDDL 326

Query: 331  INRISITASAPEKSIHKFLGKVTYKDSTSNPLSVDNTLWANTVLASSGFCIACVVYTGRD 390
            +N+ISITAS+PEKSIH+FLGK+TYKDS+SN LSVDNT+WANTVLAS G CI CVVYTG D
Sbjct: 327  LNKISITASSPEKSIHRFLGKLTYKDSSSNALSVDNTMWANTVLASVGSCIGCVVYTGTD 386

Query: 391  TRQAMNTTTAKVKTGLLELEINSISKILCACVFALSILLVAFAGFHNDDWYIDILRYLIL 450
            TRQAMNTT + VKTGLLELEINS+SKILCACVF LSI+LVAFAGF N DWY+DI+RYLIL
Sbjct: 387  TRQAMNTTMSSVKTGLLELEINSLSKILCACVFVLSIVLVAFAGFGNKDWYVDIMRYLIL 446

Query: 451  FSTIIPVSLRVNLDLAKSVYAHQIEHDKTIPETIVRTSTIPEDLGRIEYLLSDKTGTLTQ 510
            FSTIIPVSLRVNLDL KSVYA QIEHD TIP+TIVRTSTIPEDLGRIEYLLSDKTGTLTQ
Sbjct: 447  FSTIIPVSLRVNLDLGKSVYARQIEHDATIPDTIVRTSTIPEDLGRIEYLLSDKTGTLTQ 506

Query: 511  NDMQLKKIHLGTVSYTSETLDIVSDYVQSLVSSKNDSLNNSKVALSTTRKDMSFRVRDMI 570
            NDMQLKK+HLGTVSYT +T+DIV+DYVQ LVSS       + +  ST +KD+  RVRD++
Sbjct: 507  NDMQLKKLHLGTVSYTMDTMDIVTDYVQELVSSST----TTPMPQSTAKKDLPNRVRDLV 562

Query: 571  LTLAICHNVTPTFEDDELTYQAASPDEIAIVKFTESVGLSLFKRDRHSISLLHEHSGKTL 630
            +TLAICHNVTPTFED ELTYQAASPDEIAIVKFTESVGLSLFKRDRHS+SL H+HS    
Sbjct: 563  VTLAICHNVTPTFEDGELTYQAASPDEIAIVKFTESVGLSLFKRDRHSVSLFHQHSATNF 622

Query: 631  NYEILQVFPFNSDSKRMGIIVRDEQLDEYWFMQKGADTVMSKIVESNDWLEEETGNMARE 690
             Y+ILQVFPFNSD+KRMGIIV D+   E+WFMQKGADTVM++IV+SNDWL+EE GNMARE
Sbjct: 623  EYDILQVFPFNSDTKRMGIIVYDKVKGEHWFMQKGADTVMARIVQSNDWLDEEVGNMARE 682

Query: 691  GLRTLVIGRKKLNKKIYEQFQKEYNDASLSMLNRDQQMSQVITKYLEHDLELLGLTGVED 750
            GLRTLVIGRKKL+ K YEQF+KEY+DASLSMLNRD+ MS VI K+LEH+LELLGLTGVED
Sbjct: 683  GLRTLVIGRKKLSPKSYEQFRKEYHDASLSMLNRDETMSSVIKKHLEHNLELLGLTGVED 742

Query: 751  KLQKDVKSSIELLRNAGIKIWMLTGDKVETARCVSISAKLISRGQYVHTITKVTRPEGAF 810
            KLQ DVKSSIELLRNAG+KIWMLTGDKVETARCVSISAKLISRGQYVHT+TK++RPEGA 
Sbjct: 743  KLQNDVKSSIELLRNAGVKIWMLTGDKVETARCVSISAKLISRGQYVHTVTKLSRPEGAL 802

Query: 811  NQLEYLKINRNACLLIDGESLGMFLKHYEQEFFDVVVHLPTVIACRCTPQQKADVALVIR 870
            N LEYLKIN+++CLLIDGESLGMFL +Y+QEFFD+VV LP VIACRCTPQQKADVAL+IR
Sbjct: 803  NALEYLKINKSSCLLIDGESLGMFLTYYKQEFFDIVVDLPAVIACRCTPQQKADVALLIR 862

Query: 871  KMTGKRVCCIGDGGNDVSMIQCADVGVGIVGKEGKQASLAADFSITQFCHLTELLLWHGR 930
            ++TGKRVCCIGDGGNDVSMIQCADVGVGIVGKEGKQASLAADFS+TQFCHLT+LLLWHGR
Sbjct: 863  EITGKRVCCIGDGGNDVSMIQCADVGVGIVGKEGKQASLAADFSVTQFCHLTKLLLWHGR 922

Query: 931  NSYKRSAKLAQFVMHRGLIIAICQAVYSICSLFEPIALYQGWLMVGYATCYTMAPVFSLT 990
            NSYKRSAKLAQFV+HRGLII++CQAVYS+CS FEPIALYQGWLMVGYATCYTMAPVFSLT
Sbjct: 923  NSYKRSAKLAQFVIHRGLIISVCQAVYSVCSKFEPIALYQGWLMVGYATCYTMAPVFSLT 982

Query: 991  LDHDIEESLTKIYPELYKELTEGKSLSYKTFFVWVLLSLFQGSVIQLFSQAFTSLLDTDF 1050
            LDHDI+ESLTKIYPELYKELT G SLSYKTFFVWV+LSLFQG  IQ  SQ FTSL + DF
Sbjct: 983  LDHDIDESLTKIYPELYKELTAGTSLSYKTFFVWVILSLFQGCAIQGISQYFTSLDEVDF 1042

Query: 1051 TRMVAISFTALVVNELIMVALEIYTWNKTMLVTEIATLLFYIVSVPFLGDYFDLGYMTTV 1110
             ++VA+SFTALV+NELIMVALEIYTWNKTM++TEI T L Y+VSVPFL +YFDL +++ +
Sbjct: 1043 KKLVALSFTALVINELIMVALEIYTWNKTMVITEIVTFLIYVVSVPFLSEYFDLTFVSQL 1102

Query: 1111 NYYAGLLVILLISIFPVWTAK 1131
             +YA L+ IL +S+FPVW AK
Sbjct: 1103 PFYAKLIFILAVSVFPVWAAK 1123

>Kwal_23.5789
          Length = 1133

 Score = 1607 bits (4162), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 758/982 (77%), Positives = 870/982 (88%), Gaps = 5/982 (0%)

Query: 150  DQHIEREIHPDTTPVYDRNRYVSNELSNAKYNAVTFVPTLLYEQFKFFYNLYFLVVALSQ 209
            DQ ++REIHP TTPVYDR +Y  N +SNAKYN VTF+P +LYEQFKFF+NLYFL+VALSQ
Sbjct: 136  DQQLDREIHPSTTPVYDRYKYAPNAISNAKYNPVTFIPKILYEQFKFFFNLYFLLVALSQ 195

Query: 210  AVPALRIGYLSSYIVPLAFVLTVTMAKEAXXXXXXXXXXXESNNELYHVITRNRSIPSKD 269
            A+PALRIGYLSSYIVPLAFVLTVTM+KEA           ESNNELY V+++++ +PSKD
Sbjct: 196  AIPALRIGYLSSYIVPLAFVLTVTMSKEALDDIQRRRRDRESNNELYEVLSKSQLVPSKD 255

Query: 270  LKVGDLIKVHKGDRIPADLVLLQSSEPSGESFIKTDQLDGETDWKLRVACPLTQNLSEND 329
            LKVGDLIK+ KG R PADLVLLQSSEPSGE FIKTDQLDGETDWKLR+ACPLTQ+LS++D
Sbjct: 256  LKVGDLIKIGKGARAPADLVLLQSSEPSGEIFIKTDQLDGETDWKLRIACPLTQHLSQDD 315

Query: 330  LINRISITASAPEKSIHKFLGKVTYKDSTSNPLSVDNTLWANTVLASSGFCIACVVYTGR 389
            L+ RISITAS PEKSI+ FLGK+T+ +  S PLSVDNT+WANTV AS+G  IACVVYTG 
Sbjct: 316  LLYRISITASVPEKSINNFLGKLTFGEIQSQPLSVDNTMWANTVFASAGTAIACVVYTGA 375

Query: 390  DTRQAMNTTTAKVKTGLLELEINSISKILCACVFALSILLVAFAGFHNDDWYIDILRYLI 449
            DTRQAMNT+ + VKTGLLELEINS+SKILCACVF LS+ LVAFAGF+N+DWY+DI+RYLI
Sbjct: 376  DTRQAMNTSMSSVKTGLLELEINSLSKILCACVFILSVALVAFAGFNNNDWYVDIMRYLI 435

Query: 450  LFSTIIPVSLRVNLDLAKSVYAHQIEHDKTIPETIVRTSTIPEDLGRIEYLLSDKTGTLT 509
            LFSTIIPVSLRVNLDL KSVYAHQIEHD TIPETIVRTSTIPEDLGRIEYLLSDKTGTLT
Sbjct: 436  LFSTIIPVSLRVNLDLGKSVYAHQIEHDSTIPETIVRTSTIPEDLGRIEYLLSDKTGTLT 495

Query: 510  QNDMQLKKIHLGTVSYTSETLDIVSDYVQSLVSSKNDSLNNSKVALSTTRKDMSFRVRDM 569
            QNDM+LKK+HLGTVSYT +T+DIV+DYV+++    +D+LN+S V  S ++KD+  RVRD+
Sbjct: 496  QNDMELKKLHLGTVSYTMDTMDIVTDYVRAM----SDNLNSSAVP-SASKKDLPGRVRDL 550

Query: 570  ILTLAICHNVTPTFEDDELTYQAASPDEIAIVKFTESVGLSLFKRDRHSISLLHEHSGKT 629
            +LTLA+CH VTPTFED ELTYQAASPDEIAIVKFTESVGL+LF+RDRHSI+LLH+ SG  
Sbjct: 551  VLTLALCHQVTPTFEDGELTYQAASPDEIAIVKFTESVGLTLFRRDRHSITLLHDQSGTN 610

Query: 630  LNYEILQVFPFNSDSKRMGIIVRDEQLDEYWFMQKGADTVMSKIVESNDWLEEETGNMAR 689
              Y+IL VFPFNSD+KRMGI++ D+Q DEYWF+QKGAD VMSKIV+ NDWLEEETGN+AR
Sbjct: 611  FEYDILHVFPFNSDNKRMGIVIFDKQKDEYWFLQKGADVVMSKIVQKNDWLEEETGNLAR 670

Query: 690  EGLRTLVIGRKKLNKKIYEQFQKEYNDASLSMLNRDQQMSQVITKYLEHDLELLGLTGVE 749
            EGLRTLVIGRK+L+KK+ + F K+Y DASL MLNR+  MS VI+K+LEHDLE+LGLTGVE
Sbjct: 671  EGLRTLVIGRKRLSKKLLQTFTKDYEDASLMMLNREVTMSNVISKHLEHDLEILGLTGVE 730

Query: 750  DKLQKDVKSSIELLRNAGIKIWMLTGDKVETARCVSISAKLISRGQYVHTITKVTRPEGA 809
            DKLQ+DVKSSIELLRNAGIKIWMLTGDKVETARCVSISAKL+SRGQYVHT+TKV +PEGA
Sbjct: 731  DKLQEDVKSSIELLRNAGIKIWMLTGDKVETARCVSISAKLVSRGQYVHTVTKVNKPEGA 790

Query: 810  FNQLEYLKINRNACLLIDGESLGMFLKHYEQEFFDVVVHLPTVIACRCTPQQKADVALVI 869
               LE LKIN N+CLLIDGESLG++L++Y Q+FF++VV+LP VIACRCTPQQKADVA  I
Sbjct: 791  LTHLELLKINTNSCLLIDGESLGLYLEYYRQQFFEIVVNLPAVIACRCTPQQKADVATFI 850

Query: 870  RKMTGKRVCCIGDGGNDVSMIQCADVGVGIVGKEGKQASLAADFSITQFCHLTELLLWHG 929
            R++TGKRVCCIGDGGNDVSMIQ ADVGVGIVGKEGKQASLAADFSITQFCHL++LLLWHG
Sbjct: 851  REVTGKRVCCIGDGGNDVSMIQSADVGVGIVGKEGKQASLAADFSITQFCHLSKLLLWHG 910

Query: 930  RNSYKRSAKLAQFVMHRGLIIAICQAVYSICSLFEPIALYQGWLMVGYATCYTMAPVFSL 989
            RNSYKRSAKLAQFV+HRGL+I++CQAVYSI S FEPIALYQGWLMVGYATCYTMAPVFSL
Sbjct: 911  RNSYKRSAKLAQFVIHRGLLISVCQAVYSISSKFEPIALYQGWLMVGYATCYTMAPVFSL 970

Query: 990  TLDHDIEESLTKIYPELYKELTEGKSLSYKTFFVWVLLSLFQGSVIQLFSQAFTSLLDTD 1049
            TLDHDI+ESLTK YPELYKELT GKSLSYKTFFVWV+LSLFQG VIQ  SQ FTSL + D
Sbjct: 971  TLDHDIDESLTKTYPELYKELTAGKSLSYKTFFVWVVLSLFQGCVIQGLSQGFTSLDELD 1030

Query: 1050 FTRMVAISFTALVVNELIMVALEIYTWNKTMLVTEIATLLFYIVSVPFLGDYFDLGYMTT 1109
            F R+VA+SFT L++NELIMVA+EIYTWNKTM+V+E+ T L ++ SVP L +YFDL YM+ 
Sbjct: 1031 FKRLVALSFTVLILNELIMVAIEIYTWNKTMVVSEVVTFLIFVGSVPLLEEYFDLTYMSR 1090

Query: 1110 VNYYAGLLVILLISIFPVWTAK 1131
              YY  L +IL +SI PVW AK
Sbjct: 1091 PEYYGKLAIILSLSIIPVWAAK 1112

>KLLA0C08393g 734655..738101 highly similar to sp|P40527 Saccharomyces
            cerevisiae YIL048w NEO1 ATPase whose overproduction
            confers neomycin resistance, start by similarity
          Length = 1148

 Score = 1597 bits (4135), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 766/1022 (74%), Positives = 892/1022 (87%), Gaps = 19/1022 (1%)

Query: 123  IFSKALSYLKVSNTKNWSKF-------------GSPIELSDQHIEREIHPDTTPVYDRNR 169
            ++SKA S+ + S TK  SK              G+ IEL+D ++EREIHP TTP+YDR +
Sbjct: 113  VWSKAKSWFEHSFTKAKSKPSSLSVYSSTNSVDGNKIELNDHNVEREIHPATTPIYDRKK 172

Query: 170  YVSNELSNAKYNAVTFVPTLLYEQFKFFYNLYFLVVALSQAVPALRIGYLSSYIVPLAFV 229
            Y SN +SNAKYN  TF+P +LYEQFKFF+NLYFL+VALSQA+P LRIGYLSSYIVPLAFV
Sbjct: 173  YPSNVISNAKYNPFTFIPLILYEQFKFFFNLYFLIVALSQAIPQLRIGYLSSYIVPLAFV 232

Query: 230  LTVTMAKEAXXXXXXXXXXXESNNELYHVITRNRSIPSKDLKVGDLIKVHKGDRIPADLV 289
            LTVTM+KEA           E+NNELY V+ +   IPSKDLKVGD+IK+ KG R+PAD+V
Sbjct: 233  LTVTMSKEAMDDINRRKRDREANNELYEVVNKPCPIPSKDLKVGDIIKLKKGARVPADVV 292

Query: 290  LLQSSEPSGESFIKTDQLDGETDWKLRVACPLTQNLSENDLINRISITASAPEKSIHKFL 349
            +LQ++EP+GESFIKTDQLDGETDWKLR+AC LTQ+L+ENDL+N I+ITASAPE SIH FL
Sbjct: 293  VLQTNEPNGESFIKTDQLDGETDWKLRLACSLTQSLTENDLLNNITITASAPEHSIHNFL 352

Query: 350  GKVTYKDSTSNPLSVDNTLWANTVLASSGFCIACVVYTGRDTRQAMNTTTAKVKTGLLEL 409
            GK+TYKDSTS+PLSVDNT+W NTVLASS  CI C+VYTGR+TRQA+NTT +K KTGLLEL
Sbjct: 353  GKITYKDSTSSPLSVDNTMWENTVLASSAACICCIVYTGRETRQALNTTKSKAKTGLLEL 412

Query: 410  EINSISKILCACVFALSILLVAFAGFHNDDWYIDILRYLILFSTIIPVSLRVNLDLAKSV 469
            EIN +SKILCACVF LSI+LVAFAGF+N+DWY+DI+RYLILFSTIIPVSLRVNLDL KSV
Sbjct: 413  EINGLSKILCACVFLLSIMLVAFAGFNNNDWYVDIMRYLILFSTIIPVSLRVNLDLGKSV 472

Query: 470  YAHQIEHDKTIPETIVRTSTIPEDLGRIEYLLSDKTGTLTQNDMQLKKIHLGTVSYTSET 529
            YA++IEHDK I +TIVRTSTIPEDLGRIEYLLSDKTGTLTQNDMQLKKIHLGTVSYT+ET
Sbjct: 473  YAYKIEHDKQIEDTIVRTSTIPEDLGRIEYLLSDKTGTLTQNDMQLKKIHLGTVSYTNET 532

Query: 530  LDIVSDYVQSLVSSKNDSLNNSKVALSTTRKDMSFRVRDMILTLAICHNVTPTFEDDELT 589
            +DIV+D++QS+ S  ++S        +TTRK++S RV D++ TLAICHNVTPTFED ELT
Sbjct: 533  MDIVTDFIQSMNSRTSNS------TPTTTRKNISDRVIDLVTTLAICHNVTPTFEDGELT 586

Query: 590  YQAASPDEIAIVKFTESVGLSLFKRDRHSISLLHEHSGKTLNYEILQVFPFNSDSKRMGI 649
            YQAASPDEIAIVKFTESVGLSLF+RDRHSISL H+HSG  L Y+I  +FPFNSDSKRMG+
Sbjct: 587  YQAASPDEIAIVKFTESVGLSLFRRDRHSISLFHDHSGMKLEYDIKILFPFNSDSKRMGV 646

Query: 650  IVRDEQLDEYWFMQKGADTVMSKIVESNDWLEEETGNMAREGLRTLVIGRKKLNKKIYEQ 709
            I+ D+   EYWF+QKGADTVMS IV  NDWLEEET NMA EGLRTLVIGRKKL+  ++EQ
Sbjct: 647  IIFDKLKQEYWFLQKGADTVMSSIVVRNDWLEEETSNMATEGLRTLVIGRKKLSTNLFEQ 706

Query: 710  FQKEYNDASLSMLNRDQQMSQVITKYLEHDLELLGLTGVEDKLQKDVKSSIELLRNAGIK 769
            F+KEY++ASL+M++R+  M  V+ K+LE+DLELLGLTGVEDKLQKDVKSSIELLRNAGIK
Sbjct: 707  FEKEYSEASLTMMDREVHMQNVVRKFLENDLELLGLTGVEDKLQKDVKSSIELLRNAGIK 766

Query: 770  IWMLTGDKVETARCVSISAKLISRGQYVHTITKVTRPEGAFNQLEYLKINRNACLLIDGE 829
            IWMLTGDKVETARCVSISAKLISRGQYVHT+TKV +PEGA + LEYL++N+N+CLLIDGE
Sbjct: 767  IWMLTGDKVETARCVSISAKLISRGQYVHTVTKVNKPEGALHHLEYLQVNQNSCLLIDGE 826

Query: 830  SLGMFLKHYEQEFFDVVVHLPTVIACRCTPQQKADVALVIRKMTGKRVCCIGDGGNDVSM 889
            SLG++L+++  EFFD+VV+LPTV+ACRCTPQQKADVA+ IR+ TGKRVCCIGDGGNDVSM
Sbjct: 827  SLGLYLQYFPDEFFDIVVNLPTVVACRCTPQQKADVAVFIRQATGKRVCCIGDGGNDVSM 886

Query: 890  IQCADVGVGIVGKEGKQASLAADFSITQFCHLTELLLWHGRNSYKRSAKLAQFVMHRGLI 949
            IQCADVGVGIVGKEGKQASLAADFSITQFCHLT+LLLWHGRNSYK SAKL+QFV+HRGLI
Sbjct: 887  IQCADVGVGIVGKEGKQASLAADFSITQFCHLTKLLLWHGRNSYKSSAKLSQFVIHRGLI 946

Query: 950  IAICQAVYSICSLFEPIALYQGWLMVGYATCYTMAPVFSLTLDHDIEESLTKIYPELYKE 1009
            I++CQAVYSICS+FEP+ALYQGWLMVGYATCYTMAPVFSLTLDHDI+ESLT +YPELYKE
Sbjct: 947  ISVCQAVYSICSMFEPLALYQGWLMVGYATCYTMAPVFSLTLDHDIDESLTTLYPELYKE 1006

Query: 1010 LTEGKSLSYKTFFVWVLLSLFQGSVIQLFSQAFTSLLDTDFTRMVAISFTALVVNELIMV 1069
            LT GKSLS+KTFFVWV LS+FQG VIQ+ SQ FTSL D+DFT+MVAISFTALV+NELIMV
Sbjct: 1007 LTLGKSLSFKTFFVWVALSVFQGCVIQMASQFFTSLNDSDFTKMVAISFTALVLNELIMV 1066

Query: 1070 ALEIYTWNKTMLVTEIATLLFYIVSVPFLGDYFDLGYMTTVNYYAGLLVILLISIFPVWT 1129
             LEI TWNK M +TE+ TLL Y+ S+PFLG+YFDL Y++T  +   +LVIL+IS+ PVW 
Sbjct: 1067 GLEINTWNKIMAITEVVTLLIYLGSIPFLGEYFDLSYVSTTKFPLRVLVILVISVVPVWA 1126

Query: 1130 AK 1131
            AK
Sbjct: 1127 AK 1128

>ADL079C [1662] [Homologous to ScYIL048W (NEO1) - SH] (544854..548354)
            [3501 bp, 1166 aa]
          Length = 1166

 Score = 1584 bits (4101), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 739/986 (74%), Positives = 867/986 (87%), Gaps = 3/986 (0%)

Query: 146  IELSDQHIEREIHPDTTPVYDRNRYVSNELSNAKYNAVTFVPTLLYEQFKFFYNLYFLVV 205
            IEL+DQH++REIH DTTP+YD+ +Y +N +SNAKYNA+TF+P +LYEQFKFF+NLYFL+V
Sbjct: 164  IELTDQHVDREIHLDTTPIYDKRKYPTNAISNAKYNAITFLPIVLYEQFKFFFNLYFLLV 223

Query: 206  ALSQAVPALRIGYLSSYIVPLAFVLTVTMAKEAXXXXXXXXXXXESNNELYHVITRNRSI 265
            +LSQ++PALRIGYLSSYIVPLAFVL VTM+KEA           E+NNELY V+  ++ +
Sbjct: 224  SLSQSIPALRIGYLSSYIVPLAFVLVVTMSKEAMDDIQRRRRDRETNNELYEVLNNSQLV 283

Query: 266  PSKDLKVGDLIKVHKGDRIPADLVLLQSSEPSGESFIKTDQLDGETDWKLRVACPLTQNL 325
            PSK+L+VGDL+K+HK  RIPAD++LLQSSEPSGE+F+KTDQLDGETDWKLRVA  LTQNL
Sbjct: 284  PSKNLRVGDLVKLHKDSRIPADMILLQSSEPSGETFVKTDQLDGETDWKLRVAPSLTQNL 343

Query: 326  SENDLINRISITASAPEKSIHKFLGKVTYKDSTSNPLSVDNTLWANTVLASSGFCIACVV 385
            ++++++ ++ ITASAPEKSIH F GK+TYK S S PLSVDNTLWANTVLASSG C+ACV+
Sbjct: 344  TQDEMLTKVHITASAPEKSIHMFTGKLTYKGS-SAPLSVDNTLWANTVLASSGTCVACVI 402

Query: 386  YTGRDTRQAMNTTTAKVKTGLLELEINSISKILCACVFALSILLVAFAGFHNDDWYIDIL 445
            YTG DTRQAMNT+ + VKTGLLELEINS+SKILC CVF LSILLV   G  +D WY+DI+
Sbjct: 403  YTGTDTRQAMNTSKSSVKTGLLELEINSLSKILCICVFTLSILLVVIGGLDDDKWYVDIM 462

Query: 446  RYLILFSTIIPVSLRVNLDLAKSVYAHQIEHDKTIPETIVRTSTIPEDLGRIEYLLSDKT 505
            RYLILFSTIIPVSLRVNLDL KSVYA QIE DK+IP+TIVRTSTIPEDLGRIEYLLSDKT
Sbjct: 463  RYLILFSTIIPVSLRVNLDLGKSVYARQIESDKSIPDTIVRTSTIPEDLGRIEYLLSDKT 522

Query: 506  GTLTQNDMQLKKIHLGTVSYTSETLDIVSDYVQSLVSSKNDSLNNSKVALSTTRKDMSFR 565
            GTLTQNDMQL+KIHLGTVSYT ET+D+V+DY+Q+L S  N  +  + VA++ +RK++S R
Sbjct: 523  GTLTQNDMQLRKIHLGTVSYTMETMDMVTDYIQTLTSPAN--MGAAGVAVTGSRKEVSQR 580

Query: 566  VRDMILTLAICHNVTPTFEDDELTYQAASPDEIAIVKFTESVGLSLFKRDRHSISLLHEH 625
            VRD+++TLA CHNVTP FED+EL YQAASPDEIAIVKFTE VGLSLFKRDRHS++L HE+
Sbjct: 581  VRDLVVTLATCHNVTPNFEDNELAYQAASPDEIAIVKFTERVGLSLFKRDRHSLTLFHEY 640

Query: 626  SGKTLNYEILQVFPFNSDSKRMGIIVRDEQLDEYWFMQKGADTVMSKIVESNDWLEEETG 685
            SG  L Y+IL VFPF SD+KRMGIIVRD   +E WF+QKGADTVMSKIV+SNDWLEEE  
Sbjct: 641  SGVNLQYDILHVFPFTSDTKRMGIIVRDRTKNEIWFLQKGADTVMSKIVQSNDWLEEEVS 700

Query: 686  NMAREGLRTLVIGRKKLNKKIYEQFQKEYNDASLSMLNRDQQMSQVITKYLEHDLELLGL 745
            NMAREGLRTLVI RKKL+ ++YEQF KEY DASLSMLNRD+ M++V+ ++LEH+LELLGL
Sbjct: 701  NMAREGLRTLVIARKKLSTRLYEQFSKEYKDASLSMLNRDEAMNEVVKRHLEHNLELLGL 760

Query: 746  TGVEDKLQKDVKSSIELLRNAGIKIWMLTGDKVETARCVSISAKLISRGQYVHTITKVTR 805
            TGVEDKLQKDVK+SIELLRNAG+KIWMLTGDKVETARCV +SAKLISRGQYVHTITK+TR
Sbjct: 761  TGVEDKLQKDVKTSIELLRNAGVKIWMLTGDKVETARCVCVSAKLISRGQYVHTITKLTR 820

Query: 806  PEGAFNQLEYLKINRNACLLIDGESLGMFLKHYEQEFFDVVVHLPTVIACRCTPQQKADV 865
             +GA ++LEYLK NRN+CLLIDG+SL +++ HY  EFF++V+ LP VIACRCTPQQKADV
Sbjct: 821  RDGALSRLEYLKANRNSCLLIDGDSLAIYMSHYRAEFFEIVICLPVVIACRCTPQQKADV 880

Query: 866  ALVIRKMTGKRVCCIGDGGNDVSMIQCADVGVGIVGKEGKQASLAADFSITQFCHLTELL 925
            AL+IR+MTGKRVCCIGDGGNDVSMIQCADVGVGIVGKEGKQASLAAD+SITQFCHLT+LL
Sbjct: 881  ALLIREMTGKRVCCIGDGGNDVSMIQCADVGVGIVGKEGKQASLAADYSITQFCHLTKLL 940

Query: 926  LWHGRNSYKRSAKLAQFVMHRGLIIAICQAVYSICSLFEPIALYQGWLMVGYATCYTMAP 985
            LWHGRNSYKRSAKL+QFV+HRGL+I++CQAVYSI S  +PIALYQGWLMVGYATCYTMAP
Sbjct: 941  LWHGRNSYKRSAKLSQFVIHRGLLISVCQAVYSISSNLKPIALYQGWLMVGYATCYTMAP 1000

Query: 986  VFSLTLDHDIEESLTKIYPELYKELTEGKSLSYKTFFVWVLLSLFQGSVIQLFSQAFTSL 1045
            VFSLTLDHDI+ESLTK YPELYKELTEG+SLSYKTFFVWV+LSLFQG+VIQ FSQ F  +
Sbjct: 1001 VFSLTLDHDIDESLTKTYPELYKELTEGRSLSYKTFFVWVILSLFQGAVIQGFSQLFIGV 1060

Query: 1046 LDTDFTRMVAISFTALVVNELIMVALEIYTWNKTMLVTEIATLLFYIVSVPFLGDYFDLG 1105
                F +MVA+SFTALV+NELIMVALEIYTWNKTM ++EI T   Y++S+P LG+YFDL 
Sbjct: 1061 GSEVFKKMVALSFTALVINELIMVALEIYTWNKTMAISEIVTFAIYVLSIPLLGEYFDLT 1120

Query: 1106 YMTTVNYYAGLLVILLISIFPVWTAK 1131
             M  + ++  L +IL +SIFPVW AK
Sbjct: 1121 SMLALPFFIQLTIILTVSIFPVWAAK 1146

>Scas_89.1
          Length = 271

 Score =  478 bits (1230), Expect = e-161,   Method: Compositional matrix adjust.
 Identities = 219/255 (85%), Positives = 245/255 (96%)

Query: 707 YEQFQKEYNDASLSMLNRDQQMSQVITKYLEHDLELLGLTGVEDKLQKDVKSSIELLRNA 766
           Y++F+KEY+DASLSMLN D+ MS VI K+LEH+LELLGLTGVEDKLQ DVKSSIELLRNA
Sbjct: 2   YDKFEKEYHDASLSMLNXDETMSSVIKKHLEHNLELLGLTGVEDKLQNDVKSSIELLRNA 61

Query: 767 GIKIWMLTGDKVETARCVSISAKLISRGQYVHTITKVTRPEGAFNQLEYLKINRNACLLI 826
           G+KIWMLTGDKVETARCVSISAKLISRGQYVHT+TK++RPEGA N LEYLKIN+++CLLI
Sbjct: 62  GVKIWMLTGDKVETARCVSISAKLISRGQYVHTVTKLSRPEGALNALEYLKINKSSCLLI 121

Query: 827 DGESLGMFLKHYEQEFFDVVVHLPTVIACRCTPQQKADVALVIRKMTGKRVCCIGDGGND 886
           DGESLGMFL +Y+QEFFD+VV LP VIACRCTPQQKADVAL+IR++TGKRVCCIGDGGND
Sbjct: 122 DGESLGMFLTYYKQEFFDIVVDLPAVIACRCTPQQKADVALLIREITGKRVCCIGDGGND 181

Query: 887 VSMIQCADVGVGIVGKEGKQASLAADFSITQFCHLTELLLWHGRNSYKRSAKLAQFVMHR 946
           VSMIQCADVGVGIVGKEGKQASLAADFS+TQFCHLT+LLLWHGRNSYKRSAKLAQFV+HR
Sbjct: 182 VSMIQCADVGVGIVGKEGKQASLAADFSVTQFCHLTKLLLWHGRNSYKRSAKLAQFVIHR 241

Query: 947 GLIIAICQAVYSICS 961
           GLII++CQAVYS+CS
Sbjct: 242 GLIISVCQAVYSVCS 256

>KLLA0A04015g complement(355624..359655) similar to sp|P39524
            Saccharomyces cerevisiae YAL026c DRS2 P-type
            amino-phospholipids-ATPase, start by similarity
          Length = 1343

 Score =  446 bits (1148), Expect = e-136,   Method: Compositional matrix adjust.
 Identities = 318/993 (32%), Positives = 507/993 (51%), Gaps = 62/993 (6%)

Query: 167  RNRYVSNELSNAKYNAVTFVPTLLYEQFKFFYNLYFLVVALSQAVPALRIGYLSSYIVPL 226
            R  Y  N +S  KYNA TF+P  L+++F  + NL+FL  ++ Q VP +      + I  L
Sbjct: 199  RFGYRDNHISTTKYNAATFLPKFLFQEFSKYANLFFLFTSIIQQVPNVTPTNRYTTIGTL 258

Query: 227  AFVLTVTMAKEAXXXXXXXXXXXESNNELYHVI-TRNRSIPSK---DLKVGDLIKVHKGD 282
              VL V+  KE+           E N+ L  V+  R+     K   D+ VGD+I+V   +
Sbjct: 259  LVVLIVSAVKESVEDLKRSNADKELNHSLCDVLDERSGEFVRKKWIDIAVGDIIRVRSEE 318

Query: 283  RIPADLVLLQSSEPSGESFIKTDQLDGETDWKLRVACPLTQNLSENDLINRI--SITASA 340
             IPADL++L SSEP G  +I+T  LDGET+ K++ A   T N  +   + ++   + +  
Sbjct: 319  AIPADLIILSSSEPEGLCYIETANLDGETNLKIKQARQETANYLDEKALCKLHGRVQSEH 378

Query: 341  PEKSIHKFLGKVTYKDSTSNPLSVDNTLWANTVLASSGFCIACVVYTGRDTRQAMNTTTA 400
            P  S++ + G +T   ST  PLS D  L     L ++ +    +V+TG +T+   N T  
Sbjct: 379  PNSSLYTYEGTMTLNGSTF-PLSPDQMLLRGATLRNTAWIFGLIVFTGHETKLMRNATAT 437

Query: 401  KVKTGLLELEINSISKILCACVFALS-------ILLVAFAGFHNDDWYI----------- 442
             +K   +E  IN     L   +  L+       +++      H    YI           
Sbjct: 438  PIKRTAVERVINMQILALFGVLIVLALISSTGNVIMTKRDSAHLGYLYIEGTNKAGLFFK 497

Query: 443  DILRYLILFSTIIPVSLRVNLDLAKSVYAHQIE------HDKTIPETIVRTSTIPEDLGR 496
            DIL + ILFS ++P+SL V +++ K   A+ I       H+++   T+VRTS++ E+LG+
Sbjct: 498  DILTFWILFSNLVPISLFVTVEMIKYYQAYMIGSDLDLYHEESDTPTVVRTSSLVEELGQ 557

Query: 497  IEYLLSDKTGTLTQNDMQLKKIHLGTVSYTSETLDIVSDYVQSLVSSKNDSLNNSKVALS 556
            IEY+ SDKTGTLT+N M+ K + +    Y     +     V+  +     S  + K  ++
Sbjct: 558  IEYIFSDKTGTLTRNVMEFKSVSIAGRCYIETIPEDRRATVEDGIEIGFHSFESLKDKMT 617

Query: 557  TTRKDMSFRVRDMILTLAICHNVTP-TFEDDELTYQAASPDEIAIVKFTESVGLSLFKRD 615
                D +  V + +  LA CH V P T  D  + YQAASPDE A+V+    +G     R 
Sbjct: 618  DPEDDEAGIVIEFLTLLATCHTVIPETQSDGTIKYQAASPDEGALVQGAADLGFRFDIRR 677

Query: 616  RHSISLLHEHSGKTLNYEILQVFPFNSDSKRMGIIVRDEQLDEYWFMQKGADTVMSKIVE 675
             +S+S+    S + L Y++L +  FNS  KRM  I R        F  KGADTV+ + ++
Sbjct: 678  PNSVSISTPFS-EQLEYQLLNICEFNSTRKRMSAIFRMPDGSIKLFC-KGADTVILERLD 735

Query: 676  S--NDWLEEETGNM---AREGLRTLVIGRKKLNKKIYEQFQKEYNDASLSMLNRDQQMSQ 730
            S  N +++    ++   A EGLRTL I  + + +K YE++ K Y  AS +M +R +++ +
Sbjct: 736  SEFNPYVQSTLRHLEDYAAEGLRTLCIASRTIPEKEYEEWSKIYEAASTTMKDRTEELDR 795

Query: 731  VITKYLEHDLELLGLTGVEDKLQKDVKSSIELLRNAGIKIWMLTGDKVETARCVSISAKL 790
               + +EHDL  LG T +EDKLQ+ V  +I  L+ AG+K+W+LTGD+ ETA  + +S +L
Sbjct: 796  A-AELIEHDLFFLGATAIEDKLQEGVPETIHHLQEAGLKVWVLTGDRQETAINIGMSCRL 854

Query: 791  ISRGQYVHTITKVTRP------EGAFNQLEYLKINR----NACLLIDGESLGMFLKH-YE 839
            +S    +  + + T+       +   N +E  +I++    +  L+IDG+SLG  L+   E
Sbjct: 855  LSEDMNLLIVNEETKEDTRTNLQSKLNAIESHQISQQDMNSLALVIDGKSLGYALEEDLE 914

Query: 840  QEFFDVVVHLPTVIACRCTPQQKADVALVIRKMTGKRVCCIGDGGNDVSMIQCADVGVGI 899
             +F  +      VI CR +P QKA V  ++++ T   +  IGDG NDVSMIQ A VGVGI
Sbjct: 915  DQFLTIGKLCKAVICCRVSPLQKALVVKMVKRKTSSLLLAIGDGANDVSMIQAAHVGVGI 974

Query: 900  VGKEGKQASLAADFSITQFCHLTELLLWHGRNSYKRSAKLAQFVMHRGLIIAICQAVYSI 959
             G EG QA+ +ADF+I QF  L +LL+ HG  SY+R +    +  ++ + + + Q  Y  
Sbjct: 975  SGMEGMQAARSADFAIGQFRFLRKLLIVHGSWSYQRISLAILYSFYKNMALYMTQFWYVF 1034

Query: 960  CSLFEPIALYQGWLMVGYATCYTMAPVFSLTL-DHDIEESLTKIYPELYKELTEGKSLSY 1018
             + F   ++ + W +  Y   +T+ P F + + D  +   L   YP+LYK   +G+  S 
Sbjct: 1035 ANAFSGQSIMESWTLTFYNVFFTVMPPFVIGIFDQFVTSRLLDRYPQLYKLGQKGQFFSV 1094

Query: 1019 KTFFVWVLLSLFQGSVIQLFSQAFTSLLDT---------DFTRMVAISFTALVVNELIMV 1069
              F+ WVL   +  +V+ + S  F    +           +   V I  T++++  L   
Sbjct: 1095 TIFWGWVLNGFYHSAVVFIGSVLFYRYGNCLNMGGETADHWVWGVGIYTTSIII-VLGKA 1153

Query: 1070 ALEIYTWNKTMLVTEIATLLFYIVSVPFLGDYF 1102
            AL    W K  LV    +L+ +++  PF    F
Sbjct: 1154 ALITSQWTKFTLVAIPGSLVIWLLFFPFYSAVF 1186

>CAGL0G06270g 598357..602343 highly similar to sp|P39524 Saccharomyces
            cerevisiae YAL026c DRS2, start by similarity
          Length = 1328

 Score =  439 bits (1130), Expect = e-134,   Method: Compositional matrix adjust.
 Identities = 324/1034 (31%), Positives = 514/1034 (49%), Gaps = 80/1034 (7%)

Query: 130  YLKVSNTKNWSKFGSPIELSDQHIEREIHPDTTPVYDRNRYVSNELSNAKYNAVTFVPTL 189
            YL   NT +    G P         REIH       +R  Y+ N +S  KYNA TF+P  
Sbjct: 150  YLLRKNTSDGQDSGEP---------REIHISDRESNNRFGYIDNHISTTKYNAATFLPKF 200

Query: 190  LYEQFKFFYNLYFLVVALSQAVPALRIGYLSSYIVPLAFVLTVTMAKEAXXXXXXXXXXX 249
            L+++F  + NL+FL  +  Q VP +      + I  L  VL V+  KE+           
Sbjct: 201  LFQEFSKYANLFFLCTSAIQQVPHVSPTNRYTTIGTLMVVLIVSAIKESVEDLKRASSDN 260

Query: 250  ESNN---ELYHV----ITRNRSIPSKDLKVGDLIKVHKGDRIPADLVLLQSSEPSGESFI 302
            E NN   E+Y        + R I   D+KVGD+I+V+  + IPAD+++L SSEP G  +I
Sbjct: 261  ELNNSKAEIYFEAEGDFIQKRWI---DIKVGDIIRVNSEEPIPADIIILSSSEPEGLCYI 317

Query: 303  KTDQLDGETDWKLRVACPLTQNLSENDLINRIS--ITASAPEKSIHKFLGKVTYKDSTSN 360
            +T  LDGET+ K++ A   T  + ++  +  I   I++  P  S++ + G +   + T  
Sbjct: 318  ETANLDGETNLKIKQARTETAKIMDSRELRNIKGVISSEQPNSSLYTYEGTLEM-NGTKI 376

Query: 361  PLSVDNTLWANTVLASSGFCIACVVYTGRDTRQAMNTTTAKVKTGLLELEIN-------- 412
            PLS +  +     L ++G+    V++TG +T+   N T   +K   +E  IN        
Sbjct: 377  PLSPEQMILRGATLRNTGWIFGIVIFTGHETKLMRNATATPIKRTAVEKVINMQIIALFT 436

Query: 413  ---------SISKILCACVFALSILLVAFAGFHNDD-WYIDILRYLILFSTIIPVSLRVN 462
                     SI  ++ +   A  +  +   G +    ++ D L + ILFS ++P+SL V 
Sbjct: 437  VLVVLILISSIGNVIMSTADAKHLSYLYLQGTNKAGLFFKDFLTFWILFSNLVPISLFVT 496

Query: 463  LDLAKSVYAHQIEHD------KTIPETIVRTSTIPEDLGRIEYLLSDKTGTLTQNDMQLK 516
            ++L K   A  I  D      +T   T+V+TS++ E+LG+IEY+ SDKTGTLT+N M+ K
Sbjct: 497  VELIKYYQAFMIGSDLDLYYEETDTPTVVKTSSLVEELGQIEYIFSDKTGTLTRNIMEFK 556

Query: 517  KIHLGTVSYTSETLDIVSDYVQSLVSSKNDSLNNSKVALSTTRKDMSFRVRDMILTL-AI 575
               +    Y     +  +   +  +     S ++ K  L+T   D   ++ D  LTL A 
Sbjct: 557  SCSIAGRCYAEHIPEDKAATFEDGIEVGYRSFDDLKKQLTTNSDDC--KIIDEFLTLLAT 614

Query: 576  CHNVTPTFE-DDELTYQAASPDEIAIVKFTESVGLSLFKRDRHSISLLHEHSGKTLNYEI 634
            CH V P F+ D  + YQAASPDE A+V+    +G     R  +S+++L     +   Y++
Sbjct: 615  CHTVIPEFQADGSIKYQAASPDEGALVEGGALLGYKFLIRKPNSVTILINEE-EEREYQL 673

Query: 635  LQVFPFNSDSKRMGIIVRDEQLDEYWFMQKGADTV-MSKIVESNDWLEEETG----NMAR 689
            L +  FNS  KRM  I R    D    + KGAD+V + ++ E+ ++  + T     + A 
Sbjct: 674  LNICEFNSTRKRMSAIFRFPD-DSIKLLCKGADSVILERLSETGNFYVDATTRHLEDYAT 732

Query: 690  EGLRTLVIGRKKLNKKIYEQFQKEYNDASLSMLNRDQQMSQVITKYLEHDLELLGLTGVE 749
            EGLRTL +  K + +  Y  + K+Y DA+ ++ +R +++  V  + +E  L L+G T +E
Sbjct: 733  EGLRTLCLATKDIPEDEYNAWNKKYMDAATTLDHRAEKLDAVAEE-IESGLTLIGATAIE 791

Query: 750  DKLQKDVKSSIELLRNAGIKIWMLTGDKVETARCVSISAKLISRGQYVHTITKVTRPEGA 809
            DKLQ+ V  +I  L+ AGIKIW+LTGDK ETA  + +S +L+S    +  I++ T+    
Sbjct: 792  DKLQEGVPDTIRTLQEAGIKIWVLTGDKQETAINIGMSCRLLSEDMNLLIISEETKEATR 851

Query: 810  FNQLEYLKI----------NRNACLLIDGESLGMFLKHYEQEFFDVVVHL-PTVIACRCT 858
             N  E L                 L+IDG SL   L+   +++F  +  +   VI CR +
Sbjct: 852  RNMEEKLAALHEHSLSEHDMNTLALVIDGHSLSFALEADLEDYFLAIGKMCKAVICCRVS 911

Query: 859  PQQKADVALVIRKMTGKRVCCIGDGGNDVSMIQCADVGVGIVGKEGKQASLAADFSITQF 918
            P QKA V  ++++ T   +  IGDG NDVSMIQ A VGVGI G EG QA+ +AD S+ QF
Sbjct: 912  PLQKALVVKMVKRKTNSLLLAIGDGANDVSMIQAAHVGVGISGMEGMQAARSADISVGQF 971

Query: 919  CHLTELLLWHGRNSYKRSAKLAQFVMHRGLIIAICQAVYSICSLFEPIALYQGWLMVGYA 978
              L +LLL HG  SY+R +    +  ++   + + Q  Y   + F   ++ + W M  Y 
Sbjct: 972  RFLKKLLLVHGAWSYQRISVAILYSFYKNTALYMTQFWYVFANAFSGQSIMESWTMSLYN 1031

Query: 979  TCYTMAPVFSL-TLDHDIEESLTKIYPELYKELTEGKSLSYKTFFVWVLLSLFQGSV--- 1034
              +T+ P F +   D  +   L + YP+LYK   +G+  S   F+ W++   +  +V   
Sbjct: 1032 VFFTVLPPFVIGVFDQFVNSRLLERYPQLYKLGQKGQFFSVSIFWGWIVNGFYHSAVVFV 1091

Query: 1035 --IQLFSQAFTSLLDTD----FTRMVAISFTALVVNELIMVALEIYTWNKTMLVTEIATL 1088
              I  +   F      +    ++  +AI +T+ V+  L   AL    W K  L     +L
Sbjct: 1092 GTILFYRYGFALRKHGETADHWSWGIAI-YTSSVIIVLGKAALVTNQWTKFTLFAIPGSL 1150

Query: 1089 LFYIVSVPFLGDYF 1102
             F+++  P  G  F
Sbjct: 1151 FFWLIFFPIYGSIF 1164

>YAL026C (DRS2) [42] chr1 complement(95633..99700) Membrane-spanning
            Ca-ATPase (P-type) required for ribosome assembly and
            involved in late Golgi function, member of the cation
            transporting (E1-E2) P-type ATPase superfamily [4068 bp,
            1355 aa]
          Length = 1355

 Score =  439 bits (1130), Expect = e-133,   Method: Compositional matrix adjust.
 Identities = 313/1010 (30%), Positives = 503/1010 (49%), Gaps = 71/1010 (7%)

Query: 155  REIHPDTTPVYDRNRYVSNELSNAKYNAVTFVPTLLYEQFKFFYNLYFLVVALSQAVPAL 214
            R IH + +       Y  N +S  KYN  TF+P  L+++F  + NL+FL  +  Q VP +
Sbjct: 183  RVIHINDSLANSSFGYSDNHISTTKYNFATFLPKFLFQEFSKYANLFFLCTSAIQQVPHV 242

Query: 215  RIGYLSSYIVPLAFVLTVTMAKEAXXXXXXXXXXXESNN-------ELYHVITRNRSIPS 267
                  + I  L  VL V+  KE            E NN       E +      R I  
Sbjct: 243  SPTNRYTTIGTLLVVLIVSAMKECIEDIKRANSDKELNNSTAEIFSEAHDDFVEKRWI-- 300

Query: 268  KDLKVGDLIKVHKGDRIPADLVLLQSSEPSGESFIKTDQLDGETDWKLRVACPLTQNLSE 327
             D++VGD+I+V   + IPAD ++L SSEP G  +I+T  LDGET+ K++ +   T    +
Sbjct: 301  -DIRVGDIIRVKSEEPIPADTIILSSSEPEGLCYIETANLDGETNLKIKQSRVETAKFID 359

Query: 328  NDLINRIS--ITASAPEKSIHKFLGKVTYKDSTSNPLSVDNTLWANTVLASSGFCIACVV 385
               +  ++  + +  P  S++ + G +T  D    PLS D  +     L ++ +    V+
Sbjct: 360  VKTLKNMNGKVVSEQPNSSLYTYEGTMTLNDRQI-PLSPDQMILRGATLRNTAWIFGLVI 418

Query: 386  YTGRDTRQAMNTTTAKVKTGLLELEIN-----------------SISKILCACVFALSIL 428
            +TG +T+   N T   +K   +E  IN                 SI  ++ +   A  + 
Sbjct: 419  FTGHETKLLRNATATPIKRTAVEKIINRQIIRLFTVLIVLILISSIGNVIMSTADAKHLS 478

Query: 429  LVAFAGFHNDD-WYIDILRYLILFSTIIPVSLRVNLDLAKSVYAHQIEHD------KTIP 481
             +   G +    ++ D L + ILFS ++P+SL V ++L K   A  I  D      KT  
Sbjct: 479  YLYLEGTNKAGLFFKDFLTFWILFSNLVPISLFVTVELIKYYQAFMIGSDLDLYYEKTDT 538

Query: 482  ETIVRTSTIPEDLGRIEYLLSDKTGTLTQNDMQLKKIHLGTVSYTSETLDIVSDYVQSLV 541
             T+VRTS++ E+LG+IEY+ SDKTGTLT+N M+ K   +    Y  +  +  +  V+  +
Sbjct: 539  PTVVRTSSLVEELGQIEYIFSDKTGTLTRNIMEFKSCSIAGHCYIDKIPEDKTATVEDGI 598

Query: 542  SSKNDSLNNSKVALSTTRKDMSFRVRDMILTLAICHNVTPTFEDD-ELTYQAASPDEIAI 600
                   ++ K  L+    + S  + D +  LA CH V P F+ D  + YQAASPDE A+
Sbjct: 599  EVGYRKFDDLKKKLNDPSDEDSPIINDFLTLLATCHTVIPEFQSDGSIKYQAASPDEGAL 658

Query: 601  VKFTESVGLSLFKRDRHSISLLHEHSGKTLNYEILQVFPFNSDSKRMGIIVRDEQLDEYW 660
            V+    +G     R  +S+++L E +G+   Y++L +  FNS  KRM  I R        
Sbjct: 659  VQGGADLGYKFIIRKGNSVTVLLEETGEEKEYQLLNICEFNSTRKRMSAIFRFPDGSIKL 718

Query: 661  FMQKGADTVMSKIV--ESNDWLEEETGNM---AREGLRTLVIGRKKLNKKIYEQFQKEYN 715
            F  KGADTV+ + +  E+N ++E    ++   A EGLRTL +  + +++  YE++   YN
Sbjct: 719  FC-KGADTVILERLDDEANQYVEATMRHLEDYASEGLRTLCLAMRDISEGEYEEWNSIYN 777

Query: 716  DASLSMLNRDQQMSQVITKYLEHDLELLGLTGVEDKLQKDVKSSIELLRNAGIKIWMLTG 775
            +A+ ++ NR +++ +     +E +L L+G T +EDKLQ  V  +I  L+ AGIKIW+LTG
Sbjct: 778  EAATTLDNRAEKLDEA-ANLIEKNLILIGATAIEDKLQDGVPETIHTLQEAGIKIWVLTG 836

Query: 776  DKVETARCVSISAKLISRGQYVHTITKVTRPEGAFNQLEYLKIN------------RNAC 823
            D+ ETA  + +S +L+S    +  I + TR +   N LE  KIN            ++  
Sbjct: 837  DRQETAINIGMSCRLLSEDMNLLIINEETRDDTERNLLE--KINALNEHQLSTHDMKSLA 894

Query: 824  LLIDGESLGMFLKHYEQEFFDVVVHL-PTVIACRCTPQQKADVALVIRKMTGKRVCCIGD 882
            L+IDG+SLG  L+   +++   V  L   VI CR +P QKA V  ++++ +   +  I  
Sbjct: 895  LVIDGKSLGFALEPELEDYLLTVAKLCKAVICCRVSPLQKALVVKMVKRKSSSLLLAIAS 954

Query: 883  GGNDVSMIQCADVGVGIVGKEGKQASLAADFSITQFCHLTELLLWHGRNSYKRSAKLAQF 942
            G NDVSMIQ A VGVGI G EG QA+ +AD ++ QF  L +LLL HG  SY+R +    +
Sbjct: 955  GANDVSMIQAAHVGVGISGMEGMQAARSADIALGQFKFLKKLLLVHGSWSYQRISVAILY 1014

Query: 943  VMHRGLIIAICQAVYSICSLFEPIALYQGWLMVGYATCYTMAPVFSL-TLDHDIEESLTK 1001
              ++   + + Q  Y   + F   ++ + W M  Y   +T+ P F +   D  +   L +
Sbjct: 1015 SFYKNTALYMTQFWYVFANAFSGQSIMESWTMSFYNLFFTVWPPFVIGVFDQFVSSRLLE 1074

Query: 1002 IYPELYKELTEGKSLSYKTFFVWVLLSLFQGSVIQL---------FSQAFTSLLDTDFTR 1052
             YP+LYK   +G+  S   F+ W++   F  +++ +         F+      L   ++ 
Sbjct: 1075 RYPQLYKLGQKGQFFSVYIFWGWIINGFFHSAIVFIGTILIYRYGFALNMHGELADHWSW 1134

Query: 1053 MVAISFTALVVNELIMVALEIYTWNKTMLVTEIATLLFYIVSVPFLGDYF 1102
             V + +T  V+  L   AL    W K  L+    +LLF+++  P     F
Sbjct: 1135 GVTV-YTTSVIIVLGKAALVTNQWTKFTLIAIPGSLLFWLIFFPIYASIF 1183

>Kwal_26.7070
          Length = 1315

 Score =  430 bits (1105), Expect = e-130,   Method: Compositional matrix adjust.
 Identities = 312/1008 (30%), Positives = 510/1008 (50%), Gaps = 69/1008 (6%)

Query: 150  DQHIEREIHPDTTPVYDRNRYVSNELSNAKYNAVTFVPTLLYEQFKFFYNLYFLVVALSQ 209
            D+   R+I+ +         + SN +S  KYN  TF+P  L+++F  + NL+FL  +  Q
Sbjct: 177  DKSSPRQIYINDKEANRARGFGSNHISTTKYNLATFIPKFLFQEFSKYANLFFLFTSAIQ 236

Query: 210  AVPALRIGYLSSYIVPLAFVLTVTMAKEAXXXXXXXXXXXESNNELYHVITRNRS--IPS 267
             VP +      + I  L  VL V+  KE            E N+    V +        S
Sbjct: 237  QVPNVTPTNRYTTIGTLLIVLIVSAIKEIVEDLKRAQSDSELNDSRAQVFSEQLQDFTLS 296

Query: 268  K--DLKVGDLIKVHKGDRIPADLVLLQSSEPSGESFIKTDQLDGETDWKLRVA-CPLTQN 324
            K  ++ VGD+IKV+  + IPAD++++ SSEP G  +I+T  LDGET+ K++ A    ++ 
Sbjct: 297  KWVNISVGDIIKVNSEEAIPADVIVIASSEPEGLCYIETANLDGETNLKIKQARIETSKF 356

Query: 325  LSENDLIN-RISITASAPEKSIHKFLGKVTYKDSTSNPLSVDNTLWANTVLASSGFCIAC 383
            + ++DL   R  + +  P  S++ + G +   +  +  LS +  +     L ++ +    
Sbjct: 357  IDKDDLAGMRGKVLSEHPNSSLYTYEGTMNL-NGKNISLSPEQMVLRGATLRNTAWIYGL 415

Query: 384  VVYTGRDTRQAMNTTTAKVKTGLLELEINSISKILCACVFALSILLVAFAGFHN------ 437
            VV+TG +T+   N T   +K   +E  IN    +    +F + I+L   +   N      
Sbjct: 416  VVFTGHETKLMRNATATPIKRTAVERVIN----MQIVALFGVLIVLALISSIGNVIKVTS 471

Query: 438  ----------------DDWYIDILRYLILFSTIIPVSLRVNLDLAKSVYAHQIEHDKTIP 481
                              ++ DIL Y ILFS ++P+SL V +++ K   A+ I  D  + 
Sbjct: 472  DAEHLTYLYLQGTNKVGLFFKDILTYWILFSNLVPISLFVTVEMIKYYQAYMIASDLDLY 531

Query: 482  E------TIVRTSTIPEDLGRIEYLLSDKTGTLTQNDMQLKKIHLGTVSYTSETLDIVSD 535
            +      T+VRTS++ E+LG+IEY+ SDKTGTLT+N M+ K   +    Y     +  + 
Sbjct: 532  DEASDSPTVVRTSSLVEELGQIEYIFSDKTGTLTRNVMEFKSCSIAGKCYIETIPEDKAA 591

Query: 536  YVQSLVSSKNDSLNNSKVALSTTRKDMSFRVRDMILTLAICHNVTPTF-EDDELTYQAAS 594
              +  +       ++ K  L+ T+   S  + D +  LA CH V P F ED  + YQAAS
Sbjct: 592  TTEDGIEIGFRKFDSMKETLNDTQDPDSHIINDFLTLLATCHTVIPEFQEDGSIKYQAAS 651

Query: 595  PDEIAIVKFTESVGLSLFKRDRHSISLLHEHSGKTLNYEILQVFPFNSDSKRMGIIVRDE 654
            PDE A+V+   S+G     R  +S+S+L E  G+   Y++L +  FNS  KRM  I R  
Sbjct: 652  PDEGALVEGAASLGYKFIIRKPNSVSVLIEDLGQEQEYQLLNICEFNSTRKRMSAIFRLP 711

Query: 655  QLDEYWFMQKGADTVMSKIVES--NDWLEEETGNM---AREGLRTLVIGRKKLNKKIYEQ 709
               E     KGADTV+ + +++  N ++E    ++   A EGLRTL +  + + +  Y +
Sbjct: 712  N-GEIKLFCKGADTVILERLKAGENPYIEATLRHLEDYAAEGLRTLCLASRTVTESEYAE 770

Query: 710  FQKEYNDASLSMLNRDQQMSQVITKYLEHDLELLGLTGVEDKLQKDVKSSIELLRNAGIK 769
            ++  Y+ AS ++ +R Q++     + +E DL LLG T +EDKLQ  V  +I  L++AGIK
Sbjct: 771  WKDIYDAASTTLDDRAQKLDDA-AELIEKDLFLLGATAIEDKLQDGVPETIHTLQDAGIK 829

Query: 770  IWMLTGDKVETARCVSISAKLISRGQYVHTITKVTRPEGAFNQLEYLKI---------NR 820
            +W+LTGD+ ETA  + +S +L+S    +  I +  +     N  E LK          + 
Sbjct: 830  VWVLTGDRQETAVNIGMSCRLLSEDMNLLIINEEDKEATRKNLTEKLKAISDHQISQQDM 889

Query: 821  NA-CLLIDGESLGMFLKHYEQEFFDVVVHL-PTVIACRCTPQQKADVALVIRKMTGKRVC 878
            N+  L+IDG+SLG  L+   +++   +  L   VI CR +P QKA V  ++++ T   + 
Sbjct: 890  NSLALVIDGKSLGFALEADLEDYLLAIGKLCKAVICCRVSPLQKALVVKMVKRKTDSLLL 949

Query: 879  CIGDGGNDVSMIQCADVGVGIVGKEGKQASLAADFSITQFCHLTELLLWHGRNSYKRSAK 938
             IGDG NDVSMIQ A VGVGI G EG QA+ +ADF+I QF +L +LLL HG  SY+R ++
Sbjct: 950  AIGDGANDVSMIQAAHVGVGISGMEGMQAARSADFAIAQFKYLKKLLLVHGSWSYQRISQ 1009

Query: 939  LAQFVMHRGLIIAICQAVYSICSLFEPIALYQGWLMVGYATCYTMAPVFSL-TLDHDIEE 997
               +  ++ + + + Q  Y   + +   ++ + W M  Y   +T+ P F +   D  +  
Sbjct: 1010 AILYSFYKNIALYMTQFWYVFANAYSGQSIMESWTMTFYNVFFTVLPPFVMGVFDQFVSS 1069

Query: 998  SLTKIYPELYKELTEGKSLSYKTFFVWVLLSLFQGSVIQLFSQAF---TSLLDT------ 1048
             L   YP+LYK    G+  S + F+ WV+   +  +V  + S  F    ++L++      
Sbjct: 1070 RLLDRYPQLYKLGQRGQFFSVRIFWGWVINGFYHSAVTFIGSTLFYRNGNVLNSHGETAD 1129

Query: 1049 DFTRMVAISFTALVVNELIMVALEIYTWNKTMLVTEIATLLFYIVSVP 1096
             +   V+I +T  V+  +   AL    W K        +L+F++V  P
Sbjct: 1130 HWAWGVSI-YTCSVIIVIGKAALVTNQWTKFTAFAIPGSLVFWLVFFP 1176

>ADR350W [2091] [Homologous to ScYAL026C (DRS2) - SH]
            complement(1320732..1324667) [3936 bp, 1311 aa]
          Length = 1311

 Score =  410 bits (1055), Expect = e-123,   Method: Compositional matrix adjust.
 Identities = 291/874 (33%), Positives = 456/874 (52%), Gaps = 72/874 (8%)

Query: 170  YVSNELSNAKYNAVTFVPTLLYEQFKFFYNLYFLVVALSQAVPALRIGYLSSYIVPLAFV 229
            Y  N +S  KYNA TF+P  L+++F  + NL+FL  ++ Q VP +      + I  L  V
Sbjct: 194  YGDNHISTTKYNAATFLPKFLFQEFSKYANLFFLFTSIIQQVPNVTPTNRFTTIGTLIVV 253

Query: 230  LTVTMAKEAXXXXXXXXXXXESNNELYHVIT--RNRSIPSK--DLKVGDLIKVHKGDRIP 285
            L V+  KE+           E N+    V +    + I  K  D+ VGD+I+V   + IP
Sbjct: 254  LVVSAIKESVEDLKRSNSDKELNHSRADVYSDEMGQFISKKWIDIAVGDIIRVRSEEAIP 313

Query: 286  ADLVLLQSSEPSGESFIKTDQLDGETDWKLRVACPLTQNLSENDLIN--RISITASAPEK 343
            ADL++L SSEP G  +I+T  LDGET+ K++ A P T  + +   ++  R  I +  P  
Sbjct: 314  ADLIVLSSSEPEGLCYIETANLDGETNLKIKQARPETSKILDVRELSAMRGKILSEQPNT 373

Query: 344  SIHKFLGKVTYKDSTSNPLSVDNTLWANTVLASSGFCIACVVYTGRDTRQAMNTTTAKVK 403
            S++ + G +   ++   PLS D  L     L ++ +    V++TG +T+   N T   +K
Sbjct: 374  SLYTYEGTMILHNNRI-PLSPDQILLRGATLRNTVWIFGIVIFTGHETKLTRNATATPIK 432

Query: 404  TGLLELEINSISKILCACVFALSI------LLVAFAGFHNDDW------------YIDIL 445
               +E  IN     L   +  LS+      L+V +    N  +            + +IL
Sbjct: 433  RTAVERVINLQIVALFGVLICLSLISSFGNLIVMYNQKENLSYLYLQGTNMVALFFKNIL 492

Query: 446  RYLILFSTIIPVSLRVNLDLAKSVYAHQIE------HDKTIPETIVRTSTIPEDLGRIEY 499
             + ILFS ++P+SL V +++ K   A+ I       H+++   T+VRTS++ E+LG+IEY
Sbjct: 493  TFWILFSNLVPISLFVTVEMIKYYQAYMIASDLDLFHEESNMPTVVRTSSLVEELGQIEY 552

Query: 500  LLSDKTGTLTQNDMQLKKIHLGTVSYTSETLDIVSDYVQSLVSSKNDSLNNSKVALSTTR 559
            + SDKTGTLTQN M+ K   +    Y           +QS+   K+ + +        T 
Sbjct: 553  IFSDKTGTLTQNVMEFKSCSIAGRCY-----------IQSIPEDKDAAFDEGIEVGYRTY 601

Query: 560  KDM----------SFRVRDMILTL-AICHNVTPTF-EDDELTYQAASPDEIAIVKFTESV 607
             DM             + D  LTL +ICH V P F E+  + YQAASPDE A+V+    +
Sbjct: 602  DDMHELLHTPGSGDGAIIDEFLTLLSICHTVIPEFQENGSIKYQAASPDEGALVQGAADL 661

Query: 608  GLSLFKRDRHSISLLHEHSGKTLNYEILQVFPFNSDSKRMGIIVRDEQLDEYWFMQKGAD 667
            G     R  +S+++L E   + + YE+L +  FNS  KRM  I R    +    + KGAD
Sbjct: 662  GYKFIIRKPNSVTILREDITEEVVYELLNICEFNSTRKRMSAIFRFPD-NSIRLLCKGAD 720

Query: 668  TVMSK--IVESNDWLEEETGNM---AREGLRTLVIGRKKLNKKIYEQFQKEYNDASLSML 722
            TV+ +     SN ++     ++   A EGLRTL I  + + +  YE++ K Y+ A+ +M 
Sbjct: 721  TVILERLAATSNPYVAATLRHLEDYAAEGLRTLCIASRTIPESEYEEWSKLYDAAATTMH 780

Query: 723  NRDQQMSQVITKYLEHDLELLGLTGVEDKLQKDVKSSIELLRNAGIKIWMLTGDKVETAR 782
            NR +++ +V  + +E  L LLG T +EDKLQ  V  +I  L+ AGIK+W+LTGD+ ETA 
Sbjct: 781  NRSEELDKV-AEMIEKGLVLLGATAIEDKLQDGVPETIHTLQQAGIKVWVLTGDRQETAI 839

Query: 783  CVSISAKLISRGQYVHTITKVTRPEGAFNQLEYLK-INRNA---------CLLIDGESLG 832
             + +S KL+S    +  + + T+     N ++ L+ IN +           L+IDG+SLG
Sbjct: 840  NIGMSCKLLSEDMNLLIVNEDTKESTRNNLIDKLRAINDHQISQQDMNTLALVIDGKSLG 899

Query: 833  MFLKHYEQEFFDVVVHL-PTVIACRCTPQQKADVALVIRKMTGKRVCCIGDGGNDVSMIQ 891
              L+   +EF   +  +   VI CR +P QKA V  ++++ T   +  IGDG NDVSMIQ
Sbjct: 900  FALEPDLEEFLLAIGKMCRAVICCRVSPLQKALVVKMVKRRTKSLLLAIGDGANDVSMIQ 959

Query: 892  CADVGVGIVGKEGKQASLAADFSITQFCHLTELLLWHGRNSYKRSAKLAQFVMHRGLIIA 951
             A VGVGI G EG QA+ +ADF++ QF +L +LLL HG  SY+R ++   +  ++ + + 
Sbjct: 960  AAHVGVGISGMEGMQAARSADFALGQFKYLKKLLLVHGSWSYQRISQAILYSFYKNIALY 1019

Query: 952  ICQAVYSICSLFEPIALYQGWLMVGYATCYTMAP 985
            + Q  Y + + F   ++ + W +  Y    T AP
Sbjct: 1020 MTQFWYVLYNAFSGQSIMESWTLTFYNWGGTAAP 1053

>YER166W (DNF1) [1594] chr5 (512739..517454) Member of the haloacid
            dehalogenase or epoxide hydrolase family, has low
            similarity to S. cerevisiae Drs2p, which is a
            membrane-spanning Ca-ATPase (P-type) required for
            ribosome assembly and involved in late Golgi function
            [4716 bp, 1571 aa]
          Length = 1571

 Score =  352 bits (902), Expect = e-101,   Method: Compositional matrix adjust.
 Identities = 261/892 (29%), Positives = 446/892 (50%), Gaps = 125/892 (14%)

Query: 268  KDLKVGDLIKVHKGDRIPADLVLLQSSEPSGESFIKTDQLDGETDWKLRVACPLTQNLSE 327
            K +KVGD++++H  D IPAD++LL +S+  G  +++T  LDGET+ K+R +   T  +  
Sbjct: 399  KGVKVGDIVRIHNNDEIPADIILLSTSDTDGACYVETKNLDGETNLKVRQSLKCTNTIRT 458

Query: 328  NDLINRIS--ITASAPEKSIHKFLGKVTYKDST-----SNPLSVDNTLWANTVLASSGFC 380
            +  I R    I +  P  +++ + G + +++       + P++++N L     L ++ + 
Sbjct: 459  SKDIARTKFWIESEGPHSNLYTYQGNMKWRNLADGEIRNEPITINNVLLRGCTLRNTKWA 518

Query: 381  IACVVYTGRDTRQAMNTTTAKVKTGLLELEINSISKILCACVFALSIL------------ 428
            +  V++TG DT+  +N+     K   +  E+N    I    +F L  +            
Sbjct: 519  MGVVMFTGGDTKIMLNSGITPTKKSRISRELNFSVVINFVLLFILCFVSGIANGVYYDKK 578

Query: 429  --------LVAFAGFHNDDWYIDILRYLILFSTIIPVSLRVNLDLAKSVYAHQIEHD--- 477
                        AG    + ++     +IL+ +++P+SL +++++ K+  A  I  D   
Sbjct: 579  GRSRFSYEFGTIAGSAATNGFVSFWVAVILYQSLVPISLYISVEIIKTAQAAFIYGDVLL 638

Query: 478  ---KTIPETIVRTSTIPEDLGRIEYLLSDKTGTLTQNDMQLKKIHLGTVSY--------- 525
               K       ++  I +DLG++EY+ SDKTGTLTQN M+ KK  +  VSY         
Sbjct: 639  YNAKLDYPCTPKSWNISDDLGQVEYIFSDKTGTLTQNVMEFKKCTINGVSYGRAYTEALA 698

Query: 526  ---TSETLDIVSD--YVQSLVSSKNDSLNNSKVALSTTRK----DMSFR----VRDM--- 569
                 + +D+ ++    ++ ++   D++ +   ALS   +    +++F     VRD+   
Sbjct: 699  GLRKRQGIDVETEGRREKAEIAKDRDTMIDELRALSGNSQFYPEEVTFVSKEFVRDLKGA 758

Query: 570  ------------ILTLAICHNVTPTFEDD---ELTYQAASPDEIAIVKFTESVGLSLFKR 614
                        +L LA+CH+V      D   +L  +A SPDE A+V     VG S   +
Sbjct: 759  SGEVQQRCCEHFMLALALCHSVLVEANPDNPKKLDLKAQSPDEAALVATARDVGFSFVGK 818

Query: 615  DRHSISLLHEHSGKTLNYEILQVFPFNSDSKRMGIIVRDEQLD-----EYWFMQKGADTV 669
             +    L+ E  G    +EIL +  FNS  KRM  IV+   L+         + KGAD++
Sbjct: 819  TKKG--LIIEMQGIQKEFEILNILEFNSSRKRMSCIVKIPGLNPGDEPRALLICKGADSI 876

Query: 670  ----MSKIVESN-DWLEEETG----NMAREGLRTLVIGRKKLNKKIYEQFQKEYNDASLS 720
                +S+   SN + + E+T       A EGLRTL I +++L+   YE++ ++Y+ A+ S
Sbjct: 877  IYSRLSRQSGSNSEAILEKTALHLEQYATEGLRTLCIAQRELSWSEYEKWNEKYDIAAAS 936

Query: 721  MLNRDQQMSQVITKYLEHDLELLGLTGVEDKLQKDVKSSIELLRNAGIKIWMLTGDKVET 780
            + NR+ ++ +V+   +E +L LLG T +ED+LQ  V   IELL  AGIK+W+LTGDKVET
Sbjct: 937  LANREDEL-EVVADSIERELILLGGTAIEDRLQDGVPDCIELLAEAGIKLWVLTGDKVET 995

Query: 781  ARCVSISAKLISRGQYVHTITKV--------TRPEGAFNQL--EYLK------------- 817
            A  +  S  L++    +  I           + P    + L  +YLK             
Sbjct: 996  AINIGFSCNLLNNEMELLVIKTTGDDVKEFGSEPSEIVDALLSKYLKEYFNLTGSEEEIF 1055

Query: 818  --------INRNACLLIDGESL--GMFLKHYEQEFFDVVVHLPTVIACRCTPQQKADVAL 867
                       N  ++IDG++L   ++ +   ++F  +  +   V+ CR +P QKA V  
Sbjct: 1056 EAKKDHEFPKGNYAIVIDGDALKLALYGEDIRRKFLLLCKNCRAVLCCRVSPSQKAAVVK 1115

Query: 868  VIRKMTGKRVCCIGDGGNDVSMIQCADVGVGIVGKEGKQASLAADFSITQFCHLTELLLW 927
            +++         IGDG NDV+MIQ ADVG+GI G+EG+QA + +D++I QF +L  L+L 
Sbjct: 1116 LVKDSLDVMTLAIGDGSNDVAMIQSADVGIGIAGEEGRQAVMCSDYAIGQFRYLARLVLV 1175

Query: 928  HGRNSYKRSAKLAQFVMHRGLIIAICQAVYSICSLFEPIALYQGWLMVGYATCYTMAPVF 987
            HGR SYKR A++     ++ +I A+    Y I + F+   LY+   M+ Y   +T  PV 
Sbjct: 1176 HGRWSYKRLAEMIPEFFYKNMIFALALFWYGIYNDFDGSYLYEYTYMMFYNLAFTSLPVI 1235

Query: 988  SLT-LDHDIEESLTKIYPELYKELTEGKSLSYKTFFVWVLLSLFQGSVIQLF 1038
             L  LD D+ ++++ + P+LY+     K  + + F  ++L  L+Q S+I  F
Sbjct: 1236 FLGILDQDVNDTISLVVPQLYRVGILRKEWNQRKFLWYMLDGLYQ-SIICFF 1286

 Score = 45.4 bits (106), Expect = 3e-04,   Method: Compositional matrix adjust.
 Identities = 26/91 (28%), Positives = 42/91 (46%)

Query: 169 RYVSNELSNAKYNAVTFVPTLLYEQFKFFYNLYFLVVALSQAVPALRIGYLSSYIVPLAF 228
           +Y  N++   KY  +TF+P  +  QF  F N+YFLV+ +  A     +       VPL  
Sbjct: 190 QYPRNKIRTTKYTPLTFLPKNILFQFHNFANVYFLVLIILGAFQIFGVTNPGLSAVPLVV 249

Query: 229 VLTVTMAKEAXXXXXXXXXXXESNNELYHVI 259
           ++ +T  K+A           E NN   H++
Sbjct: 250 IVIITAIKDAIEDSRRTVLDLEVNNTKTHIL 280

>CAGL0L11814g 1262124..1266854 highly similar to sp|P32660
            Saccharomyces cerevisiae YER166w or sp|Q12675
            Saccharomyces cerevisiae YDR093w, start by similarity
          Length = 1576

 Score =  351 bits (900), Expect = e-101,   Method: Compositional matrix adjust.
 Identities = 284/990 (28%), Positives = 478/990 (48%), Gaps = 157/990 (15%)

Query: 268  KDLKVGDLIKVHKGDRIPADLVLLQSSEPSGESFIKTDQLDGETDWKLRVA--CPLTQNL 325
            K +KVGD++++H  D IPAD++LL +S+  G  +++T  LDGET+ K+R A  C      
Sbjct: 395  KSVKVGDIVRIHNNDEIPADIILLSTSDSDGGCYVETKNLDGETNLKVRQALKCSYKIKT 454

Query: 326  SENDLINRISITASAPEKSIHKFLGKVTYKDSTSN-----PLSVDNTLWANTVLASSGFC 380
            S +    R  I +  P  +++ + G + +KDST+N     P++++N L     L ++ + 
Sbjct: 455  SRDIARTRFWIESEGPHANLYSYQGNLKWKDSTNNELRNEPVTINNMLLRGCTLRNTKWA 514

Query: 381  IACVVYTGRDTRQAMNTTTAKVKTGLLELEINSISKILCACVFALSIL------------ 428
            +  VV+TG DT+  +N      K   +  E+N    I    +F L  +            
Sbjct: 515  MGIVVFTGDDTKIMLNAGVTPTKKSRISRELNFSVLINFLVLFILCFISGLANGIDYDKH 574

Query: 429  --------LVAFAGFHNDDWYIDILRYLILFSTIIPVSLRVNLDLAKSVYAHQIEHD--- 477
                        AG    + ++     +IL+ +++P+SL +++++ K+  A  I  D   
Sbjct: 575  PRSRDFFEFGTVAGNPATNGFVSFWVAVILYQSLVPISLYISVEIIKTAQAAFIYGDVLL 634

Query: 478  ---KTIPETIVRTSTIPEDLGRIEYLLSDKTGTLTQNDMQLKKIHLGTVSY--------- 525
               K       ++  I +DLG+IEY+ SDKTGTLTQN M+ KK  +  VSY         
Sbjct: 635  YNAKLDYPCTPKSWNISDDLGQIEYIFSDKTGTLTQNVMEFKKCTINGVSYGRAYTEALA 694

Query: 526  ---TSETLDIVSD--YVQSLVSSKNDSLNNSKVALSTTR---------------KDMSFR 565
                 + +D+ ++    +  ++   D + N    LS                  +D   R
Sbjct: 695  GLRKRQGIDVEAEGRREKEEIAKDRDVMINDLRNLSNNTQFFPDEITFISKEIVQDFKGR 754

Query: 566  VRDM--------ILTLAICHNV----TPTFEDDELTYQAASPDEIAIVKFTESVGLSLFK 613
              D+        +L LA+CH+V    +PT   ++L  +A SPDE A+V     +G     
Sbjct: 755  NGDIQKKCCEHFMLALALCHSVLTEPSPT-NPNKLEMKAQSPDEAALVTTARDLGFCFMG 813

Query: 614  RDRHSISLLHEHSGKTLNYEILQVFPFNSDSKRMGIIVR-------DEQLDEYWFMQKGA 666
            + +    ++ E  G    +EIL +  FNS  KRM  I++       DE       + KGA
Sbjct: 814  KTK--TGMVVEIQGIQKEFEILNILEFNSARKRMSCIIKIPGATPNDEP--RALLICKGA 869

Query: 667  DTVM-----SKIVESNDWLEEETG----NMAREGLRTLVIGRKKLNKKIYEQFQKEYNDA 717
            D+V+     +K  E+++ L E+T       A EGLRTL + +++L    Y ++   Y+ A
Sbjct: 870  DSVIYSRLSTKAGENDETLLEKTALHLEQYATEGLRTLCLAQRELTWSEYTEWNARYDIA 929

Query: 718  SLSMLNRDQQMSQVITKYLEHDLELLGLTGVEDKLQKDVKSSIELLRNAGIKIWMLTGDK 777
            + S+ NR++Q+ ++++  +E DL LLG T +ED+LQ  V  SI LL  AGIK+W+LTGDK
Sbjct: 930  AASLTNREEQL-EIVSDSIERDLILLGGTAIEDRLQDGVPESIALLAEAGIKLWVLTGDK 988

Query: 778  VETARCVSISAKLISR-----------------GQYVHT-----ITKVTRPE----GAFN 811
            VETA  +  S  L++                  G+  H      I+K  R +    G+  
Sbjct: 989  VETAINIGFSCNLLNNDMELLVVKTAGEDVLEYGEDPHEVVNSLISKYLREKFGLSGSEM 1048

Query: 812  QLEYLKINR-----NACLLIDGESLGMFL--KHYEQEFFDVVVHLPTVIACRCTPQQKAD 864
            +L+  K +      +  ++IDG++L + L     +++F  +  +   V+ CR +P QKA 
Sbjct: 1049 ELDNAKGDHSFPKGDFAVVIDGDALKIALTGDDMKRKFLLLCKNCKAVLCCRVSPAQKAA 1108

Query: 865  VALVIRKMTGKRVCCIGDGGNDVSMIQCADVGVGIVGKEGKQASLAADFSITQFCHLTEL 924
            V  +++         IGDG NDV+MIQ ADVG+GI G+EG+QA + +D++I QF +LT L
Sbjct: 1109 VVKLVKNTLDVMTLAIGDGSNDVAMIQSADVGIGIAGEEGRQAVMCSDYAIGQFRYLTRL 1168

Query: 925  LLWHGRNSYKRSAKLAQFVMHRGLIIAICQAVYSICSLFEPIALYQGWLMVGYATCYTMA 984
            LL HGR SYKR +++     ++ +I  +    Y I + F+   L++   ++ Y   +T  
Sbjct: 1169 LLVHGRWSYKRLSEMIPEFFYKNVIFTLALFWYGIYNNFDGSYLFEYTYLMFYNLAFTSI 1228

Query: 985  PVFSLT-LDHDIEESLTKIYPELYKELTEGKSLSY-KTFFVWVLLSLFQGSVIQLFSQAF 1042
            PV  L  LD D+ ++++ + P+LY+       L + +T F+W +      SVI  F   F
Sbjct: 1229 PVILLGILDQDVNDTISLVVPQLYR--VGILRLEWNQTKFLWYMFDGLYQSVICFF---F 1283

Query: 1043 TSLLDTDFTRMVAISFTALVVNELIMVALEIYTWNKTMLVTEIATLL--FYIVSVPFLGD 1100
              LL   + R   ++   + +     V +         +VT IA      YI+   +  D
Sbjct: 1284 PYLL---YKRNGVVTKNGMGLEHRYYVGI---------IVTTIAVFACNLYILIHQYRWD 1331

Query: 1101 YFDLGYMTTVNYYAGLLVILLISIFPVWTA 1130
            +F         ++  L  I++I    +WT+
Sbjct: 1332 WFS-------GFFIFLSCIVVIGWTGIWTS 1354

 Score = 43.9 bits (102), Expect = 9e-04,   Method: Compositional matrix adjust.
 Identities = 25/90 (27%), Positives = 40/90 (44%)

Query: 170 YVSNELSNAKYNAVTFVPTLLYEQFKFFYNLYFLVVALSQAVPALRIGYLSSYIVPLAFV 229
           Y  N++   KY  ++F P  L  QF+ F N+YFLV+ +  A     +       VPL  +
Sbjct: 184 YPRNKIRTTKYTPLSFFPKNLLFQFQNFANVYFLVLIILGAFQIFGVTNPGLSAVPLIVI 243

Query: 230 LTVTMAKEAXXXXXXXXXXXESNNELYHVI 259
           + +T  K+            E NN   H++
Sbjct: 244 VIITAIKDGIEDSRRTILDLEVNNTRTHIL 273

>KLLA0C17644g 1557138..1561868 similar to sp|P32660 Saccharomyces
            cerevisiae YER166w, start by similarity
          Length = 1576

 Score =  345 bits (885), Expect = 5e-99,   Method: Compositional matrix adjust.
 Identities = 257/894 (28%), Positives = 446/894 (49%), Gaps = 132/894 (14%)

Query: 268  KDLKVGDLIKVHKGDRIPADLVLLQSSEPSGESFIKTDQLDGETDWKLR--VACPLTQNL 325
            K + VGD+++VH  D IPAD++LL SS+  G  +++T  LDGET+ K+R  + C      
Sbjct: 444  KSVSVGDIVRVHNNDEIPADIILLSSSDSDGACYVETKNLDGETNLKVRQSLKCSHMIRN 503

Query: 326  SENDLINRISITASAPEKSIHKFLGKVTYKDSTSN-----PLSVDNTLWANTVLASSGFC 380
            S N    +  + +  P  +++ + G + + D  +      P++++N L     L ++ + 
Sbjct: 504  SRNITRTKFKVESEGPHSNLYSYQGNLKWVDRETGLEKNEPVNINNLLLRGCTLRNTKWA 563

Query: 381  IACVVYTGRDTRQAMNTTTAKVKTGLLELEINSISKILCACVFALSILLVAFAGFHNDDW 440
            +  VV+TG DT+  +N      K   +  E+N    +     FAL  +L   AG  N  +
Sbjct: 564  MGIVVFTGPDTKIMLNAGVTPTKVSRISRELN----LSVFMNFALLFVLCFAAGIVNGVY 619

Query: 441  Y------------------------IDILRYLILFSTIIPVSLRVNLDLAKSVYAHQIEH 476
            Y                        +     LIL+ +++P+SL +++++ K+  A  I  
Sbjct: 620  YRTDNTSRNYFEFGSIAGSAAANGVVSFWVALILYQSVVPISLYISIEIIKTAQALFIYG 679

Query: 477  DKTI-------PETIVRTSTIPEDLGRIEYLLSDKTGTLTQNDMQLKKIHLGTVSY---- 525
            D  +       P T  ++ TI +DLG+IEY+ SDKTGTLTQN M+ KK  +  VSY    
Sbjct: 680  DVALYNERLDYPCT-PKSWTISDDLGQIEYIFSDKTGTLTQNVMEFKKCTINGVSYGRAY 738

Query: 526  --------TSETLDIVSDYV---QSLVSSKNDSLNNSKVALSTTR---KDMSFRVRDMI- 570
                      + +D+  +     + +   K   L N K+    ++   ++++F  ++ + 
Sbjct: 739  TEALAGLRKRQGIDVEEEGALEKEGIAQDKEIMLANLKILGENSQLRPENVTFVSKEFVQ 798

Query: 571  ------------------LTLAICHNVTPTFEDDE---LTYQAASPDEIAIVKFTESVGL 609
                              L LA+CH V      D+   + ++A SPDE A+V     +G 
Sbjct: 799  DTAGANGETQKKCNENFMLALALCHTVLVEENKDDPEIMDFKAQSPDEAALVGTARDMGF 858

Query: 610  SLFKRDRHSISLLHEHSGKTLNYEILQVFPFNSDSKRMGIIVR--DEQLDE---YWFMQK 664
            S   R ++ +  + +  G    Y +L V  FNS  KRM  I++   E  +E      + K
Sbjct: 859  SFVGRTKNGV--IVDIQGVQKEYRLLNVLEFNSTRKRMSCILKIPSENPNEEPRALLICK 916

Query: 665  GADTVM-SKIVESNDW-LEEETG----NMAREGLRTLVIGRKKLNKKIYEQFQKEYNDAS 718
            GAD+++ S++ ++ND  L E+T       A EGLRTL I +++L+ K Y+++ +++  A+
Sbjct: 917  GADSIIYSRLSKNNDEKLLEKTALHLEQYATEGLRTLCIAQRELSWKEYQEWNEKHEIAA 976

Query: 719  LSMLNRDQQMSQVITKYLEHDLELLGLTGVEDKLQKDVKSSIELLRNAGIKIWMLTGDKV 778
             ++++R+ +M +V    +E +L LLG T +ED+LQ  V  SI  L  AGIK+W+LTGDKV
Sbjct: 977  AALVDREDEMEKV-ADVIERELTLLGGTAIEDRLQDGVPDSIATLGEAGIKLWVLTGDKV 1035

Query: 779  ETARCVSISAKLISRGQYVHTITKV--------TRP------------------EGAFNQ 812
            ETA  +  S  L++    +  I           ++P                   G++ +
Sbjct: 1036 ETAINIGFSCNLLNNEMELLVIKASGDDVDIYGSKPAEIVKNLILKYLQEKFQMSGSYEE 1095

Query: 813  LEYLK-----INRNACLLIDGESLGMFLKH--YEQEFFDVVVHLPTVIACRCTPQQKADV 865
            LE  K        N  ++IDG++L + L++   ++EF  +      V+ CR +P QKA V
Sbjct: 1096 LEEAKKVHEPPTGNFGVIIDGDALKLALRNDDVKREFLLLCKRCKAVLCCRVSPAQKAAV 1155

Query: 866  ALVIRKMTGKRVCCIGDGGNDVSMIQCADVGVGIVGKEGKQASLAADFSITQFCHLTELL 925
              +++         IGDG NDV+MIQ AD+GVGI G+EG+QA +++D++I QF +LT L+
Sbjct: 1156 VKLVKNTLDVMTLAIGDGSNDVAMIQSADIGVGIAGEEGRQAVMSSDYAIGQFRYLTRLV 1215

Query: 926  LWHGRNSYKRSAKLAQFVMHRGLIIAICQAVYSICSLFEPIALYQGWLMVGYATCYTMAP 985
            L HGR SYKR A++     ++ +I  +    Y + + ++   L++   +  +   +T  P
Sbjct: 1216 LVHGRWSYKRMAEMIPLFFYKNVIFTLSLFWYGVYNNYDGSYLFEYTYLTLFNLAFTSLP 1275

Query: 986  VFSLT-LDHDIEESLTKIYPELYKELTEGKSLSYKTFFVWVLLSLFQGSVIQLF 1038
            V  L  LD D+ + ++ + P+LY+        +   F++++  +++Q SVI  F
Sbjct: 1276 VIFLGILDQDVNDIVSMVVPQLYRVGILRSEWNQTKFWLYMFDAMYQ-SVICFF 1328

 Score = 41.2 bits (95), Expect = 0.006,   Method: Compositional matrix adjust.
 Identities = 25/90 (27%), Positives = 39/90 (43%)

Query: 170 YVSNELSNAKYNAVTFVPTLLYEQFKFFYNLYFLVVALSQAVPALRIGYLSSYIVPLAFV 229
           Y  N++   KY  +TF P  +  QFK   N+YFLV+ +        +       VPL  +
Sbjct: 240 YPRNKIRTTKYTPLTFFPKNIAFQFKNVANVYFLVLIIMGFFQIFGVANPGLATVPLIVI 299

Query: 230 LTVTMAKEAXXXXXXXXXXXESNNELYHVI 259
           + +T  K+A           E NN   H++
Sbjct: 300 VVLTSFKDAIEDSRRTILDMEVNNAPTHIL 329

>Scas_576.8
          Length = 1591

 Score =  344 bits (883), Expect = 1e-98,   Method: Compositional matrix adjust.
 Identities = 271/960 (28%), Positives = 467/960 (48%), Gaps = 135/960 (14%)

Query: 268  KDLKVGDLIKVHKGDRIPADLVLLQSSEPSGESFIKTDQLDGETDWKLRVACPLTQNLSE 327
            K++KVGD++++H  D IPAD++LL +S+  G  +++T  LDGET+ K+R +   + ++  
Sbjct: 415  KNVKVGDIVRIHNNDEIPADIILLSTSDSDGGCYLETKNLDGETNLKVRESLKCSHSIRN 474

Query: 328  NDLINRIS--ITASAPEKSIHKFLGKVTYKDS-----TSNPLSVDNTLWANTVLASSGFC 380
            +  I R    + +  P  +++ + G V + DS      + P++++N L     L ++ + 
Sbjct: 475  SRDIARTKFWVESEGPHANLYSYQGNVKWVDSKDGDLKNEPVTINNLLLRGCTLRNTKWA 534

Query: 381  IACVVYTGRDTRQAMNTTTAKVKTGLLELEIN-SISK----ILCACVFALSILLVAF--- 432
            +  VV+TG DT+  +N+     K   +  E+N S+S     +   C  +  I  V +   
Sbjct: 535  MGMVVFTGDDTKIMLNSGATPTKKSRISRELNLSVSLNFLFLFIICFISAIINGVDYDKH 594

Query: 433  ------------AGFHNDDWYIDILRYLILFSTIIPVSLRVNLDLAKSVYAHQIEHD--- 477
                        AG  + + ++     +IL+ +++P+SL +++++ K+  A  I  D   
Sbjct: 595  PRSRDFFEFGTVAGSASTNGFVSFWVAVILYQSLVPISLYISVEIIKTAQAAFIYGDVLL 654

Query: 478  ---KTIPETIVRTSTIPEDLGRIEYLLSDKTGTLTQNDMQLKKIHLGTVSYTSETLDIVS 534
               K       ++  I +D+G+IEY+ SDKTGTLTQN M+ KK  +  +SY     + ++
Sbjct: 655  YNAKLDYPCTPKSWNISDDMGQIEYIFSDKTGTLTQNVMEFKKCTINGISYGRAYTEALA 714

Query: 535  DYVQ--------------SLVSSKNDSLNNSKVALSTTRK----DMSFRVRDMI------ 570
               +                ++   D++ N+   LS   +    D++F  ++ +      
Sbjct: 715  GLRKRQGIDVEEEGRREKEEIAKDRDTMINTLRNLSHNSQFYPDDITFISKEFVNDLKGA 774

Query: 571  -------------LTLAICHN--VTPTFEDD-ELTYQAASPDEIAIVKFTESVGLSLFKR 614
                         L LA+CH+  V P   D  +L  +A SPDE A+V     VG S   +
Sbjct: 775  SGDMQQKCCEHFMLALALCHSVLVEPNKHDSKKLDVKAQSPDEAALVCTARDVGFSFIGK 834

Query: 615  DRHSISLLHEHSGKTLNYEILQVFPFNSDSKRMGIIVR-----DEQLDEYWFMQKGADTV 669
             +    L+ E  G    ++IL    FNS  KRM  IV+      +       + KGAD++
Sbjct: 835  TK--TGLIIEVQGVQKEFQILNTLEFNSTRKRMSCIVKIPGANPDDEPRALLICKGADSI 892

Query: 670  M-----SKIVESNDWLEEETG----NMAREGLRTLVIGRKKLNKKIYEQFQKEYNDASLS 720
            +     +K   +++ L E+T       A EGLRTL I +++L+   Y ++ K Y+ A+ S
Sbjct: 893  IYSRLGTKNGANSENLLEKTALHLEQYATEGLRTLCIAQRELSWPEYLEWNKRYDIAAAS 952

Query: 721  MLNRDQQMSQVITKYLEHDLELLGLTGVEDKLQKDVKSSIELLRNAGIKIWMLTGDKVET 780
            + NR++Q+ + ++  +E +L LLG T +ED+LQ  V  SI +L  AGIK+W+LTGDKVET
Sbjct: 953  VTNREEQL-EAVSDEIERELTLLGGTAIEDRLQDGVPESISILAQAGIKLWVLTGDKVET 1011

Query: 781  ARCVSISAKLI----------SRGQYVHT------------ITKVTRPE----GAFNQLE 814
            A  +  S  L+          + G  V              ITK  R +    G+  +L 
Sbjct: 1012 AINIGFSCNLLNNDMELLVVKTNGDDVQEFGNDPAEIAESLITKYLREKFGLTGSEMELA 1071

Query: 815  YLKINR-----NACLLIDGESLGMFL--KHYEQEFFDVVVHLPTVIACRCTPQQKADVAL 867
              K N      +  ++IDGE+L + L  +   ++F  +  +   V+ CR +P QKA V  
Sbjct: 1072 DAKKNHDFPRGDFAVVIDGEALKLALNGESIRRKFLLLCKNCKAVLCCRVSPAQKAAVVK 1131

Query: 868  VIRKMTGKRVCCIGDGGNDVSMIQCADVGVGIVGKEGKQASLAADFSITQFCHLTELLLW 927
            ++          IGDG NDV+MIQ ADVGVGI G+EG+QA + +D++I QF +LT L+L 
Sbjct: 1132 LVMTSLDVMTLAIGDGSNDVAMIQSADVGVGIAGEEGRQAVMCSDYAIGQFRYLTRLVLV 1191

Query: 928  HGRNSYKRSAKLAQFVMHRGLIIAICQAVYSICSLFEPIALYQGWLMVGYATCYTMAPV- 986
            HGR SY+R A++     ++ +I  +    Y I + F+   L++   ++ Y   +T  PV 
Sbjct: 1192 HGRWSYRRLAEMIPAFFYKNVIFTLALFWYGIYNNFDGSYLFEYTFLMFYNLAFTSLPVI 1251

Query: 987  FSLTLDHDIEESLTKIYPELYKELTEGKSLSYKTFFVWVLLSLFQGSVIQLFSQAF---- 1042
            F   +D D+ ++++ + P+LY+        +   F  ++L  L+Q  +   F        
Sbjct: 1252 FMGIMDQDVSDTVSLVMPQLYRSGILRLDWNQTKFLWYMLDGLYQSCICFFFPYCLYHKN 1311

Query: 1043 ----TSLLDTDFTRMVAISFTAL-VVNELIMVALEIYTWN--KTMLVTEIATLLFYIVSV 1095
                 + L  D    V +  T+L VV+  I + L  Y W+    + +     +LF+   V
Sbjct: 1312 QIVSNNGLGLDHRFYVGVMVTSLAVVSCNIYMLLHQYRWDWFSCLFIGLSCIILFFWTGV 1371

 Score = 46.6 bits (109), Expect = 1e-04,   Method: Compositional matrix adjust.
 Identities = 28/103 (27%), Positives = 46/103 (44%), Gaps = 3/103 (2%)

Query: 157 IHPDTTPVYDRNRYVSNELSNAKYNAVTFVPTLLYEQFKFFYNLYFLVVALSQAVPALRI 216
           +  D  P+ D   Y  N++   KY+ + F P  +  QF+ F N+YFLV+ +  A     +
Sbjct: 191 VDEDGKPITD---YPRNKIRTTKYSPLNFFPKNIMFQFQNFANVYFLVLIILGAFQIFGV 247

Query: 217 GYLSSYIVPLAFVLTVTMAKEAXXXXXXXXXXXESNNELYHVI 259
                  VPL  ++ +T  K+A           E NN   H++
Sbjct: 248 TNPGLAAVPLIVIVIITAIKDAIEDSRRTLLDMEVNNTRTHIL 290

>YDR093W (DNF2) [945] chr4 (631276..636114) Member of the haloacid
            dehalogenase or epoxide hydrolase family, has low
            similarity to familial intrahepatic cholestasis 1 (human
            ATP8B1), which is an aminophospholipid ATPase transporter
            associated with familial intrahepatic cholestasis [4839
            bp, 1612 aa]
          Length = 1612

 Score =  344 bits (883), Expect = 1e-98,   Method: Compositional matrix adjust.
 Identities = 284/990 (28%), Positives = 474/990 (47%), Gaps = 163/990 (16%)

Query: 268  KDLKVGDLIKVHKGDRIPADLVLLQSSEPSGESFIKTDQLDGETDWKLRVACPLTQNLSE 327
            K++KVGD+++VH  D IPAD++LL +S+  G  +++T  LDGET+ K+R +   ++ +  
Sbjct: 444  KNVKVGDIVRVHNNDEIPADMILLSTSDVDGACYVETKNLDGETNLKVRQSLKCSKIIKS 503

Query: 328  NDLINRIS--ITASAPEKSIHKFLGKVTYKDSTSN-----PLSVDNTLWANTVLASSGFC 380
            +  I R    + +  P  +++ + G   ++D+ +      P++++N L     L ++ + 
Sbjct: 504  SRDITRTKFWVESEGPHANLYSYQGNFKWQDTQNGNIRNEPVNINNLLLRGCTLRNTKWA 563

Query: 381  IACVVYTGRDTRQAMNTTTAKVKTGLLELEINSISKILCACVFALSILLVAFAGFHNDDW 440
            +  V++TG DT+  +N      K   +  E+N  S IL    F L  +L   AG  N  +
Sbjct: 564  MGMVIFTGDDTKIMINAGVTPTKKSRISRELN-FSVILN---FVLLFILCFTAGIVNGVY 619

Query: 441  YIDILR------------------------YLILFSTIIPVSLRVNLDLAKSVYAHQIEH 476
            Y    R                         +IL+ +++P+SL +++++ K+  A  I  
Sbjct: 620  YKQKPRSRDYFEFGTIGGSASTNGFVSFWVAVILYQSLVPISLYISVEIIKTAQAIFIYT 679

Query: 477  D------KTIPETIVRTSTIPEDLGRIEYLLSDKTGTLTQNDMQLKKIHLGTVSYTSETL 530
            D      K       ++  I +DLG+IEY+ SDKTGTLTQN M+ KK  +  VSY     
Sbjct: 680  DVLLYNAKLDYPCTPKSWNISDDLGQIEYIFSDKTGTLTQNVMEFKKCTINGVSYGRAYT 739

Query: 531  DIVSDYVQSLVSSKNDSLNNSKVALSTTRKDMSFRVRDM--------------------- 569
            + ++   +             K  ++  R+ M   +R M                     
Sbjct: 740  EALAGLRKRQGVDVESEGRREKEEIAKDRETMIDELRSMSDNTQFCPEDLTFVSKEIVED 799

Query: 570  ----------------ILTLAICHNV--TPTFED-DELTYQAASPDEIAIVKFTESVGLS 610
                            +L LA+CH+V   P  +D  +L  +A SPDE A+V     +G S
Sbjct: 800  LKGSSGDHQQKCCEHFLLALALCHSVLVEPNKDDPKKLDIKAQSPDESALVSTARQLGYS 859

Query: 611  LFKRDRHSISLLHEHSGKTLNYEILQVFPFNSDSKRMGIIVR-------DEQLDEYWFMQ 663
                 +    L+ E  G    +++L V  FNS  KRM  I++       DE   +   + 
Sbjct: 860  FVGSSKSG--LIVEIQGVQKEFQVLNVLEFNSSRKRMSCIIKIPGSTPKDEP--KALLIC 915

Query: 664  KGADTVM-SKI--VESNDWLEEETG----NMAREGLRTLVIGRKKLNKKIYEQFQKEYND 716
            KGAD+V+ S++   +++  L E+T       A EGLRTL + +++L    YE++ K Y+ 
Sbjct: 916  KGADSVIYSRLDRTQNDATLLEKTALHLEEYATEGLRTLCLAQRELTWSEYERWVKTYDV 975

Query: 717  ASLSMLNRDQQMSQVITKYLEHDLELLGLTGVEDKLQKDVKSSIELLRNAGIKIWMLTGD 776
            A+ S+ NR++++ +V T  +E +L LLG T +ED+LQ  V  SI LL  AGIK+W+LTGD
Sbjct: 976  AAASVTNREEELDKV-TDVIERELILLGGTAIEDRLQDGVPDSIALLAEAGIKLWVLTGD 1034

Query: 777  KVETARCVSISAKLI----------SRGQYVHT------------ITKVTRPE-GAFNQL 813
            KVETA  +  S  ++          + G+ V              +TK  R + G     
Sbjct: 1035 KVETAINIGFSCNVLNNDMELLVVKASGEDVEEFGSDPIQVVNNLVTKYLREKFGMSGSE 1094

Query: 814  EYLKINR--------NACLLIDGESLGMFLKHYE--QEFFDVVVHLPTVIACRCTPQQKA 863
            E LK  +        N  ++IDG++L + L   E  ++F  +  +   V+ CR +P QKA
Sbjct: 1095 EELKEAKREHGLPQGNFAVIIDGDALKVALNGEEMRRKFLLLCKNCKAVLCCRVSPAQKA 1154

Query: 864  DVALVIRKMTGKRVCCIGDGGNDVSMIQCADVGVGIVGKEGKQASLAADFSITQFCHLTE 923
             V  +++K        IGDG NDV+MIQ ADVGVGI G+EG+QA + +D++I QF ++T 
Sbjct: 1155 AVVKLVKKTLDVMTLAIGDGSNDVAMIQSADVGVGIAGEEGRQAVMCSDYAIGQFRYVTR 1214

Query: 924  LLLWHGRNSYKRSAKLAQFVMHRGLIIAICQAVYSICSLFEPIALYQGWLMVGYATCYTM 983
            L+L HG+  YKR A++     ++ +I  +    Y I + F+   L++   +  Y   +T 
Sbjct: 1215 LVLVHGKWCYKRLAEMIPQFFYKNVIFTLSLFWYGIYNNFDGSYLFEYTYLTFYNLAFTS 1274

Query: 984  APVFSLT-LDHDIEESLTKIYPELYKELTEGKSLSYKTFFVWVLLSLFQGSVIQLFSQAF 1042
             PV  L  LD D+ ++++ + P+LY+     K  + +T F+W +L     SVI  F   F
Sbjct: 1275 VPVILLAVLDQDVSDTVSMLVPQLYRVGILRKEWN-QTKFLWYMLDGVYQSVICFF---F 1330

Query: 1043 TSLLDTDFTRMVAISFTALVVNELIMVALEIYTWNKTMLVTEIA--TLLFYIVSVPFLGD 1100
              L    + + + ++   L ++    V +          VT IA  +  FY+    +  D
Sbjct: 1331 PYLA---YHKNMVVTENGLGLDHRYFVGV---------FVTAIAVTSCNFYVFMEQYRWD 1378

Query: 1101 YFDLGYMTTVNYYAGLLVILLISIFPVWTA 1130
            +F            GL + L +++F  WT 
Sbjct: 1379 WF-----------CGLFICLSLAVFYGWTG 1397

 Score = 42.7 bits (99), Expect = 0.002,   Method: Compositional matrix adjust.
 Identities = 24/91 (26%), Positives = 40/91 (43%)

Query: 170 YVSNELSNAKYNAVTFVPTLLYEQFKFFYNLYFLVVALSQAVPALRIGYLSSYIVPLAFV 229
           Y  N++   KY  +TF P  +  QF  F N+YFL++ +  A     +       VPL  +
Sbjct: 229 YPRNKIRTTKYTPLTFFPKNILFQFHNFANIYFLILLILGAFQIFGVTNPGFASVPLIVI 288

Query: 230 LTVTMAKEAXXXXXXXXXXXESNNELYHVIT 260
           + +T  K+            E NN   H+++
Sbjct: 289 VIITAIKDGIEDSRRTVLDLEVNNTRTHILS 319

>AGR120C [4431] [Homologous to ScYER166W (DNF1) - SH; ScYDR093W (DNF2)
            - SH] (972456..977099) [4644 bp, 1547 aa]
          Length = 1547

 Score =  343 bits (879), Expect = 3e-98,   Method: Compositional matrix adjust.
 Identities = 288/1003 (28%), Positives = 474/1003 (47%), Gaps = 149/1003 (14%)

Query: 268  KDLKVGDLIKVHKGDRIPADLVLLQSSEPSGESFIKTDQLDGETDWKLRVACPLTQNLSE 327
            KD++VGD++++H  D IPAD++LL +S+  G  +++T  LDGET+ K+R +   +  +  
Sbjct: 406  KDIRVGDIVRIHNNDEIPADIILLSTSDADGACYVETKNLDGETNLKVRQSLKCSHRIRN 465

Query: 328  NDLINRIS--ITASAPEKSIHKFLGKVTYKDSTSN-----PLSVDNTLWANTVLASSGFC 380
            +  I+R    + +  P  +++ + G   + DS +      P++++N L     L ++ + 
Sbjct: 466  SKDISRCKFWVESEGPHANLYSYQGNFKWVDSETGVMHNEPVNINNMLLRGCSLRNTKWA 525

Query: 381  IACVVYTGRDTRQAMNTTTAKVKTGLLELEINSISKILCACVFALSILLVAFAGFHNDDW 440
            +  V++TG DT+  +N      K   +  E+N  S IL    F    +L   AG  N  +
Sbjct: 526  MGIVMFTGTDTKIMLNAGVTPTKRSRISRELN-YSVILN---FVFLFVLCLAAGLVNGIY 581

Query: 441  YI---------------------DILRY---LILFSTIIPVSLRVNLDLAKSVYAHQIEH 476
            Y                       IL +   LIL+ +++P+SL +++++ K+  A  I  
Sbjct: 582  YRRDATSRTFFEFGTVAGTPFANGILAFFVALILYQSLVPISLYISIEIIKTAQAAFIYG 641

Query: 477  D------KTIPETIVRTSTIPEDLGRIEYLLSDKTGTLTQNDMQLKKIHLGTVSY----- 525
            D      K       RT  I +DLG+IEY+ SDKTGTLTQN M+ KK  +  VSY     
Sbjct: 642  DVLLYNPKLDYPCTPRTWNISDDLGQIEYIFSDKTGTLTQNVMEFKKCTINGVSYGRAYT 701

Query: 526  -------TSETLDI----------VSDYVQSLVS-----SKNDSLNNSKVAL-------- 555
                     + +DI          + +  + +V       KN  L+   V          
Sbjct: 702  EALAGLRKRQGVDIEEEGARERAEIEEDKKQMVELLLKLGKNSQLDPHTVTFVSKELVQD 761

Query: 556  --STTRKDMSFRVRDMILTLAICHNVT---PTFEDDELTYQAASPDEIAIVKFTESVGLS 610
                  ++    V   +L+LA+CH+V         ++L  +A SPDE A+V+    +G S
Sbjct: 762  LGGANSQEQKEAVEHFMLSLALCHSVVVEENKNNPEKLDIKAQSPDEAALVETARDMGFS 821

Query: 611  LFKRDRHSISLLHEHSGKTLNYEILQVFPFNSDSKRMGIIVRDEQLDE-----YWFMQKG 665
               R ++ + +  E  G    + IL V  FNS  KRM  IV+    DE        + KG
Sbjct: 822  FVGRTKNGVII--EIQGVQKEFRILNVLEFNSTRKRMSCIVKIPAADENSKPKALLLCKG 879

Query: 666  ADTVM-SKIVES-ND-WLEEETG----NMAREGLRTLVIGRKKLNKKIYEQFQKEYNDAS 718
            AD+V+ S++  S ND  L E T       A EGLRTL + +++++   Y  + +    A+
Sbjct: 880  ADSVIYSRLDRSRNDPKLLERTALHLEQFATEGLRTLCVAQREIDWDEYLNWNERRELAA 939

Query: 719  LSMLNRDQQMSQVITKYLEHDLELLGLTGVEDKLQKDVKSSIELLRNAGIKIWMLTGDKV 778
             S+ NR++ + +V    +E  L LLG T +ED+LQ  V  SI +L +AGIK+W+LTGDKV
Sbjct: 940  ASLDNREEALERV-ADAIERQLVLLGGTAIEDRLQDGVPDSISILADAGIKLWVLTGDKV 998

Query: 779  ETARCVSISAKLI----------SRGQYV---------------------HTITKVTRPE 807
            ETA  +  S  L+          S G+ V                     H   K +  E
Sbjct: 999  ETAINIGFSCNLLGSDMELLVIKSSGEDVEHLGEKDSDVVLALIDKYLETHFNMKGSPEE 1058

Query: 808  GAFNQLEYLKINRNACLLIDGESLGMFL--KHYEQEFFDVVVHLPTVIACRCTPQQKADV 865
             A  + ++        ++IDG++L + L  +   ++F  +  +   V+ CR +P QKA V
Sbjct: 1059 LAAARKDHTPPQSAFGVVIDGDALKLALHGEDIRRKFLLLCKNCKAVLCCRVSPSQKAAV 1118

Query: 866  ALVIRKMTGKRVCCIGDGGNDVSMIQCADVGVGIVGKEGKQASLAADFSITQFCHLTELL 925
              ++++        IGDG NDV+MIQ ADVG+GI G+EG+QA ++AD++I QF +LT L+
Sbjct: 1119 VKLVKESLDVVTLAIGDGSNDVAMIQAADVGIGIAGEEGRQAVMSADYAIGQFRYLTRLV 1178

Query: 926  LWHGRNSYKRSAKLAQFVMHRGLIIAICQAVYSICSLFEPIALYQGWLMVGYATCYTMAP 985
            L HGR SYKR A++     ++ +   +    + ICS ++   L++   ++ Y   +T  P
Sbjct: 1179 LVHGRWSYKRLAEMIPQFFYKNITFTLALFWFGICSNYDGSYLFEYTYLMFYNLAFTSLP 1238

Query: 986  VFSLT-LDHDIEESLTKIYPELYKELTEGKSLSYKTFFVWVLLSLFQGSVIQLFSQAF-- 1042
            V  L  +D D  + L+ + P+LYK        +   F+ +    ++Q S+I  F      
Sbjct: 1239 VIFLGIMDQDASDVLSVVVPQLYKVGILRTEWTQNKFWWYCFDGVYQ-SIICFFFPYLCY 1297

Query: 1043 --TSL-------LDTDFTRMVAISFTALV-VNELIMVALEIYTWNKTMLVTEIATLLFYI 1092
              T L       LD  +T  V ++  A+V  N  +++    + W  T+ +     +LF+ 
Sbjct: 1298 YRTGLITKNAYGLDHRYTFGVFVTSIAVVSCNLYVLIHQYRWDWFTTLFIFLSCGILFFW 1357

Query: 1093 VSVPFLGDYFDLGYMTTVNYYAG------LLVILLISIFPVWT 1129
              V     Y    Y T V  YA       L V ++  + P +T
Sbjct: 1358 TGVWSSATYSGEFYKTAVRLYAQPVFWAVLFVGVIFCLLPRFT 1400

 Score = 40.8 bits (94), Expect = 0.008,   Method: Compositional matrix adjust.
 Identities = 24/90 (26%), Positives = 41/90 (45%)

Query: 170 YVSNELSNAKYNAVTFVPTLLYEQFKFFYNLYFLVVALSQAVPALRIGYLSSYIVPLAFV 229
           Y  N++   KY  ++F+P  L  QFK   N+YFL++     V    +   +   +PL  +
Sbjct: 203 YPRNKIRTTKYTPLSFLPKNLAYQFKNAANIYFLLLVCLSFVSIFGVTNPALAAIPLIAI 262

Query: 230 LTVTMAKEAXXXXXXXXXXXESNNELYHVI 259
           + +T  K+A           E NN   H++
Sbjct: 263 VVITGLKDAFEDSRRTILDLEVNNMRSHIL 292

>CAGL0G08085g 763185..767921 highly similar to sp|Q12675 Saccharomyces
            cerevisiae YDR093w, hypothetical start
          Length = 1578

 Score =  342 bits (878), Expect = 4e-98,   Method: Compositional matrix adjust.
 Identities = 257/899 (28%), Positives = 445/899 (49%), Gaps = 140/899 (15%)

Query: 268  KDLKVGDLIKVHKGDRIPADLVLLQSSEPSGESFIKTDQLDGETDWKLRVACPLTQNLSE 327
            K++KVGD++++H  + IPAD++LL +S+  G  +++T  LDGET+ K+R +   T ++  
Sbjct: 406  KNVKVGDIVRIHNNEEIPADIILLSTSDSDGACYVETKNLDGETNLKVRQSMKCTSDIRS 465

Query: 328  NDLINRIS--ITASAPEKSIHKFLGKVTYKDSTSN-----PLSVDNTLWANTVLASSGFC 380
            +  I R    I +  P  +++ + G   +     N     P++++N L     L ++ + 
Sbjct: 466  SIDIARTRFWIESEGPHANLYSYQGNFRWNSLEDNQLKNEPVNINNLLLRGCTLRNTKWA 525

Query: 381  IACVVYTGRDTRQAMNTTTAKVKTGLLELEINSISKILCACVFALSILLVAFAG-FHND- 438
            +  V +TG DT+  +N      K   +  E+N       A +F L  +   + G +HN  
Sbjct: 526  MGVVAFTGDDTKIMLNAGVTPTKKSRISKELNLSVLFNFALLFVLCFIAGLYNGIYHNKH 585

Query: 439  ------------------DWYIDILRYLILFSTIIPVSLRVNLDLAKSVYAHQIEHD--- 477
                                ++     +IL+ +++P+SL +++++ K+  A  I  D   
Sbjct: 586  PRSRDFFDFGTGTGGSATSGFVSFWVAVILYQSLVPISLYISVEIIKTAQAIFIYLDVMM 645

Query: 478  ---KTIPETIVRTSTIPEDLGRIEYLLSDKTGTLTQNDMQLKKIHLGTVSYTSETLDIVS 534
               K       ++  I +DLG+IEY+ SDKTGTLTQN M+ KK  +  VSY         
Sbjct: 646  YNEKLDYPCTPKSWNISDDLGQIEYIFSDKTGTLTQNVMEFKKCTINGVSYGRA------ 699

Query: 535  DYVQSLVSSKN----DSLNNSKV---ALSTTRKDMSFRVRDM------------------ 569
             Y ++L   +     D  + SK+    +   R++M  +++++                  
Sbjct: 700  -YTEALAGLRKRQGVDVAHESKIEKEGIKRDREEMINKLQNLAKNSQFYEDEVTFVSKEF 758

Query: 570  -------------------ILTLAICHNV--TPTFEDD-ELTYQAASPDEIAIVKFTESV 607
                               +L LA+CH+V   P+ ED  +L  +A SPDE A+V     +
Sbjct: 759  VDDLTGGSGSVQQKSCQHFMLALALCHSVLTEPSKEDPAKLEIKAQSPDEAALVTTARDM 818

Query: 608  GLSLFKRDRHSISLLHEHSGKTLNYEILQVFPFNSDSKRMGIIVRDEQLD-----EYWFM 662
            G S  K+ +  + L  E  G    ++IL +  FNS  KRM  IV+    D     +   +
Sbjct: 819  GFSFLKKTKEGMVL--EVQGIEKEFQILNILEFNSSRKRMSCIVKIPGDDANGKPKALLI 876

Query: 663  QKGADTV----MSKIVESNDWLEEETG----NMAREGLRTLVIGRKKLNKKIYEQFQKEY 714
             KGAD+V    + K   + + L E+T       A EGLRTL + +++L+ + YE++ K+Y
Sbjct: 877  CKGADSVIYSRLDKTGLNEESLLEKTALHLEQYATEGLRTLCLAQRELSWEEYERWNKKY 936

Query: 715  NDASLSMLNRDQQMSQVITKYLEHDLELLGLTGVEDKLQKDVKSSIELLRNAGIKIWMLT 774
            + A+ ++++R++++ +V +  +E  L LLG T +ED+LQ  V  SI LL  AGIK+W+LT
Sbjct: 937  DIAAAAVVDREEELEKV-SDEIERHLILLGGTAIEDRLQDGVPDSIALLGEAGIKLWVLT 995

Query: 775  GDKVETARCVSISAKLISRGQYVHTITKVTRPE--------------------------- 807
            GDKVETA  +  S  L++    +  I K T P+                           
Sbjct: 996  GDKVETAINIGFSCNLLNNDMELLVI-KTTGPDVEDLGATPKDIVDTLISQYLHDKFGMA 1054

Query: 808  GAFNQLEYLKINRNA-----CLLIDGESLGMFL--KHYEQEFFDVVVHLPTVIACRCTPQ 860
            G+  +L+  K   +       ++IDGE+L   L  +  +++F  +  +  +V+ CR +P 
Sbjct: 1055 GSEEELKKAKAEHDIPRGEFAVIIDGEALKYALSTEDMKRKFLLLCKNCKSVLCCRVSPA 1114

Query: 861  QKADVALVIRKMTGKRVCCIGDGGNDVSMIQCADVGVGIVGKEGKQASLAADFSITQFCH 920
            QKA V  +++         IGDG NDV+MIQ A++GVGI G+EG+QA +++D++I QF +
Sbjct: 1115 QKAAVVKLVKNTLDVMTLAIGDGSNDVAMIQSANIGVGIAGEEGRQAVMSSDYAIGQFRY 1174

Query: 921  LTELLLWHGRNSYKRSAKLAQFVMHRGLIIAICQAVYSICSLFEPIALYQGWLMVGYATC 980
            LT LLL HG+  YKR A++     ++ +I  +    + I + ++   L++   +  Y   
Sbjct: 1175 LTRLLLVHGKWCYKRLAEMIPQFFYKNMIFTLALFWFGIYNDYDGSYLFEYTYLTFYNLA 1234

Query: 981  YTMAPVFSLTL-DHDIEESLTKIYPELYKELTEGKSLSYKTFFVWVLLSLFQGSVIQLF 1038
            +T  PV  L + D D+ ++++ ++P+LY+     K  S +T F+W +L     SVI  F
Sbjct: 1235 FTSIPVILLGIFDQDVSDTISLVFPQLYRVGILRKEWS-QTKFLWYMLDGLYQSVIAFF 1292

 Score = 41.6 bits (96), Expect = 0.005,   Method: Compositional matrix adjust.
 Identities = 28/105 (26%), Positives = 48/105 (45%), Gaps = 2/105 (1%)

Query: 170 YVSNELSNAKYNAVTFVPTLLYEQFKFFYNLYFLVVALSQAVPALRIGYLSSYIVPLAFV 229
           Y  N++   KY  +TF+P  +  QF  F N+YFL++ +  A     +       VPL  +
Sbjct: 196 YPRNKIRTTKYTPLTFLPKNILLQFHNFANIYFLILIILGAFQIFGVTNPGFSAVPLIVI 255

Query: 230 LTVTMAKEAXXXXXXXXXXXESNNELYHVIT--RNRSIPSKDLKV 272
           + +T  K+            E NN   HV+T   N ++ + D+ +
Sbjct: 256 IIITAIKDGIEDSRRTVLDLEVNNTKTHVLTGIENYNVSADDISL 300

>Scas_636.16
          Length = 1554

 Score =  340 bits (873), Expect = 2e-97,   Method: Compositional matrix adjust.
 Identities = 269/959 (28%), Positives = 456/959 (47%), Gaps = 142/959 (14%)

Query: 268  KDLKVGDLIKVHKGDRIPADLVLLQSSEPSGESFIKTDQLDGETDWKLRVACPLTQNLSE 327
            K+++VGD++++H  D IPAD++LL +S+  G  +++T  LDGE++ K+R +   T  +  
Sbjct: 378  KNVRVGDIVRIHNNDEIPADVILLSTSDIDGGCYVETKNLDGESNLKVRQSLRCTNAIRN 437

Query: 328  NDLINRIS--ITASAPEKSIHKFLGKVTYKDST-----SNPLSVDNTLWANTVLASSGFC 380
            +  I R    + +  P  +++ + G + + DS      + P++++N L     L ++ + 
Sbjct: 438  SRDICRTKFWVESEGPHANLYVYQGNLKWIDSLDGQTHNEPITINNMLLRGCTLRNTKWA 497

Query: 381  IACVVYTGRDTRQAMNTTTAKVKTGLLELEINSISKILCACVFALSILLVA--------- 431
            +  VV+TG DT+  +N      K   +  E+N    +L   VF   + L+A         
Sbjct: 498  MGIVVFTGDDTKTMINAGVTPTKKSRISRELNF--SVLINFVFLFILCLIAGVANGAYYR 555

Query: 432  -------------FAGFHNDDWYIDILRYLILFSTIIPVSLRVNLDLAKSVYAHQIEHDK 478
                          AG    + ++     +IL+ +++P+SL +++++ K+  A  I  D 
Sbjct: 556  KKPRSRDFFEFGTIAGNPTTNGFVSFWVAVILYQSLVPISLYISVEIIKTAQAIFIYLDV 615

Query: 479  TI-------PETIVRTSTIPEDLGRIEYLLSDKTGTLTQNDMQLKKIHLGTVSYTSETLD 531
             +       P T  ++ +I +DLG+IEY+ SDKTGTLTQN M+ KK  +  VSY     +
Sbjct: 616  LLYNERLDYPCT-PKSWSISDDLGQIEYIFSDKTGTLTQNVMEFKKCTINGVSYGRAYTE 674

Query: 532  IVSDYV--QSLVSSKNDSLNNSKVA------LSTTRK----------DMSF--------- 564
             ++     Q + + K   +    +A      +   RK          +++F         
Sbjct: 675  ALAGLRKRQGIDTEKEGRIEREGIAQDREIMIDDLRKISNNSQFYPEELTFVSKEFSQDL 734

Query: 565  ----------RVRDMILTLAICHNV--TPTFED-DELTYQAASPDEIAIVKFTESVGLSL 611
                      R +  +L LA+CH+V   P   D ++L   A SPDE A+V     +G S 
Sbjct: 735  LGNNGEVQQKRCQHFMLALALCHSVLVEPDKNDPNKLELTAQSPDETALVTTARDMGFSF 794

Query: 612  FKRDRHSISLLHEHSGKTLNYEILQVFPFNSDSKRMGIIVR-----DEQLDEYWFMQKGA 666
              + +    LL E  G    ++IL +  FNS  KRM  IV+     ++       + KGA
Sbjct: 795  IGKTKQG--LLVEVQGIQKEFQILNILEFNSSRKRMSCIVKLPPATEKDEPRALLICKGA 852

Query: 667  DTVMSKIVESNDWLEEET---------GNMAREGLRTLVIGRKKLNKKIYEQFQKEYNDA 717
            D+V+   +       +ET            A EGLRTL +G+++++   Y+++ ++YN A
Sbjct: 853  DSVIYSRLSRKPGYNDETLLEKTALHLEQYATEGLRTLCVGQREISWSEYQEWNEKYNIA 912

Query: 718  SLSMLNRDQQMSQVITKYLEHDLELLGLTGVEDKLQKDVKSSIELLRNAGIKIWMLTGDK 777
            + S+  R++++  V    +E DL LLG T +ED+LQ  V  SI LL  AGIK+W+LTGDK
Sbjct: 913  AASLAGREEELDHV-ADLIERDLVLLGGTAIEDRLQDGVPDSIALLAEAGIKLWVLTGDK 971

Query: 778  VETARCVSISAKLISRGQYVHTITKVTR--------PEGAFNQL--EYL--KINRNA--- 822
            VETA  +  S  L++    +  I             P    N L  +YL  K N      
Sbjct: 972  VETAINIGFSCNLLNTDMELLVIKTTGEDVKEFGDDPTEIVNALVSKYLMEKFNMTGSEE 1031

Query: 823  ----------------CLLIDGESLGMFLKH--YEQEFFDVVVHLPTVIACRCTPQQKAD 864
                             ++IDGE+L + L     +++F  +  +   V+ CR +P QKA 
Sbjct: 1032 ELAAAKKDHSPPQGEFAIIIDGEALKIALTGDTMKRKFLLLCKNCKAVLCCRVSPAQKAA 1091

Query: 865  VALVIRKMTGKRVCCIGDGGNDVSMIQCADVGVGIVGKEGKQASLAADFSITQFCHLTEL 924
            V  +++         IGDG NDV+MIQ ADVGVGI G+EG+QA + +D++I QF ++T L
Sbjct: 1092 VVKLVKDTLDVMTLAIGDGSNDVAMIQSADVGVGIAGEEGRQAVMCSDYAIGQFRYVTRL 1151

Query: 925  LLWHGRNSYKRSAKLAQFVMHRGLIIAICQAVYSICSLFEPIALYQGWLMVGYATCYTMA 984
            +L HG+  YKR A++     ++ +I  +    Y + + F+   L++   +  Y   +T  
Sbjct: 1152 VLVHGKWCYKRLAEMIPQFFYKNVIFTLALFWYGVHNDFDGSYLFEYTYLTFYNLAFTSL 1211

Query: 985  PVFSL-TLDHDIEESLTKIYPELYKELTEGKSLSYKTFFVWVLLSLFQGSVIQLFSQAF- 1042
            PV  L  LD D+  +++ I P+LY+     +  + +T F+W +      SVI  F     
Sbjct: 1212 PVIFLGILDQDVSATVSMIVPQLYRSGILRQEWN-QTKFLWYMFDGIYQSVICYFFPYLI 1270

Query: 1043 --------TSLLDTDFTRMVAISFTALVVNEL-IMVALEIYTWNK-TMLVTEIATLLFY 1091
                     + L  D    V I  T + V      V +E Y W+  T     ++T++++
Sbjct: 1271 YRKTNIITQNGLGLDHRYYVGIPVTGIAVTSCNFYVLMEQYRWDWFTTFFAFLSTIVYF 1329

 Score = 45.4 bits (106), Expect = 3e-04,   Method: Compositional matrix adjust.
 Identities = 29/112 (25%), Positives = 50/112 (44%), Gaps = 5/112 (4%)

Query: 157 IHPDTTPVYDRNRYVSNELSNAKYNAVTFVPTLLYEQFKFFYNLYFLVVALSQAVPALRI 216
           ++ D  P+ +   Y  N++   KY  +TF P  +  QF  F N+YFL++ +  A     +
Sbjct: 158 LYEDGLPIME---YPRNKIRTTKYTPLTFFPKNVMLQFNNFANIYFLIMIILGAFQIFGV 214

Query: 217 GYLSSYIVPLAFVLTVTMAKEAXXXXXXXXXXXESNNELYHVI--TRNRSIP 266
                  VPL  ++ +T  K+A           E NN   H++    N ++P
Sbjct: 215 TNPGLAAVPLIVIIILTAIKDAIEDSRRTLLDMEVNNTRTHILQGPENPNVP 266

>KLLA0E01650g complement(155975..160627) similar to sp|Q12674
            Saccharomyces cerevisiae YMR162c, start by similarity
          Length = 1550

 Score =  221 bits (564), Expect = 1e-58,   Method: Compositional matrix adjust.
 Identities = 139/406 (34%), Positives = 228/406 (56%), Gaps = 18/406 (4%)

Query: 672  KIVESNDWLEEETGN----MAREGLRTLVIGRKKLNKKIYEQFQKEYNDASLSMLNRDQQ 727
            K++++ +++ E+T N     + EGLRTL+   K +  + Y+ ++ +Y++A  S+ NR  Q
Sbjct: 928  KLIKNEEFILEKTLNAIDEFSTEGLRTLLYSYKWIPAEEYKAWEAKYHEAKTSLTNRSTQ 987

Query: 728  MSQVITKYLEHDLELLGLTGVEDKLQKDVKSSIELLRNAGIKIWMLTGDKVETARCVSIS 787
            +++V   ++E DLELLG T +EDKLQ+ V  +I+ +R AGIK+WMLTGDK ETA  +  +
Sbjct: 988  IAEV-GGHIETDLELLGATAIEDKLQEGVPEAIQKIRRAGIKMWMLTGDKRETAINIGYA 1046

Query: 788  AKLISRGQYVHTITK-----VTRPEGAFNQLEYLKINRNACLLIDGESLGMFLKH--YEQ 840
             KLI     V  + K     +++      +L+  KI  +  L+IDG SL +F  +     
Sbjct: 1047 CKLIYDYSTVVILKKNDDNLISKMTALGEELDTGKI-AHCVLVIDGASLAVFENNPTMMS 1105

Query: 841  EFFDVVVHLPTVIACRCTPQQKADVALVIRKMTGKRVC-CIGDGGNDVSMIQCADVGVGI 899
             F ++     +VI CR +P QKA +   IR      V   IGDG ND++MIQ AD+GVGI
Sbjct: 1106 VFIELCTKTDSVICCRASPSQKALIVTNIRLKNKDLVTLAIGDGANDIAMIQSADIGVGI 1165

Query: 900  VGKEGKQASLAADFSITQFCHLTELLLWHGRNSYKRSAKLAQFVMHRGLIIAICQAVYSI 959
             GKEG QAS ++D+SI QF +L +LL  HGR +Y R++K      ++ ++  + Q +Y  
Sbjct: 1166 TGKEGLQASRSSDYSIAQFRYLLKLLFVHGRYNYVRTSKFVLCTFYKEVLFYLTQMIYQR 1225

Query: 960  CSLFEPIALYQGWLMVGYATCYTMAPVFSLTL-DHDIEESLTKIYPELYKELTEGKSLSY 1018
             ++F   +LY+ W +  + T +T  PV  + + + D++       PELY    + ++ + 
Sbjct: 1226 QTMFSGTSLYEPWSLSMFNTLFTSLPVICIGMFEKDLKPMTLLAVPELYTMGQKCQAFNL 1285

Query: 1019 KTFFVWVLLSLFQGSVIQLFS---QAFTSLLDTDFTRMVAISFTAL 1061
            K F VW+L +     +I   +     FT+  D     +  I+FT++
Sbjct: 1286 KIFLVWMLTAAGISVLITFLNFEIWGFTAQSDNSIYPIGVINFTSI 1331

 Score =  129 bits (323), Expect = 9e-30,   Method: Compositional matrix adjust.
 Identities = 114/448 (25%), Positives = 198/448 (44%), Gaps = 92/448 (20%)

Query: 170 YVSNELSNAKYNAVTFVPTLLYEQFKFFYNLYFLVVALSQAVPALRIGYLSSYIVPLAFV 229
           Y  N +++++Y   +F+P  LY QF    N YFL+VA+ Q +P+       + IVPL+  
Sbjct: 116 YRDNVITSSRYTVYSFLPRQLYAQFSKLANAYFLLVAILQMIPSWSTTGTYTTIVPLSIF 175

Query: 230 LTVTMAKEAXXXXXXXXXXXESNNELYHVIT----------------RNRSIPSKDLKVG 273
           L+++MA+EA           E NN+   V+T                 N S  S D  + 
Sbjct: 176 LSISMAREAWDDFKRHRLDKEENNKSTKVLTMGKDHDELESDSIYSLSNVSARSTDAILS 235

Query: 274 DLIKVHKGDRIP--------------------------------ADLVLLQSSE------ 295
           D   +H  + +                                  + VLL S +      
Sbjct: 236 DFNSMHNLNDVTEPSYTDHFTNLNLLRSQFDIHIKKKEWKDLKVGEFVLLNSDDWVPADI 295

Query: 296 -------PSGESFIKTDQLDGETDWKLRVACP-LTQNLSENDLINRISITASA--PEKSI 345
                   + E+F++T  LDGET+ K +   P L + ++    ++  S T +   P   +
Sbjct: 296 LLLSTDGENNEAFVETMALDGETNLKSKNPLPELAKRMTSATGLSMHSATTTLEDPNNDL 355

Query: 346 HKFLGKVTYKDSTSNPLSVDNTLWANTVLASSGFCIACVVYTGRDTRQAMNT-TTAKVKT 404
           + F G V   D    PL  DN ++  ++L ++   +  V++TG +T+  MN     + K 
Sbjct: 356 YNFEGTVEI-DGELYPLGSDNVVYRGSILRNTQSIVGIVIFTGEETKIRMNAIKNPRTKA 414

Query: 405 GLLELEINSISKILCACVFALSILLVAFAGFH---------NDDWYI---------DILR 446
             L+ +IN I   +   V A+++   ++ G H         N  WY+          I+ 
Sbjct: 415 PKLQGKINLIVLFMVFVVAAMAMF--SYLGQHILKKNYVDNNRAWYLFQEDAGTAPTIMS 472

Query: 447 YLILFSTIIPVSLRVNLDLAKSVYAHQIE------HDKTIPETIVRTSTIPEDLGRIEYL 500
           ++I+++T+IP+SL V  ++ K++ +  +E      H ++      RT+TI E+LG++ Y+
Sbjct: 473 FIIMYNTLIPLSLYVTTEIIKAMQSKLMEWDIDMYHIESDTPCESRTATILEELGQVSYI 532

Query: 501 LSDKTGTLTQNDMQLKKIHLGTVSYTSE 528
            SDKTGTLT N M  +K  +   S+  E
Sbjct: 533 FSDKTGTLTDNKMIFRKFSICGSSWLHE 560

 Score = 59.3 bits (142), Expect = 2e-08,   Method: Compositional matrix adjust.
 Identities = 37/119 (31%), Positives = 61/119 (51%), Gaps = 9/119 (7%)

Query: 561 DMSFRVRDMILTLAICHNVTPTFEDD---ELTYQAASPDEIAIVKFTESVGLSLFKRDRH 617
           + S R +  IL+LA+CH   P    D    + YQ++SPDE+A+V     +G  +  R+  
Sbjct: 664 EFSIRAKFFILSLALCHTCLPKKTHDGTDSILYQSSSPDELALVTAARDMGFVVTNRNSS 723

Query: 618 SISLLHEHSG-----KTLNYEILQVFPFNSDSKRMGIIVR-DEQLDEYWFMQKGADTVM 670
           ++S+    +G        +YE+L+   F+S  KRM + V+     D    + KGAD V+
Sbjct: 724 TLSIATYPNGFDDQPIVEDYEVLEYINFDSQRKRMSVAVKMPNDDDRVLLICKGADNVI 782

>CAGL0H04477g 421857..426737 similar to sp|Q12674 Saccharomyces
            cerevisiae YMR162c, start by similarity
          Length = 1626

 Score =  219 bits (559), Expect = 6e-58,   Method: Compositional matrix adjust.
 Identities = 141/396 (35%), Positives = 215/396 (54%), Gaps = 18/396 (4%)

Query: 682  EETGNMAREGLRTLVIGRKKLNKKIYEQFQKEYNDASLSMLNRDQQMSQVITKYLEHDLE 741
            E+  + + EGLRTL+   K ++ + +EQ++  Y++A  S+  R Q++ +V  + +E +L 
Sbjct: 963  EDIESFSTEGLRTLLFAHKWISNEDFEQWRTRYHEAKTSLSERKQKIDEVGAQ-IEDELY 1021

Query: 742  LLGLTGVEDKLQKDVKSSIELLRNAGIKIWMLTGDKVETARCVSISAKLISRGQYVHTIT 801
            LLG T +EDKLQ+ V  +IE +R AGIK+WMLTGDK ETA  +  S KLI    Y   + 
Sbjct: 1022 LLGATAIEDKLQEGVSEAIEKIRRAGIKMWMLTGDKRETAINIGYSCKLIH--DYSTVVI 1079

Query: 802  KVTRPEGAFNQL-----EYLKINRNACLL-IDGESLGMFLKH--YEQEFFDVVVHLPTVI 853
              T  E   +++     E    N   C++ IDG +L MF  +      F ++     +V+
Sbjct: 1080 LTTSDENIISKMNAISQEVDSGNVAHCVIVIDGATLAMFEDNPTLMSVFTELCTKTDSVV 1139

Query: 854  ACRCTPQQKADVALVIRKMTGKRVC--CIGDGGNDVSMIQCADVGVGIVGKEGKQASLAA 911
             CR +P QKA +   IR  T K +    IGDG ND++MIQ AD+GVGI GKEG QAS +A
Sbjct: 1140 CCRASPAQKALMVSNIRN-TDKSIVTLAIGDGANDIAMIQSADIGVGIAGKEGLQASRSA 1198

Query: 912  DFSITQFCHLTELLLWHGRNSYKRSAKLAQFVMHRGLIIAICQAVYSICSLFEPIALYQG 971
            D+SI QF  + +LLL HGR +Y R+AK      ++ L   + Q +Y   ++F   +LY+ 
Sbjct: 1199 DYSIGQFRFILKLLLVHGRYNYIRTAKFILCTFYKELTFYLTQLIYQRYTMFSGTSLYEP 1258

Query: 972  WLMVGYATCYTMAPVFSLTL-DHDIEESLTKIYPELYKELTEGKSLSYKTFFVWVLLSLF 1030
            W +  Y T +T  PV  + + + D++       PELY      K+ ++  F  WV L   
Sbjct: 1259 WSLSMYNTLFTSLPVLCVGMFEKDLKPVTLLTVPELYSMGRLSKAFNWSIFAEWVFLGTA 1318

Query: 1031 QGSVI---QLFSQAFTSLLDTDFTRMVAISFTALVV 1063
               +I    + +   TSL D     +  ++F+A V 
Sbjct: 1319 NALIITFLNIVAWGETSLSDNTLYPLGFVNFSATVA 1354

 Score =  171 bits (433), Expect = 7e-43,   Method: Compositional matrix adjust.
 Identities = 122/450 (27%), Positives = 212/450 (47%), Gaps = 73/450 (16%)

Query: 170 YVSNELSNAKYNAVTFVPTLLYEQFKFFYNLYFLVVALSQAVPALRIGYLSSYIVPLAFV 229
           Y +N +++++Y  ++F P  LY QF    N+YF +VA+ Q +P        + IVPL   
Sbjct: 123 YCNNLITSSRYTIISFFPRQLYAQFSKLANVYFFIVAILQMIPGWSTTGTYTTIVPLCVF 182

Query: 230 LTVTMAKEAXXXXXXXXXXXESNNEL---------------------YHVITRNRSIPS- 267
           + ++MA+EA           E NN+L                      H      SI + 
Sbjct: 183 MAISMAREAYDDYRRHKLDKEENNKLTKVLQILHEREDNDLDLENNAQHSANNPESISNL 242

Query: 268 ---------------------KDLKVGDLIKVHKGDRIPADLVLLQSSEPSGESFIKTDQ 306
                                KD++VGD + + + D +PAD+++L S   + E FI+T  
Sbjct: 243 YFNNFDLLAKKYNVRIVEKKWKDIRVGDFVLLQQDDWVPADILILTSDGDNSEVFIETMA 302

Query: 307 LDGETDWKLRVACPLTQNL--SENDLIN-RISITASAPEKSIHKFLGKVTYKDSTSN--- 360
           LDGET+ K +V  P    L  S + L N    +T   P   ++ F G +     +S+   
Sbjct: 303 LDGETNLKGKVPHPEINKLTKSASGLANINAQVTVEDPNNDLYNFEGNLELNSGSSSKKK 362

Query: 361 -PLSVDNTLWANTVLASSGFCIACVVYTGRDTRQAMNT-TTAKVKTGLLELEINSISKIL 418
            PL  DN ++  +++ ++  C+  V++TG +++  MN     + K   L+ +IN I   +
Sbjct: 363 YPLGPDNVIYRGSIIRNTRNCVGMVIFTGEESKIRMNALRNPRTKAPKLQRKINMIVVFM 422

Query: 419 -----CACVFALSILLVAFAGFHNDD--WYI---------DILRYLILFSTIIPVSLRVN 462
                C  +F+     +    + N++  WY+          I+ ++I+++TIIP+SL V 
Sbjct: 423 VFVVACMSLFSYLGHTIQIKRYVNNNKAWYLLQEDAGTAPTIMSFIIMYNTIIPLSLYVT 482

Query: 463 LDLAKSVYAHQIE------HDKTIPETIVRTSTIPEDLGRIEYLLSDKTGTLTQNDMQLK 516
           ++L K   +  +E      H ++     VRT+TI E+LG++ Y+ SDKTGTLT N M  +
Sbjct: 483 MELIKVAQSRMMEWDIDMYHAESDTPCAVRTATILEELGQVSYIFSDKTGTLTDNKMLFR 542

Query: 517 KIHLGTVSYTSETLDIVSDYVQSLVSSKND 546
           K+     S+       +S++  + +S+KND
Sbjct: 543 KLSFCGTSWVHNATQDISEFKPAQLSNKND 572

 Score = 69.3 bits (168), Expect = 2e-11,   Method: Compositional matrix adjust.
 Identities = 43/118 (36%), Positives = 65/118 (55%), Gaps = 12/118 (10%)

Query: 565 RVRDMILTLAICHNVTPTF------EDDELTYQAASPDEIAIVKFTESVGLSLFKRDRHS 618
           + +  IL+LAICH   P        EDD + YQ++SPDE+A+V     +G  ++ R+ + 
Sbjct: 674 KAKMFILSLAICHICLPKRTEEGNDEDDIIEYQSSSPDELALVTAARDMGYIVYNRNANI 733

Query: 619 ISLLHEHSG-----KTLNYEILQVFPFNSDSKRMGIIVR-DEQLDEYWFMQKGADTVM 670
           ++L     G     +  N+EIL++  FNS  KRM +IVR  E+ D      KGAD V+
Sbjct: 734 LTLKTFPDGFDELPRFENFEILELVDFNSQRKRMSVIVRVPEEKDRVLLFCKGADNVI 791

>Kwal_23.3556
          Length = 1597

 Score =  216 bits (551), Expect = 6e-57,   Method: Compositional matrix adjust.
 Identities = 157/512 (30%), Positives = 261/512 (50%), Gaps = 49/512 (9%)

Query: 647  MGIIVRDEQLDEYWFMQKGADTVMSKIVESNDWLEEET----GNMAREGLRTLVIGRKKL 702
            +G ++ D  ++EY + +         ++++ +++ E T     + +  GLRTL+   K +
Sbjct: 931  LGPLLDDNSIEEYIWSED--------LIQNEEFVLERTLQAIEDFSTSGLRTLLYSYKWI 982

Query: 703  NKKIYEQFQKEYNDASLSMLNRDQQMSQVITKYLEHDLELLGLTGVEDKLQKDVKSSIEL 762
              + YE++ K+Y+ A  S+ NR ++M  V  + +E  L LLG T +EDKLQ+ V  +I+ 
Sbjct: 983  PSEDYEKWSKKYHAAKTSLENRKEKMHSV-GELVETSLHLLGATAIEDKLQEGVADAIDK 1041

Query: 763  LRNAGIKIWMLTGDKVETARCVSISAKLISRGQYVHTITKVTRPEGAFNQL-----EYLK 817
            +R AGIK+WMLTGDK ETA  +  S  LI    Y   +    + E   ++L     E  +
Sbjct: 1042 IRRAGIKMWMLTGDKRETAINIGYSCNLIH--DYSTVVILSAKDENISSKLTAVSQEIER 1099

Query: 818  INRNACLL-IDGESLGMFLKH--YEQEFFDVVVHLPTVIACRCTPQQKADVALVIRKMTG 874
             N   C++ IDG +L  F  +      F ++     +VI CR +P QKA +   IR    
Sbjct: 1100 GNIAHCVVVIDGSTLTTFESNPTLMSVFVELCTKTDSVICCRASPSQKALMVTHIRNTDK 1159

Query: 875  KRVC-CIGDGGNDVSMIQCADVGVGIVGKEGKQASLAADFSITQFCHLTELLLWHGRNSY 933
            K V   IGDG ND++MIQ AD+GVGI GKEG QAS ++D+SI QF  L +LLL HGR +Y
Sbjct: 1160 KLVTLAIGDGANDIAMIQSADIGVGIAGKEGLQASRSSDYSIAQFRFLLKLLLVHGRYNY 1219

Query: 934  KRSAKLAQFVMHRGLIIAICQAVYSICSLFEPIALYQGWLMVGYATCYTMAPVFSLTL-D 992
             R+ K      ++ L+  + Q +Y   ++F   +LY+ W +  + T +T  PV  + + +
Sbjct: 1220 VRTTKFVLCTFYKELLFYLTQMIYQRHTMFSGTSLYEPWSLSMFNTLFTSLPVLCIGMFE 1279

Query: 993  HDIEESLTKIYPELYKELTEGKSLSYKTFFVWVLLSLFQGSVIQLFS---QAFTSLLDTD 1049
             D++       PELY      +S + + F  W+ L+     +I   +    A +SL D  
Sbjct: 1280 KDLKPMTLLAIPELYSIGRLSQSFNLRVFLYWMFLAALNSLIITFLNWKIWAVSSLSDNT 1339

Query: 1050 FTRMVAISFTALVVNELIMVALEIY-TWNKTM-----LVTEIATLLFYIVSVPFL----- 1098
               +  I+FTA++   L+ V  ++  T N+ +     LV  +   L +   +P +     
Sbjct: 1340 VYPIGVINFTAIIT--LVNVKCQLLETHNRNVLAICSLVISVGGWLLWCCLLPGIYSEDG 1397

Query: 1099 ------GDYFDLGYMTTVNYYAGLLVILLISI 1124
                  G YF  G    + ++   LV++++ +
Sbjct: 1398 MYDVLTGLYFQFG--NDITFWCACLVLVVLPL 1427

 Score =  136 bits (343), Expect = 4e-32,   Method: Compositional matrix adjust.
 Identities = 129/529 (24%), Positives = 237/529 (44%), Gaps = 126/529 (23%)

Query: 268 KDLKVGDLIKVHKGDRIPADLVLLQSSEPSGESFIKTDQLDGETDWKLRVACPLTQ---- 323
           KD+KVGD + + + + +PAD+++L  S+   E F++T  LDGET+  L+   PLT+    
Sbjct: 268 KDIKVGDYVVLEQDEWVPADMLVLTCSDEKNECFVETMALDGETN--LKNKQPLTEVSEV 325

Query: 324 -----NLSENDLINRISITASAPEKSIHKFLGKVT-YKDSTSNPLSVDNTLWANTVLASS 377
                 L+E     +  +T   P   +H F G +    ++    +  D+ ++  +++ ++
Sbjct: 326 MKTAAGLTE----FKAKVTVEDPNIDLHNFEGNLELLGENRKLTIGPDHIIYRGSIIRNT 381

Query: 378 GFCIACVVYTGRDTRQAMNT-TTAKVKTGLLELEINSISKILCACVFALSILLVAFAGF- 435
              +  VV+TG +T+  MN     ++K   L+  IN I  +L       S+ L +  G  
Sbjct: 382 SNAVGMVVFTGEETKIRMNAIKNPRIKAPKLQRAINLI--VLFMVFVVASMALFSLLGQR 439

Query: 436 --------HNDDWYI---------DILRYLILFSTIIPVSLRVNLDLAKSVYAHQIE--- 475
                   +N  WY+          ++ ++I+++T+IP+SL V +++ K++ +  +E   
Sbjct: 440 IIKKKYVDNNRAWYLFNSDAGLAPTVMSFIIMYNTLIPLSLYVTMEIIKAMQSKLMEWDI 499

Query: 476 ---HDKTIPETIVRTSTIPEDLGRIEYLLSDKTGTLTQNDMQLKKIHLGTVSYT------ 526
              H +T      RT+TI E+LG++ Y+ SDKTGTLT N M  + + +   S+       
Sbjct: 500 DMYHAETNTPCESRTATILEELGQVSYIFSDKTGTLTDNKMVFRALSVCGSSWIHDFDPA 559

Query: 527 -----------SETLDIVS----DYVQSLVSSKNDSLNNSKV---------ALSTTRKDM 562
                      S T+++VS     ++Q+  ++     +N K          A+ T R  M
Sbjct: 560 AEKLTKSESSDSNTVEVVSVDDRSFLQNFGAADRKVPSNHKTSIDYKGNSSAIYTGRPSM 619

Query: 563 SFRVRD------------------------------------------MILTLAICHNVT 580
           + R+ +                                           IL+LA+CH   
Sbjct: 620 ASRICEEDKNPKKIEPEKSSKTGLRSSTELIRYIQQNPNTHFAKKVSFFILSLALCHACL 679

Query: 581 PTFE-----DDELTYQAASPDEIAIVKFTESVGLSLFKRDRHSISLLHEHSGKTL----- 630
           P        +D + YQA+SPDE+A+V     +G ++  R+   +++    +G        
Sbjct: 680 PKSSSGVEGEDCVEYQASSPDELALVTAARDMGYAVMNRNSDVLTIKTYPNGFDAEPHLD 739

Query: 631 NYEILQVFPFNSDSKRMGIIVR-DEQLDEYWFMQKGADTVMSKIVESND 678
            YEIL    F+S  KRM ++VR   + +    + KGAD V+ + + ++D
Sbjct: 740 KYEILNNIEFSSHRKRMSVLVRLPHEENRILLICKGADNVILERLHNSD 788

 Score = 61.2 bits (147), Expect = 4e-09,   Method: Compositional matrix adjust.
 Identities = 37/146 (25%), Positives = 68/146 (46%)

Query: 170 YVSNELSNAKYNAVTFVPTLLYEQFKFFYNLYFLVVALSQAVPALRIGYLSSYIVPLAFV 229
           Y+SN +++++Y   TF+P  LY QF    N YF +VA+ Q +P        + IVPL   
Sbjct: 108 YISNLITSSRYTIYTFLPRQLYAQFSRLANAYFFLVAVLQMIPGWSTTGTYTTIVPLLIF 167

Query: 230 LTVTMAKEAXXXXXXXXXXXESNNELYHVITRNRSIPSKDLKVGDLIKVHKGDRIPADLV 289
           + ++M++EA           E N++   V+ ++ S  ++  +   L  + +  +      
Sbjct: 168 MGISMSREAWDDFRRHKLDREENDKTARVLVKSSSPHTEFSRPNSLYSLPQWQQSATSTS 227

Query: 290 LLQSSEPSGESFIKTDQLDGETDWKL 315
           +L +      +   T Q D  T+W L
Sbjct: 228 MLTNPTLESTAEAATSQNDDHTNWDL 253

>AFL191W [3004] [Homologous to ScYMR162C (DNF3) - SH]
            complement(79156..83883) [4728 bp, 1575 aa]
          Length = 1575

 Score =  211 bits (536), Expect = 3e-55,   Method: Compositional matrix adjust.
 Identities = 137/388 (35%), Positives = 211/388 (54%), Gaps = 18/388 (4%)

Query: 690  EGLRTLVIGRKKLNKKIYEQFQKEYNDASLSMLNRDQQMSQVITKYLEHDLELLGLTGVE 749
            EGLRTL+   K +  + YE +   Y+ A  +++NR +QM  V  + +E DL LLG  G+E
Sbjct: 951  EGLRTLLYSFKWIGNQEYETWNSRYSAAKAALVNRREQMDTV-GEIIERDLTLLGTIGIE 1009

Query: 750  DKLQKDVKSSIELLRNAGIKIWMLTGDKVETARCVSISAKLISRGQYVHTITKVTRPEGA 809
            DKLQ+ V  +I+ LR AGIK+WMLTGDK ETA  +  S +LI    Y   I      E  
Sbjct: 1010 DKLQEGVPDAIDKLRRAGIKMWMLTGDKRETAINIGYSCRLIH--DYSTVIILAPNDENM 1067

Query: 810  FNQL-----EYLKINRNACLL-IDGESLGMFLKHYE--QEFFDVVVHLPTVIACRCTPQQ 861
             +++     E    N   C++ IDG +L +F  +      F ++     +VI CR +P Q
Sbjct: 1068 ASKITTITQEIEAGNVAHCVVVIDGATLTIFEGNLTLMTLFIELCTKTDSVICCRSSPSQ 1127

Query: 862  KADVALVIRKMTGKRVC-CIGDGGNDVSMIQCADVGVGIVGKEGKQASLAADFSITQFCH 920
            KA +   IRK   K V   IGDG ND++MIQ AD+GV I GKEG QAS ++D+SI QF +
Sbjct: 1128 KALMVTKIRKTDKKLVTLAIGDGANDIAMIQSADIGVDITGKEGLQASRSSDYSIAQFRY 1187

Query: 921  LTELLLWHGRNSYKRSAKLAQFVMHRGLIIAICQAVYSICSLFEPIALYQGWLMVGYATC 980
            L +LLL HGR +Y R++K      ++  +  + Q ++ I ++F   + Y+ W +  + T 
Sbjct: 1188 LLKLLLVHGRYNYIRTSKFVLCTFYKEFVFYLTQLIFQINTMFSGTSQYEPWCLTVFNTL 1247

Query: 981  YTMAPVFSLTL-DHDIEESLTKIYPELYKELTEGKSLSYKTFFVWVLLSLFQGSVIQLFS 1039
            +T  PV  + + + D++       PELY    + ++ +   F  W+ ++    SVI  F+
Sbjct: 1248 FTSLPVLCIGMFEKDLKSVTLLSIPELYTTGRQSQAFNLVIFLRWMAIAAL-SSVIICFT 1306

Query: 1040 Q----AFTSLLDTDFTRMVAISFTALVV 1063
                 + T+  D     +  I++TA+VV
Sbjct: 1307 NWQCWSLTAQSDNTLYPIGLINYTAVVV 1334

 Score =  146 bits (369), Expect = 3e-35,   Method: Compositional matrix adjust.
 Identities = 113/414 (27%), Positives = 201/414 (48%), Gaps = 68/414 (16%)

Query: 170 YVSNELSNAKYNAVTFVPTLLYEQFKFFYNLYFLVVALSQAVPALRIGYLSSYIVPLAFV 229
           Y+ N +++++Y+  +F+P  L  QF    N YF  +A+ Q VP        + IVPL+  
Sbjct: 110 YIGNAITSSRYSVYSFLPRQLCAQFSKVVNSYFFGMAILQMVPNWSTTGQYTTIVPLSIF 169

Query: 230 LTVTMAKEAXXXXXXXXXXXESNNELYHVITR--------NRSIPS-------------- 267
           + +++A+E            E NN+L  V+ +        N+ I +              
Sbjct: 170 MGISIAREGWEDFRRHKLDREENNKLVKVLAQAHDSEFGDNKDISAEARAASFTDFETLQ 229

Query: 268 ------------KDLKVGDLIKVHKGDRIPADLVLLQSSEPSGESFIKTDQLDGETDWKL 315
                       KD++VG+ + +++ D +PADL LL +   + E +++T  LDGET+ K 
Sbjct: 230 ANHGVAVVEKQWKDVEVGEFVLLNQDDWVPADLFLLATDGDNNECYVETMALDGETNLKC 289

Query: 316 RVACP--LTQNLSENDLIN-RISITASAPEKSIHKFLGKVTYKDSTSN----PLSVDNTL 368
           +   P   +Q  + + L   R   T   P   ++ F GK+  +  +       + +DN L
Sbjct: 290 KHVLPKIASQTRTASGLATFRGMTTVEDPNIDLYNFEGKIEVETDSGEQQAYSIGLDNVL 349

Query: 369 WANTVLASSGFCIACVVYTGRDTRQAMNT-TTAKVKTGLLELEINSIS--KILCACVFA- 424
           +  +++ ++   +  VV+TG +T+  MN     ++K+  L+ +IN I    IL   +F+ 
Sbjct: 350 FRGSIIRNTQTVVGMVVFTGEETKIRMNAIKNPRIKSPKLQTQINLIVLFMILVVAIFSF 409

Query: 425 LSILLVAFAGFHNDD------WYI---------DILRYLILFSTIIPVSLRVNLDLAKSV 469
           LS  L  F  F N +      WY+          I+ ++I+++T+IP+SL V +++ K +
Sbjct: 410 LSFGLQRF--FKNREVDSDRAWYLMKVDAGLAPTIMSFIIMYNTLIPLSLYVTMEIIKDM 467

Query: 470 YAHQIEHD------KTIPETIVRTSTIPEDLGRIEYLLSDKTGTLTQNDMQLKK 517
            +  +E D      +T      RT+TI E+LG++ Y+ SDKTGTLT N M  +K
Sbjct: 468 QSRLMEWDIDMYHLETNTGCTSRTATILEELGQVSYIFSDKTGTLTDNRMIFRK 521

 Score = 63.2 bits (152), Expect = 1e-09,   Method: Compositional matrix adjust.
 Identities = 50/185 (27%), Positives = 88/185 (47%), Gaps = 32/185 (17%)

Query: 563 SFRVRDMILTLAICHNVTP-------TFEDDELTYQAASPDEIAIVKFTESVGLSLFKRD 615
           S R +  IL LA+CH   P       + + D + YQ++SPDE+A+V     +G  +  R+
Sbjct: 647 SQRAKFFILALALCHTCLPKKRQGADSGDFDSVEYQSSSPDELALVTAARDMGYVVLNRN 706

Query: 616 RHSISLLHEHSGKTLN-----YEILQVFPFNSDSKRMGIIVRDEQLDE-YWFMQKGADTV 669
              +++     G   +     YE+L    F+SD KRM ++VR  Q  E    + KGAD V
Sbjct: 707 GDELTIKTYPDGFEADCVLEKYEVLNTIDFSSDRKRMSVLVRMHQHPEKVLLICKGADNV 766

Query: 670 MSKIVESNDWLEEETGNMAREGLRTLVIGRKKLNKKIYEQFQKEYNDASLSMLNRDQQMS 729
           + + + ++D                  + ++KLN+      Q++  +A L + +R + + 
Sbjct: 767 ILERLHNSD------------------LAQQKLNEINTSAGQRKIEEAELVLQHR-KSLE 807

Query: 730 QVITK 734
           Q IT+
Sbjct: 808 QAITR 812

>YMR162C (DNF3) [4117] chr13 complement(578950..583920) Member of the
            Drs2p-like family of the P-type ATPase superfamily of
            membrane transporters [4971 bp, 1656 aa]
          Length = 1656

 Score =  209 bits (532), Expect = 1e-54,   Method: Compositional matrix adjust.
 Identities = 147/439 (33%), Positives = 224/439 (51%), Gaps = 27/439 (6%)

Query: 690  EGLRTLVIGRKKLNKKIYEQFQKEYNDASLSMLNRDQQMSQVITKYLEHDLELLGLTGVE 749
            EGLRTLV   K ++   YE + K Y+ A  S+ +R  ++ +   + +E  L LLG+T +E
Sbjct: 1031 EGLRTLVYAYKWIDIGQYENWNKRYHQAKTSLTDRKIKVDEAGAE-IEDGLNLLGVTAIE 1089

Query: 750  DKLQKDVKSSIELLRNAGIKIWMLTGDKVETARCVSISAKLISRGQYVHTITKVTRPEGA 809
            DKLQ  V  +IE +R AGIK+WMLTGDK ETA  +  S  LI    Y   +   T  E  
Sbjct: 1090 DKLQDGVSEAIEKIRRAGIKMWMLTGDKRETAINIGYSCMLIK--DYSTVVILTTTDENI 1147

Query: 810  FNQL-----EYLKINRNACLL-IDGESLGMFLKH--YEQEFFDVVVHLPTVIACRCTPQQ 861
             +++     E    N   C++ IDG ++ MF  +  Y   F ++     +VI CR +P Q
Sbjct: 1148 ISKMNAVSQEVDSGNIAHCVVVIDGATMAMFEGNPTYMSVFVELCTKTDSVICCRASPSQ 1207

Query: 862  KADVALVIRKMTGKRVC-CIGDGGNDVSMIQCADVGVGIVGKEGKQASLAADFSITQFCH 920
            KA +   IR      V   IGDG ND++MIQ AD+GVGI GKEG QAS  +D+SI QF  
Sbjct: 1208 KALMVSNIRNTDPNLVTLAIGDGANDIAMIQSADIGVGIAGKEGLQASRVSDYSIGQFRF 1267

Query: 921  LTELLLWHGRNSYKRSAKLAQFVMHRGLIIAICQAVYSICSLFEPIALYQGWLMVGYATC 980
            L +LL  HGR +Y R++K      ++ +     Q +Y   ++F   +LY+ W +  + T 
Sbjct: 1268 LLKLLFVHGRYNYIRTSKFMLCTFYKEITFYFTQLIYQRYTMFSGSSLYEPWSLSMFNTL 1327

Query: 981  YTMAPVFSLTL-DHDIEESLTKIYPELYKELTEGKSLSYKTFFVWVLLSLFQGSVIQLFS 1039
            +T  PV  + + + D++       PELY      +  ++  F  WV+L+     +I   +
Sbjct: 1328 FTSLPVLCIGMFEKDLKPMTLLTVPELYSYGRLSQGFNWLIFMEWVILATTNSLIITFLN 1387

Query: 1040 ---QAFTSLLDTDFTRMVAISFTALVVNELIMVA---LEIYTWNK---TMLVTEIATLLF 1090
                  +SL D     +  I+FTA+V   LI V    +E++  N    T +V      L 
Sbjct: 1388 VVMWGMSSLSDNTMYPLGLINFTAIVA--LINVKSQFVEMHNRNWLAFTSVVLSCGGWLV 1445

Query: 1091 YIVSVPFLGD---YFDLGY 1106
            +  ++P L +    +D+ Y
Sbjct: 1446 WCCALPILNNTDQIYDVAY 1464

 Score =  119 bits (299), Expect = 6e-27,   Method: Compositional matrix adjust.
 Identities = 85/289 (29%), Positives = 147/289 (50%), Gaps = 35/289 (12%)

Query: 270 LKVGDLIKVHKGDRIPADLVLLQSSEPSGESFIKTDQLDGETDWKLRVACPLTQNLSE-- 327
           L+VGD + + + D +PADL+LL     + E F++T  LDGET+ K +   P    L++  
Sbjct: 302 LRVGDFVLLTQDDWVPADLLLLTCDGENSECFVETMALDGETNLKSKQPHPELNKLTKAA 361

Query: 328 NDLIN-RISITASAPEKSIHKFLGKVTYKDSTSN-----PLSVDNTLWANTVLASSGFCI 381
           + L N    +T   P   ++ F G +  K+  ++     PL  DN ++  ++L ++   +
Sbjct: 362 SGLANINAQVTVEDPNIDLYNFEGNLELKNHRNDTIMKYPLGPDNVIYRGSILRNTQNVV 421

Query: 382 ACVVYTGRDTRQAMNT-TTAKVKTGLLELEINSISKILCACVFALSILLVAFAGF----- 435
             V+++G +T+  MN     + K   L+ +IN I  I+       +I L ++ G      
Sbjct: 422 GMVIFSGEETKIRMNALKNPRTKAPKLQRKINMI--IVFMVFVVATISLFSYLGHVLHKK 479

Query: 436 ----HNDDWYI---------DILRYLILFSTIIPVSLRVNLDLAKSVYAHQIE------H 476
                N  WY+          I+ ++I+++T+IP+SL V +++ K V +  +E      H
Sbjct: 480 KYIDQNKAWYLFQADAGVAPTIMSFIIMYNTVIPLSLYVTMEIIKVVQSKMMEWDIDMYH 539

Query: 477 DKTIPETIVRTSTIPEDLGRIEYLLSDKTGTLTQNDMQLKKIHLGTVSY 525
            +T      RT+TI E+LG++ Y+ SDKTGTLT N M  +K  L   S+
Sbjct: 540 AETNTPCESRTATILEELGQVSYIFSDKTGTLTDNKMIFRKFSLCGSSW 588

 Score = 63.2 bits (152), Expect = 1e-09,   Method: Compositional matrix adjust.
 Identities = 38/120 (31%), Positives = 63/120 (52%), Gaps = 12/120 (10%)

Query: 563 SFRVRDMILTLAICHNVTP------TFEDDELTYQAASPDEIAIVKFTESVGLSLFKRDR 616
           S + +   L+LA+CH+  P      +  +D + YQ++SPDE+A+V     +G  +  R+ 
Sbjct: 725 SQKAKFFFLSLALCHSCLPKKTHNESIGEDSIEYQSSSPDELALVTAARDLGYIVLNRNA 784

Query: 617 HSISLL-----HEHSGKTLNYEILQVFPFNSDSKRMGIIVR-DEQLDEYWFMQKGADTVM 670
             +++       +   K  NYEIL    FNS  KRM ++VR   Q ++   + KGAD V+
Sbjct: 785 QILTIKTFPDGFDGEAKLENYEILNYIDFNSQRKRMSVLVRMPNQPNQVLLICKGADNVI 844

 Score = 55.1 bits (131), Expect = 3e-07,   Method: Compositional matrix adjust.
 Identities = 26/93 (27%), Positives = 46/93 (49%)

Query: 170 YVSNELSNAKYNAVTFVPTLLYEQFKFFYNLYFLVVALSQAVPALRIGYLSSYIVPLAFV 229
           Y  N +++++Y   +F+P  LY QF    N YF +VA+ Q +P        + I+PL   
Sbjct: 138 YCDNRITSSRYTFYSFLPRQLYAQFSKLANTYFFIVAVLQMIPGWSTTGTYTTIIPLCVF 197

Query: 230 LTVTMAKEAXXXXXXXXXXXESNNELYHVITRN 262
           + ++M +EA           E NN+   V+ ++
Sbjct: 198 MGISMTREAWDDFRRHRLDKEENNKPVGVLVKD 230

>Scas_669.3
          Length = 1638

 Score =  201 bits (510), Expect = 5e-52,   Method: Compositional matrix adjust.
 Identities = 146/427 (34%), Positives = 223/427 (52%), Gaps = 22/427 (5%)

Query: 690  EGLRTLVIGRKKLNKKIYEQFQKEYNDASLSMLNRDQQMSQVITKYLEHDLELLGLTGVE 749
            EGLRTLV   K ++ + Y+Q++  Y+DA +S+ NR  ++++V  + +E DL+LLG T +E
Sbjct: 1005 EGLRTLVYSYKWVDLQEYQQWEDRYHDAKISLTNRKSKIAEV-GEEIEQDLQLLGATAIE 1063

Query: 750  DKLQKDVKSSIELLRNAGIKIWMLTGDKVETARCVSISAKLISRGQYVHTITK----VTR 805
            DKLQ+ V  +IE +R AGIKIWMLTGDK ETA  +  S KLI     V  + K    +  
Sbjct: 1064 DKLQEGVSEAIEKIRRAGIKIWMLTGDKRETAINIGYSCKLIYDYSTVVILAKGDENIIS 1123

Query: 806  PEGAFNQLEYLKINRNAC-LLIDGESLGMFLKH--YEQEFFDVVVHLPTVIACRCTPQQK 862
               A +Q E    N   C ++IDG +L MF  +      F ++     +VI CR +P QK
Sbjct: 1124 KMNAISQ-EVDSGNVAHCVIIIDGSTLAMFEGNPTLMSVFIELCTKTDSVICCRASPSQK 1182

Query: 863  ADVALVIRKMTGKRVC-CIGDGGNDVSMIQCADVGVGIVGKEGKQASLAADFSITQFCHL 921
            + +   IR      V   IGDG ND++MIQ AD+G+GI GKEG QAS  AD+SI QF  +
Sbjct: 1183 SLMVTNIRNSNKNLVTLAIGDGANDIAMIQSADIGIGIGGKEGLQASRTADYSIAQFRFI 1242

Query: 922  TELLLWHGRNSYKRSAKLAQFVMHRGLIIAICQAVYSICSLFEPIALYQGWLMVGYATCY 981
             +LLL HGR +Y R+AK       + +   + Q ++   ++F   +LY+ W +  + T +
Sbjct: 1243 LKLLLVHGRYNYIRTAKFILCTFFKEITFYLTQLIFQRYTMFSGSSLYEPWSLSMFNTLF 1302

Query: 982  TMAPVFSLTL-DHDIEESLTKIYPELYKELTEGKSLSYKTFFVWVLLSLFQGSVIQLFS- 1039
            T  PV  + + + D++       PELY      +  +   F  WV+ +     +I   + 
Sbjct: 1303 TSLPVLCIGMFEKDLKPMTLLTIPELYSMGRLSQGFNLIIFGEWVIQAAAYALLITFLNI 1362

Query: 1040 --QAFTSLLDTDFTRMVAISFTALVVNELIMVALEIYTWNK------TMLVTEIATLLFY 1091
                 T+L D     +  I+FTA+V   L+ V  +    N       T ++      L +
Sbjct: 1363 IIWGETALSDHTMYPLGVINFTAIVA--LVNVKCQFIEMNNRNWVVFTSVILSCGGWLVW 1420

Query: 1092 IVSVPFL 1098
              ++P L
Sbjct: 1421 CCALPIL 1427

 Score =  157 bits (398), Expect = 1e-38,   Method: Compositional matrix adjust.
 Identities = 119/441 (26%), Positives = 202/441 (45%), Gaps = 83/441 (18%)

Query: 170 YVSNELSNAKYNAVTFVPTLLYEQFKFFYNLYFLVVALSQAVPALRIGYLSSYIVPLAFV 229
           Y +N +++++Y   +F P  LY QF    N+YF VVA+ Q +P        + IVPL   
Sbjct: 140 YCNNNITSSRYTIYSFFPKQLYAQFSKVANVYFFVVAILQMIPGWSTTGTYTTIVPLCIF 199

Query: 230 LTVTMAKEAXXXXXXXXXXXESNNELYHVITRNRS---------IPSK------------ 268
           + ++MA+EA           E NN+   ++T+  S         +PS+            
Sbjct: 200 MGISMAREAWDDFRRHRLDKEENNKTCSILTKEFSNKPMPDDAQLPSRQNIDNLSNDSNT 259

Query: 269 ---------------------------DLKVGDLIKVHKGDRIPADLVLLQSSEPSGESF 301
                                      +L VGD + + + + +PAD+++L S   + E F
Sbjct: 260 DYLNTKFNNFPFLEERHGVRIQETTWSNLHVGDFVLLKQDNWVPADILVLTSDGDNNECF 319

Query: 302 IKTDQLDGETDWKLRVACPLTQNL--SENDLIN-RISITASAPEKSIHKFLGKVTYKDST 358
           ++T  LDGET+ K++   P    L  S + L N    IT   P   ++ F G +   D+ 
Sbjct: 320 VETMALDGETNLKVKQPHPELNKLACSASGLANINALITVEDPNSDLYNFEGNLELTDNN 379

Query: 359 SN-----PLSVDNTLWANTVLASSGFCIACVVYTGRDTRQAMNT-TTAKVKTGLLELEIN 412
           +N     P+  DN  +  +++ ++   I  V+YTG++T+  MN     + K   L+  IN
Sbjct: 380 NNSLKKYPVGPDNVAYRGSIIRNTDNVIGMVIYTGKETKIRMNALNNPRTKAPKLQKNIN 439

Query: 413 SISKILCACVFALSILLVAFAGF---------HNDDWYI---------DILRYLILFSTI 454
            I   +   V  +S  L ++ G           N  WY+          I+ ++I+++TI
Sbjct: 440 IIITFMVFVVAVIS--LFSYLGHVLQNKKAIDENQAWYLLTKDAGAAPTIMSFIIMYNTI 497

Query: 455 IPVSLRVNLDLAKSVYAHQIE------HDKTIPETIVRTSTIPEDLGRIEYLLSDKTGTL 508
           IP+SL V +++ K++ +  +E      H +T      RT+TI E+LG++ Y+ SDKTGTL
Sbjct: 498 IPLSLYVTMEIIKAMQSKMMEWDIDMYHSETNTPCESRTATILEELGQVSYMFSDKTGTL 557

Query: 509 TQNDMQLKKIHLGTVSYTSET 529
           T N M  +K  +   S+   T
Sbjct: 558 TDNKMIFRKFSICGSSWLHST 578

 Score = 54.3 bits (129), Expect = 5e-07,   Method: Compositional matrix adjust.
 Identities = 45/175 (25%), Positives = 85/175 (48%), Gaps = 19/175 (10%)

Query: 565 RVRDMILTLAICHNVTPTFE------DDELTYQAASPDEIAIVKFTESVGLSLFKRDRHS 618
           + +  IL+LA+CH   P         +D + YQ++SPDE+A+V     +G  +  ++   
Sbjct: 698 KAKFFILSLALCHTCLPKKSNFPEGGEDVIEYQSSSPDELALVTAARDLGYVVLNKNADV 757

Query: 619 ISLL-----HEHSGKTLNYEILQVFPFNSDSKRMGIIVR-DEQLDEYWFMQKGADTVMSK 672
           +++       E+     +Y+IL    FNS  KRM ++V+  ++ ++   + KGAD ++ +
Sbjct: 758 LTIKTYPDGFENEPIFEDYQILNYIDFNSQRKRMSVLVKTPDEPNKVLLICKGADNMILE 817

Query: 673 IVESNDWLEEETGNMAR------EGLRTLVI-GRKKLNKKIYEQFQKEYNDASLS 720
            ++  D   ++  ++ R      E    LVI  RK L +  Y+   +     SLS
Sbjct: 818 RLQDRDLAYQKMEDINRNTRERKELEAGLVIEQRKSLERMAYDDVPRNSFKTSLS 872

>Scas_505.4
          Length = 1025

 Score =  137 bits (345), Expect = 1e-32,   Method: Compositional matrix adjust.
 Identities = 87/294 (29%), Positives = 146/294 (49%), Gaps = 18/294 (6%)

Query: 823  CLLIDGESLGMFLKHYEQEFFDVVVHL----PTVIACRCTPQQKADVALVIRKMTGKRVC 878
             L+IDG+SL   L   E +  D ++ L      V+ CR +P QKA V  ++++ T   + 
Sbjct: 559  ALVIDGKSLSYAL---ESDLEDYLLALGKICKAVVCCRVSPLQKALVVKMVKRKTSSLLL 615

Query: 879  CIGDGGNDVSMIQCADVGVGIVGKEGKQASLAADFSITQFCHLTELLLWHGRNSYKRSAK 938
             IGDG NDVSMIQ A VGVGI G EG QA+ +AD ++ QF  L +LLL HG  SY+R + 
Sbjct: 616  AIGDGANDVSMIQAAHVGVGISGMEGMQAARSADIAVGQFRFLKKLLLVHGSWSYQRISV 675

Query: 939  LAQFVMHRGLIIAICQAVYSICSLFEPIALYQGWLMVGYATCYTMAPVFSL-TLDHDIEE 997
               +  ++   + + Q  +   + F   ++ + W M  Y   +T+ P F +   D  +  
Sbjct: 676  AILYSFYKNTALYMTQFWFVFANAFSGQSIMESWTMSYYNVFFTVFPPFVIGVFDQFVSS 735

Query: 998  SLTKIYPELYKELTEGKSLSYKTFFVWVLLSLFQGSVIQLFSQAFTSL---------LDT 1048
             L + YP+LYK   +GK  S + F+ W++   +  +V+ + +  F            +  
Sbjct: 736  RLLERYPQLYKLGQQGKFFSVRIFWGWIVNGFYHSAVVYIGTMLFYRYGMALNMHGEVAD 795

Query: 1049 DFTRMVAISFTALVVNELIMVALEIYTWNKTMLVTEIATLLFYIVSVPFLGDYF 1102
             ++  +A+ +T+ ++  L   AL    W K  L     + +F+++  P     F
Sbjct: 796  HWSWGIAV-YTSSILIVLGKAALVTNQWTKFTLFAIPGSFIFWMIFFPIYASVF 848

 Score =  123 bits (309), Expect = 3e-28,   Method: Compositional matrix adjust.
 Identities = 83/295 (28%), Positives = 141/295 (47%), Gaps = 11/295 (3%)

Query: 149 SDQHIEREIHPDTTPVYDRNRYVSNELSNAKYNAVTFVPTLLYEQFKFFYNLYFLVVALS 208
           SD    REI+ +         Y  N +S  KYN  TF+P  L+++F  + NL+FL  A  
Sbjct: 216 SDDGTPREIYLNDRTANHAFNYGDNHISTTKYNIATFLPKFLFQEFSKYANLFFLCTAAI 275

Query: 209 QAVPALRIGYLSSYIVPLAFVLTVTMAKEAXXXXXXXXXXXESNNELYHVITRNRS--IP 266
           Q VP +      + +  L  VL V+  KE+           E NN    + +      I 
Sbjct: 276 QQVPHVSPTNRYTTVGTLMVVLIVSAFKESIEDIKRANSDKELNNSKTEIYSEENGDFIE 335

Query: 267 SK--DLKVGDLIKVHKGDRIPADLVLLQSSEPSGESFIKTDQLDGETDWKLRVACPLTQN 324
            +  D++ GD+I+V   + IPADL+++ SSEP G  +I+T  LDGET+ K++ A P T  
Sbjct: 336 RRWIDIRAGDVIRVKSEEAIPADLIVISSSEPEGLCYIETANLDGETNLKIKQARPETAE 395

Query: 325 LSENDLINRI--SITASAPEKSIHKFLGKVTYKDSTSNPLSVDNTLWANTVLASSGFCIA 382
           + ++  +N     + +  P  S++ + G + + +    PLS +  +     L ++ +   
Sbjct: 396 MMDSRKLNNFKGKVISEQPNSSLYTYEGTLEFNNRKI-PLSPEQMILRGATLRNTSWMFG 454

Query: 383 CVVYTGRDTRQAMNTTTAKVKTGLLELEINSISKILCACVFALSILLVAFAGFHN 437
            V++TG +T+   N T   +K   +E  IN    +    +F + I+LV  +   N
Sbjct: 455 LVIFTGHETKLMRNATATPIKRTAVERVIN----LQIVALFGVLIVLVLISSLGN 505

>YDR040C (ENA1) [893] chr4 complement(535187..538462) P-type ATPase
           involved in Na+ and Li+ efflux, required for Na+
           tolerance [3276 bp, 1091 aa]
          Length = 1091

 Score =  110 bits (274), Expect = 4e-24,   Method: Compositional matrix adjust.
 Identities = 192/763 (25%), Positives = 316/763 (41%), Gaps = 116/763 (15%)

Query: 257 HVITRNRS--IPSKDLKVGDLIKVHKGDRIPADLVLLQSSE-PSGESFIKTDQLDGETDW 313
           HVI   +S  I SKD+  GD+  V  GD IPADL L+++    + ES +  + L    D 
Sbjct: 131 HVIRNGKSETINSKDVVPGDICLVKVGDTIPADLRLIETKNFDTDESLLTGESLPVSKDA 190

Query: 314 KLRVACPLTQNLSENDLINRISITASAPEKSIHKFLGKVTYKDSTSNPLSVDNTLWANTV 373
            L       +  S  D +N ++ ++SA  K   K  G V      S    +  +L  ++ 
Sbjct: 191 NLVFG--KEEETSVGDRLN-LAFSSSAVVKGRAK--GIVIKTALNSEIGKIAKSLQGDSG 245

Query: 374 LASSGFCIACVVYTGRDTRQAMNTTTAKVKTGLLELEINSISKILCACVFALSILLVAFA 433
           L S     + +  T   T++             L  +++ ++ +L       +I+++A  
Sbjct: 246 LISRDPSKSWLQNTWISTKKVTGAFLGTNVGTPLHRKLSKLAVLLFWIAVLFAIIVMASQ 305

Query: 434 GFHNDDWYIDILRYLILFS-TIIPVSLRVNLDLAKSVYAHQIEHDKTIPETIVRTSTIPE 492
            F  D     +  Y I  + ++IP SL V L +  SV A  +         IVR     E
Sbjct: 306 KFDVDK---RVAIYAICVALSMIPSSLVVVLTITMSVGAAVM----VSRNVIVRKLDSLE 358

Query: 493 DLGRIEYLLSDKTGTLTQNDMQLKKI---HLGTVSYTSE---------TLDIVSDYVQSL 540
            LG +  + SDKTGTLTQ  M  ++I     GT++ ++           + ++  +    
Sbjct: 359 ALGAVNDICSDKTGTLTQGKMLARQIWIPRFGTITISNSDDPFNPNEGNVSLIPRFSPYE 418

Query: 541 VSSKNDS----LNNSKVAL--STTRKDMSFRVRDMILTLAICHNVTPTFEDDELTYQAA- 593
            S   D     L N K  L      +D+   +    L  A   N+   F+DD      A 
Sbjct: 419 YSHNEDGDVGILQNFKDRLYEKDLPEDIDMDLFQKWLETATLANIATVFKDDATDCWKAH 478

Query: 594 -SPDEIAIVKFTESVGL---------SLFKRDRHSISLLHEHSGK--TLNYEILQVFPFN 641
             P EIAI  F   + L         S  + + +  S L +H+ K  +  +E +  FPF+
Sbjct: 479 GDPTEIAIQVFATKMDLPHNALTGEKSTNQSNENDQSSLSQHNEKPGSAQFEHIAEFPFD 538

Query: 642 SDSKRMGIIVRDEQLDEYWFMQKGA-DTVMS-----------KIVESNDW----LEEETG 685
           S  KRM  +  +   + Y    KGA ++++S           KI    D     + +   
Sbjct: 539 STVKRMSSVYYNNHNETYNIYGKGAFESIISCCSSWYGKDGVKITPLTDCDVETIRKNVY 598

Query: 686 NMAREGLRTLVIGRKKLNKKIYEQFQKEYNDASLSMLNRDQQMSQVITKYLEHDLELLGL 745
           +++ EGLR L    K   K        + ND  L  +  ++  +       E DL  LGL
Sbjct: 599 SLSNEGLRVLGFASKSFTKD-------QVNDDQLKNITSNRATA-------ESDLVFLGL 644

Query: 746 TGVEDKLQKDVKSSIELLRNAGIKIWMLTGDKVETARCVSISAKLISRGQYVHTITKVTR 805
            G+ D  + +   +++    AGI + MLTGD V TA+ ++    ++    Y ++   V  
Sbjct: 645 IGIYDPPRNETAGAVKKFHQAGINVHMLTGDFVGTAKAIAQEVGILPTNLYHYSQEIVDS 704

Query: 806 PEGAFNQLEYLKINRNACLLIDGESLGMFLKHYEQEFFDVVVHLPTVIACRCTPQQKADV 865
                +Q + L                      E+E  D+ V LP VIA RC+PQ K  +
Sbjct: 705 MVMTGSQFDGLS---------------------EEEVDDLPV-LPLVIA-RCSPQTKVRM 741

Query: 866 ALVIRKMTGKRVCCI-GDGGNDVSMIQCADVGV--GIVGKE-GKQAS--LAADFSITQFC 919
              + +   K+ C + GDG ND   ++ A+VG+  GI G +  K+AS  + +D +     
Sbjct: 742 IEALHRR--KKFCTMTGDGVNDSPSLKMANVGIAMGINGSDVSKEASDIVLSDDNFASIL 799

Query: 920 HLTELLLWHGRNSYKRSAKLAQFVMHRGLIIAICQAVYSICSL 962
           +  E     GR   + +  + +FV+   L   + QA+Y I  L
Sbjct: 800 NAVE----EGR---RMTDNIQKFVLQL-LAENVAQALYLIIGL 834

>YDR039C (ENA2) [892] chr4 complement(531302..534577) Member of the
           Na[+]-transporting ATPases family in the superfamily of
           P-type ATPases [3276 bp, 1091 aa]
          Length = 1091

 Score =  110 bits (274), Expect = 4e-24,   Method: Compositional matrix adjust.
 Identities = 202/825 (24%), Positives = 340/825 (41%), Gaps = 123/825 (14%)

Query: 199 NLYFLVVALSQAVP-ALR---IGYLSSYIVPLAFVLTVTMAKEAXXXXXXXXXXXESNNE 254
           N   +V+ +S A+  A+R    G + S+++ +  ++ +    +A             N  
Sbjct: 72  NAMIMVLVISMAISFAVRDWITGGVISFVIAVNVLIGLVQEYKATKTMNSLKNLSSPN-- 129

Query: 255 LYHVITRNRS--IPSKDLKVGDLIKVHKGDRIPADLVLLQSSE-PSGESFIKTDQLDGET 311
             HVI   +S  I SKD+  GD+  V  GD IPADL L+++    + ES +  + L    
Sbjct: 130 -AHVIRNGKSETINSKDVVPGDICLVKVGDTIPADLRLIETKNFDTDESLLTGESLPVSK 188

Query: 312 DWKLRVACPLTQNLSENDLINRISITASAPEKSIHKFLGKVTYKDSTSNPLSVDNTLWAN 371
           D  L       +  S  D +N ++ ++SA  K   K  G V      S    +  +L  +
Sbjct: 189 DANLVFG--KEEETSVGDRLN-LAFSSSAVVKGRAK--GIVIKTALNSEIGKIAKSLQGD 243

Query: 372 TVLASSGFCIACVVYTGRDTRQAMNTTTAKVKTGLLELEINSISKILCACVFALSILLVA 431
           + L S     + +  T   T++             L  +++ ++ +L       +I+++A
Sbjct: 244 SGLISRDPSKSWLQNTWISTKKVTGAFLGTNVGTPLHRKLSKLAVLLFWIAVLFAIIVMA 303

Query: 432 FAGFHNDDWYIDILRYLILFS-TIIPVSLRVNLDLAKSVYAHQIEHDKTIPETIVRTSTI 490
              F  D     +  Y I  + ++IP SL V L +  SV A  +         IVR    
Sbjct: 304 SQKFDVDK---RVAIYAICVALSMIPSSLVVVLTITMSVGAAVM----VSRNVIVRKLDS 356

Query: 491 PEDLGRIEYLLSDKTGTLTQNDMQLKKI---HLGTVSYTSE---------TLDIVSDYVQ 538
            E LG +  + SDKTGTLTQ  M  ++I     GT++ ++           + ++  +  
Sbjct: 357 LEALGAVNDICSDKTGTLTQGKMLARQIWIPRFGTITISNSDDPFNPNEGNVSLIPRFSP 416

Query: 539 SLVSSKNDS----LNNSKVAL--STTRKDMSFRVRDMILTLAICHNVTPTFEDDELTYQA 592
              S   D     L N K  L      +D+   +    L  A   N+   F+DD      
Sbjct: 417 YEYSHNEDGDVGILQNFKDRLYEKDLPEDIDMDLFQKWLETATLANIATVFKDDATDCWK 476

Query: 593 A--SPDEIAIVKFTESVGL---------SLFKRDRHSISLLHEHSGK--TLNYEILQVFP 639
           A   P EIAI  F   + L         S  + + +  S L +H+ K  +  +E +  FP
Sbjct: 477 AHGDPTEIAIQVFATKMDLPHNALTGEKSTNQSNENDQSSLSQHNEKPGSAQFEHIAEFP 536

Query: 640 FNSDSKRMGIIVRDEQLDEYWFMQKGA-DTVMS-----------KIVESNDW----LEEE 683
           F+S  KRM  +  +   + Y    KGA ++++S           KI    D     + + 
Sbjct: 537 FDSTVKRMSSVYYNNHNETYNIYGKGAFESIISCCSSWYGKDGVKITPLTDCDVETIRKN 596

Query: 684 TGNMAREGLRTLVIGRKKLNKKIYEQFQKEYNDASLSMLNRDQQMSQVITKYLEHDLELL 743
             +++ EGLR L    K   K        + ND  L  +  ++  +       E DL  L
Sbjct: 597 VYSLSNEGLRVLGFASKSFTKD-------QVNDDQLKNITSNRATA-------ESDLVFL 642

Query: 744 GLTGVEDKLQKDVKSSIELLRNAGIKIWMLTGDKVETARCVSISAKLISRGQYVHTITKV 803
           GL G+ D  + +   +++    AGI + MLTGD V TA+ ++    ++    Y ++   V
Sbjct: 643 GLIGIYDPPRNETAGAVKKFHQAGINVHMLTGDFVGTAKAIAQEVGILPTNLYHYSQEIV 702

Query: 804 TRPEGAFNQLEYLKINRNACLLIDGESLGMFLKHYEQEFFDVVVHLPTVIACRCTPQQKA 863
                  +Q + L                      E+E  D+ V LP VIA RC+PQ K 
Sbjct: 703 DSMVMTGSQFDGLS---------------------EEEVDDLPV-LPLVIA-RCSPQTKV 739

Query: 864 DVALVIRKMTGKRVCCI-GDGGNDVSMIQCADVGV--GIVGKE-GKQAS--LAADFSITQ 917
            +   + +   K+ C + GDG ND   ++ A+VG+  GI G +  K+AS  + +D +   
Sbjct: 740 RMIEALHRR--KKFCAMTGDGVNDSPSLKMANVGIAMGINGSDVSKEASDIVLSDDNFAS 797

Query: 918 FCHLTELLLWHGRNSYKRSAKLAQFVMHRGLIIAICQAVYSICSL 962
             +  E     GR   + +  + +FV+   L   + QA+Y I  L
Sbjct: 798 ILNAVE----EGR---RMTDNIQKFVLQL-LAENVAQALYLIIGL 834

>YDR038C (ENA5) [891] chr4 complement(527417..530692) Member of the
           Na[+]-transporting ATPases family in the superfamily of
           P-type ATPases [3276 bp, 1091 aa]
          Length = 1091

 Score =  110 bits (274), Expect = 5e-24,   Method: Compositional matrix adjust.
 Identities = 202/825 (24%), Positives = 340/825 (41%), Gaps = 123/825 (14%)

Query: 199 NLYFLVVALSQAVP-ALR---IGYLSSYIVPLAFVLTVTMAKEAXXXXXXXXXXXESNNE 254
           N   +V+ +S A+  A+R    G + S+++ +  ++ +    +A             N  
Sbjct: 72  NAMIMVLVISMAISFAVRDWITGGVISFVIAVNVLIGLVQEYKATKTMNSLKNLSSPN-- 129

Query: 255 LYHVITRNRS--IPSKDLKVGDLIKVHKGDRIPADLVLLQSSE-PSGESFIKTDQLDGET 311
             HVI   +S  I SKD+  GD+  V  GD IPADL L+++    + ES +  + L    
Sbjct: 130 -AHVIRNGKSETINSKDVVPGDICLVKVGDTIPADLRLIETKNFDTDESLLTGESLPVSK 188

Query: 312 DWKLRVACPLTQNLSENDLINRISITASAPEKSIHKFLGKVTYKDSTSNPLSVDNTLWAN 371
           D  L       +  S  D +N ++ ++SA  K   K  G V      S    +  +L  +
Sbjct: 189 DANLVFG--KEEETSVGDRLN-LAFSSSAVVKGRAK--GIVIKTALNSEIGKIAKSLQGD 243

Query: 372 TVLASSGFCIACVVYTGRDTRQAMNTTTAKVKTGLLELEINSISKILCACVFALSILLVA 431
           + L S     + +  T   T++             L  +++ ++ +L       +I+++A
Sbjct: 244 SGLISRDPSKSWLQNTWISTKKVTGAFLGTNVGTPLHRKLSKLAVLLFWIAVLFAIIVMA 303

Query: 432 FAGFHNDDWYIDILRYLILFS-TIIPVSLRVNLDLAKSVYAHQIEHDKTIPETIVRTSTI 490
              F  D     +  Y I  + ++IP SL V L +  SV A  +         IVR    
Sbjct: 304 SQKFDVDK---RVAIYAICVALSMIPSSLVVVLTITMSVGAAVM----VSRNVIVRKLDS 356

Query: 491 PEDLGRIEYLLSDKTGTLTQNDMQLKKI---HLGTVSYTSE---------TLDIVSDYVQ 538
            E LG +  + SDKTGTLTQ  M  ++I     GT++ ++           + ++  +  
Sbjct: 357 LEALGAVNDICSDKTGTLTQGKMLARQIWIPRFGTITISNSDDPFNPNEGNVSLIPRFSP 416

Query: 539 SLVSSKNDS----LNNSKVAL--STTRKDMSFRVRDMILTLAICHNVTPTFEDDELTYQA 592
              S   D     L N K  L      +D+   +    L  A   N+   F+DD      
Sbjct: 417 YEYSHNEDGDVGILQNFKDRLYEKDLPEDIDMDLFQKWLETATLANIATVFKDDATDCWK 476

Query: 593 A--SPDEIAIVKFTESVGL---------SLFKRDRHSISLLHEHSGK--TLNYEILQVFP 639
           A   P EIAI  F   + L         S  + + +  S L +H+ K  +  +E +  FP
Sbjct: 477 AHGDPTEIAIQVFATKMDLPHNALTGEKSTNQSNENDQSSLSQHNEKPGSAQFEHIAEFP 536

Query: 640 FNSDSKRMGIIVRDEQLDEYWFMQKGA-DTVMS-----------KIVESNDW----LEEE 683
           F+S  KRM  +  +   + Y    KGA ++++S           KI    D     + + 
Sbjct: 537 FDSTVKRMSSVYYNNHNETYNIYGKGAFESIISCCSSWYGKDGVKITPLTDCDVETIRKN 596

Query: 684 TGNMAREGLRTLVIGRKKLNKKIYEQFQKEYNDASLSMLNRDQQMSQVITKYLEHDLELL 743
             +++ EGLR L    K   K        + ND  L  +  ++  +       E DL  L
Sbjct: 597 VYSLSNEGLRVLGFASKSFTKD-------QVNDDQLKNITSNRATA-------ESDLVFL 642

Query: 744 GLTGVEDKLQKDVKSSIELLRNAGIKIWMLTGDKVETARCVSISAKLISRGQYVHTITKV 803
           GL G+ D  + +   +++    AGI + MLTGD V TA+ ++    ++    Y ++   V
Sbjct: 643 GLIGIYDPPRNETAGAVKKFHQAGINVHMLTGDFVGTAKAIAQEVGILPTNLYHYSQEIV 702

Query: 804 TRPEGAFNQLEYLKINRNACLLIDGESLGMFLKHYEQEFFDVVVHLPTVIACRCTPQQKA 863
                  +Q + L                      E+E  D+ V LP VIA RC+PQ K 
Sbjct: 703 DSMVMTGSQFDGLS---------------------EEEVDDLPV-LPLVIA-RCSPQTKV 739

Query: 864 DVALVIRKMTGKRVCCI-GDGGNDVSMIQCADVGV--GIVGKE-GKQAS--LAADFSITQ 917
            +   + +   K+ C + GDG ND   ++ A+VG+  GI G +  K+AS  + +D +   
Sbjct: 740 RMIEALHRR--KKFCAMTGDGVNDSPSLKMANVGIAMGINGSDVSKEASDIVLSDDNFAS 797

Query: 918 FCHLTELLLWHGRNSYKRSAKLAQFVMHRGLIIAICQAVYSICSL 962
             +  E     GR   + +  + +FV+   L   + QA+Y I  L
Sbjct: 798 ILNAVE----EGR---RMTDNIQKFVLQL-LAENVAQALYLIIGL 834

>KLLA0B08217g complement(724364..728683) similar to sp|Q12697
            Saccharomyces cerevisiae YOR291w, start by similarity
          Length = 1439

 Score =  106 bits (264), Expect = 8e-23,   Method: Compositional matrix adjust.
 Identities = 169/776 (21%), Positives = 308/776 (39%), Gaps = 138/776 (17%)

Query: 265  IPSKDLKVGDLIKVHKGDRI--PADLVLLQSSEPSGESFIKTDQLDGETDWKLRVACPLT 322
            + S DL  GDL ++     +  P D VL+     SG+  +    L GE+        P++
Sbjct: 551  VNSSDLVPGDLFEISDPSLVVLPCDAVLI-----SGDCIVNESMLTGES-------VPVS 598

Query: 323  QNLSENDLINRISITASAPEKSIHKFLGKVTYKDSTSNPLSVDNTLWANTVL------AS 376
            +               +A E ++ + L    +K S  +     + L+  T +        
Sbjct: 599  K--------------YAATEATMAQLLQD--FKSSQVSSFVSKSFLFNGTKIIRVRNQPG 642

Query: 377  SGFCIACVVYTGRDTRQAMNTTT----AKVKTGLLELEINSISKILCACVFALSILLVAF 432
             G  +A V+ TG  T +     +      V     E     I  +    +F  SI  + F
Sbjct: 643  QGMALALVIRTGFSTTKGSLVRSMVFPKPVGFKFYEDSFKYIGFMTLIAMFGFSISCIQF 702

Query: 433  AGFHNDDWYIDILRYLILFSTIIPVSLRVNLDLAKSVYAHQIEHDKTIPETIVRTSTIPE 492
                  ++ + ILR L + + ++P +L   L +  S    +++       +  R +    
Sbjct: 703  IRL-GLEYKVMILRALDIITIVVPPALPATLTIGTSFALGRLKKKGIFCISPTRVNV--- 758

Query: 493  DLGRIEYLLSDKTGTLTQNDMQLKKIHLGTVSYTSETLDIVSDYVQSLVSSKNDSLNNSK 552
              G+++ +  DKTGTLT+  + +  IH      +S  L +       L++  ++ L   K
Sbjct: 759  -GGKVDMMCFDKTGTLTEEGLDVLGIHFAKPEGSSTILQL-----SDLITDCDEVLQ--K 810

Query: 553  VALSTTRKDMSFRVRDMILTLAICHNVTPTFEDDELTYQAASPDEIAIVKFTESV---GL 609
              LS       F+ ++ +++L  CH++     D EL      P ++ + +FT+     G 
Sbjct: 811  HTLSDCNSAEEFKAKNFLVSLLTCHSLKHI--DGELL---GDPLDLKMFEFTKWAYEEGY 865

Query: 610  SLFK----RDRHSISLLHEHSGKTLNY---------EILQVFPFNSDSKRMGIIVRDEQL 656
              +K     D+  IS    H     N+          +++ F F S+ +RM +IV+  + 
Sbjct: 866  ESWKFKNAEDKTGISPAVVHPTSNCNFIENDPDNLIGVIRSFEFLSELRRMSVIVKGFKE 925

Query: 657  DEYWFMQKGADTVMSKIVESNDW---LEEETGNMAREGLRTLVIGRKKLNKKIYEQFQKE 713
            + YW   KGA  V++ I           E   +    G R +    K L K  +   QK 
Sbjct: 926  NTYWSFTKGAPEVIADICNPATIPKDFHELLHHYTHNGFRIIACAGKTLPKSSWLYSQK- 984

Query: 714  YNDASLSMLNRDQQMSQVITKYLEHDLELLGLTGVEDKLQKDVKSSIELLRNAGIKIWML 773
                    ++R++         +E +LE LG    E+KL+   K++++ L+NA I+  M 
Sbjct: 985  --------VSREE---------VEDNLEFLGFIVFENKLKSRTKAALKELQNANIRTVMC 1027

Query: 774  TGDKVETARCVSISAKLIS--------------RGQYVHTITKVTRPEGAFNQLEYLKIN 819
            TGD V TA  V   + LIS                +++ +   V       + +    +N
Sbjct: 1028 TGDNVLTAVSVGRDSGLISSERVFIPFLNDNLEESRHLLSWRDVDEEGSVLDAVTLKPLN 1087

Query: 820  ---RNACLLIDGESLGMFLKHYE---QEFFDVVVHLPTVIACRCTPQQKADVALVIRKMT 873
               ++  L I G+   +  ++ E    ++   V+   ++ A R +P +K ++   ++K+ 
Sbjct: 1088 DPEKSYTLAITGDIFRILFRNDEILPDDYISTVLMKGSIYA-RMSPDEKHELVEQLQKLD 1146

Query: 874  GKRVCCIGDGGNDVSMIQCADVGVGIVGKEGKQASLAADFSITQF---CHLTELLLWHGR 930
                 C GDG ND   ++ A++G+ +   E   AS+AA F+   F   C L   ++  GR
Sbjct: 1147 YNVGFC-GDGANDCGALKAANIGISLSEAE---ASVAAPFTSAVFDISCVLD--VIKEGR 1200

Query: 931  NSYKRSAKLAQF--------------VMHRGLIIAICQAVYSICSLFEPIALYQGW 972
             S   S    Q+              +  RG  +   Q +Y    L  PIA+   W
Sbjct: 1201 ASLVTSFSCFQYMSLYSAIQFITITILYSRGSNLGDFQFLYIDLLLIVPIAISMSW 1256

>Scas_665.30
          Length = 1439

 Score =  105 bits (263), Expect = 9e-23,   Method: Compositional matrix adjust.
 Identities = 152/668 (22%), Positives = 266/668 (39%), Gaps = 118/668 (17%)

Query: 380  CIACVVYTGRDTRQA--MNTTTAKVKTGL--LELEINSISKILCACVFALSILLVAFAGF 435
             +A VV TG  T +   + +      TG    E     I  +    +F  SI  + F   
Sbjct: 435  ALAMVVRTGFSTTKGSLVRSMVFPKPTGFKFYEDSFKYIGVMALIALFGFSISCIQFIKI 494

Query: 436  HNDDWYIDILRYLILFSTIIPVSLRVNLDLAKSVYAHQIEHDKTIPETIVRTSTIPEDLG 495
              D   + ILR L + + ++P +L   L +       +++       +  R +      G
Sbjct: 495  GLDKRTM-ILRALDIITIVVPPALPATLTIGTGFALSRLKKKGIFCISPTRVNI----GG 549

Query: 496  RIEYLLSDKTGTLTQNDMQLKKIHLGTVSY--TSETLDIVSDYVQSLVSSKNDSLNNSKV 553
            +I+ L  DKTGTLT+N + +  + L   S   + +  D+V D V  L           K 
Sbjct: 550  KIDILCFDKTGTLTENGLDVLGVQLCVPSSHNSFQFADLVQD-VHKLFP---------KF 599

Query: 554  ALSTTRKDMSFRVRDMILTLAICHNVTPTFEDDELTYQAASPDEIAIVKFT--------- 604
            +L+       +R ++  ++L  CH++     D+EL      P +  + +FT         
Sbjct: 600  SLNDCSSPRDYRAKNFFISLLTCHSLRVV--DNELI---GDPLDFKMFQFTKWSYEEDFQ 654

Query: 605  ESVGLSLFKRDRHSISL----------LHEHSGKTLN----------YEILQVFPFNSDS 644
            E    S ++  RH  +L          +H +S    N            I++ F F S+ 
Sbjct: 655  EKEFHSTYEERRHDNALPENIDIIPAVVHPNSADPENTFIDNDPHNFLGIIRSFEFLSEL 714

Query: 645  KRMGIIVRDEQLDEYWFMQKGADTVMSKIVESNDW---LEEETGNMAREGLRTLVIGRKK 701
            +RM +IV+    D YW   KGA  V+++I          EE       +G R +    + 
Sbjct: 715  RRMSVIVKPSNEDVYWAFTKGAPEVITQICNKATLPANFEEMLNYYTHKGYRVIACAGRV 774

Query: 702  LNKKIYEQFQKEYNDASLSMLNRDQQMSQVITKYLEHDLELLGLTGVEDKLQKDVKSSIE 761
            L +  +   QK         ++R++         +E ++E LG    E+KL+K+   +++
Sbjct: 775  LPRNTWLYSQK---------VSREE---------VESNMEFLGFIIFENKLKKETAKTLQ 816

Query: 762  LLRNAGIKIWMLTGDKVETARCVSISAKLI-SRGQYVHTITK-------------VTRPE 807
             L+ A I+  M TGD V TA  V     LI S+  YV ++ +             V   +
Sbjct: 817  TLQEASIRTVMCTGDNVLTAISVGRQCNLIKSKKVYVPSLEEIDSTGQTSIIWRDVDNMD 876

Query: 808  GAFNQLEYLKINRNAC----LLIDGESLGMFL----KHYEQEFFDVVVHLPTVIACRCTP 859
               +    L IN ++     L I G+   +          +++ + V+ L   I  R +P
Sbjct: 877  DTLDSRTLLPINNSSSTSYTLAITGDIFRIIFGDENNSISEDYINTVL-LKGTIYARMSP 935

Query: 860  QQKADVALVIRKMTGKRVCCIGDGGNDVSMIQCADVGVGIVGKEGKQASLAADFSITQF- 918
             +K ++   ++++      C GDG ND   ++ ADVG+ +   E   AS+AA F+   F 
Sbjct: 936  DEKHELMEQLQRLNYTVGFC-GDGANDCGALKAADVGISLSEAE---ASVAAPFTSQVFD 991

Query: 919  -------------CHLTELLLWHGRNSYKRSAKLAQFVMH-RGLIIAICQAVYSICSLFE 964
                         C +T    +   + Y     +   V++ RG  +   Q +Y    L  
Sbjct: 992  ISCVLDVIKEGRACLVTSFSCFQYMSLYSAIQFITITVLYSRGSNLGDFQFLYIDLLLIV 1051

Query: 965  PIALYQGW 972
            PIA++  W
Sbjct: 1052 PIAIFMSW 1059

>Kwal_23.3160
          Length = 1100

 Score =  105 bits (262), Expect = 1e-22,   Method: Compositional matrix adjust.
 Identities = 206/840 (24%), Positives = 343/840 (40%), Gaps = 186/840 (22%)

Query: 257  HVI--TRNRSIPSKDLKVGDLIKVHKGDRIPADLVLLQSSEPSGESFIKTDQ--LDGETD 312
            HVI    + +IPSK L  GDL  V  GD +PADL L++          +TD+  L GE+ 
Sbjct: 137  HVIRDGNDETIPSKQLVPGDLCVVKAGDTVPADLRLIECVN------FETDEALLTGESL 190

Query: 313  WKLRVAC---PLTQNLSENDLIN---------RISITASAPEKSIHKFLGKVTYKDSTSN 360
               + A    P T++    D +N         +   T    +  ++  +GK+       N
Sbjct: 191  PIAKEASQVYPATEDTPVGDRLNLAFASSTVSKGRATGIVVKTGLNTEIGKIAQSLKGDN 250

Query: 361  PL---SVDNTLWANTVLASSGFCIACVV--YTGRDTRQAMNTTTAKVKTGLLELEINSIS 415
             L     + T WAN     +G  +A  +  + G  T   ++   +K+   L         
Sbjct: 251  SLISKDENKTFWAN-----AGITLAATIGSFLGTTTGTPLHRKLSKLAVLLF-------- 297

Query: 416  KILCACVFALSILLVAFAGFHNDDWYIDILRYLILFS-TIIPVSLRVNLDLAKSVYAHQI 474
                A VFA  I+++A   F  +    ++  Y I  + ++IP SL V L +  SV A +I
Sbjct: 298  --FIAVVFA--IVVMATQKFVVNK---EVAIYAICVAVSMIPSSLVVVLTITMSVGA-KI 349

Query: 475  EHDKTIPETIVRTSTIPEDLGRIEYLLSDKTGTLTQNDMQLKKIHLG-----TVSYTSET 529
               + +   +VR     E LG +  + SDKTGTLTQ  M +K+  +      TVS +S  
Sbjct: 350  MATRNV---VVRKLDSLEALGAVNDVCSDKTGTLTQGKMIVKQAWVPSFGTITVSNSSNP 406

Query: 530  LDIVSDYVQ-----SLVSSKNDSLNNSKVALSTTRKDMSFRVRDMI--------LTLAIC 576
             D     ++     S    K+DS  +  +  S   K  + ++   +        L  A  
Sbjct: 407  FDPTDGGIELIPRFSPHQYKHDSTEDVGIITSFKNKFYNDKLPAGLNSKLFLNWLKTAAL 466

Query: 577  HNVTPTFEDDELTYQAA--SPDEIAIVKFTESVGL---SLFKRDR------HSISLLHEH 625
             N+   ++D E     A   P EIAI  F   + +   +L   D+         +L  + 
Sbjct: 467  ANIAHVYQDPETEEWKAHGDPTEIAIQVFAHKLDMPRNALTAEDKSDSESDEDAALGEKT 526

Query: 626  SGKTLNYEILQVFPFNSDSKRM-GIIVRDEQLDEYWFMQKGADTVMSKIVES-NDWL--- 680
            S    +Y+ +  FPF+S  KRM  + V  ++ + +    KGA     ++++    WL   
Sbjct: 527  SSVEPHYKHIAEFPFDSSIKRMSAVYVSLDEDNAHRVFTKGA---FERVLDCCTKWLPDG 583

Query: 681  --------------EEETGN---MAREGLRTLVIGRKKLNK----KIYEQFQKEYNDASL 719
                          EE   N   ++ EGLR L    K   +    K+ E  +K       
Sbjct: 584  CNESDAKPMTEEDKEEVFKNVETLSSEGLRVLAFATKSFTESQALKVSEDLRK------- 636

Query: 720  SMLNRDQQMSQVITKYLEHDLELLGLTGVEDKLQKDVKSSIELLRNAGIKIWMLTGDKVE 779
               NRD         ++E DL   GL G+ D  +++   +++    AGI + MLTGD   
Sbjct: 637  ---NRD---------FVESDLIFQGLVGIYDPPRQETAGAVKQFHKAGINVHMLTGDFPG 684

Query: 780  TARCVSISAKLISRGQYVHTITKVTRPEGAFNQLEYLKINRNACLLIDGESLGMFLKHYE 839
            TA+ ++    ++ R  Y H   +V                         +S+ M    ++
Sbjct: 685  TAKAIAQEVGILPRNLY-HYPKEVV------------------------DSMVMTAAQFD 719

Query: 840  Q---EFFDVVVHLPTVIACRCTPQQKADVALVIRKMTGKRVCCI-GDGGNDVSMIQCADV 895
            Q   E  D ++ LP VIA RC PQ K  +   + +   ++ C + GDG ND   ++ A+V
Sbjct: 720  QLTDEEIDNLLLLPLVIA-RCAPQTKVRMIDALHRR--EKFCAMTGDGVNDSPSLKKANV 776

Query: 896  GV--GIVGKE-GKQAS--LAADFSITQFCHLTELLLWHGRNSYKRSAKLAQFVMHRGLII 950
            G+  GI G +  K AS  + +D +     +  E     GR   + S  + +FV+   L  
Sbjct: 777  GIAMGINGSDVAKDASDIVLSDDNFASILNAVE----EGR---RMSDNIQKFVLQL-LAE 828

Query: 951  AICQAVY---SICSLFE------PIALYQGWLMVGYATCYTMAPVFSLTLDHDIEESLTK 1001
             + QA+Y    +C L E      P++  +   ++   +C+   P   L L+    + + K
Sbjct: 829  NVAQALYLMIGLCFLDEDRLSVFPLSPVEVLWIIVVTSCF---PAMGLGLEKSAPDIMEK 885

>Kwal_26.9207
          Length = 1469

 Score =  105 bits (263), Expect = 1e-22,   Method: Compositional matrix adjust.
 Identities = 144/624 (23%), Positives = 257/624 (41%), Gaps = 125/624 (20%)

Query: 429  LVAFAGFH---------NDDWYIDILRYLILFSTIIPVSLRVNLDLAKSVYAHQIEHDK- 478
            L+A AGF             + + ILR L + + ++P +L   L +  S    +++    
Sbjct: 708  LIALAGFSISCINFIRLGLAYKVMILRALDIITIVVPPALPATLSIGASFAIARLKKKGI 767

Query: 479  -TIPETIVRTSTIPEDLGRIEYLLSDKTGTLTQNDMQLKKIHLGTVSYTSETLDIVSDYV 537
              I  T V  S      G+I+ +  DKTGTLT++ + +  +H+      +E     +   
Sbjct: 768  FCIAPTRVNVS------GKIDVMCFDKTGTLTEDGLDVLGVHV------AEPQGHQNFRF 815

Query: 538  QSLVSSKNDSLNNSKVALSTTRKDMSFRVRDMILTLAICHNVTPTFEDDELTYQAASPDE 597
             +L+++     N  K +L+     + F+ R+ +++L  CH++     D EL      P +
Sbjct: 816  GALITNVRGLFN--KYSLNDCGSPIDFKSRNFLVSLLTCHSLRVV--DGELL---GDPLD 868

Query: 598  IAIVKFT--------ESVGLSLFKRDRHSISLLHEHSG-----------KTLN------- 631
              + +FT        +         +R++ S L E++G            T N       
Sbjct: 869  FKMFQFTNWSYAEDFQDFKFHSLNEERNNKSTLPENAGIAPAVVHPNAESTENKFTENDP 928

Query: 632  ---YEILQVFPFNSDSKRMGIIVRDEQLDEYWFMQKGADTVMSKIVESNDW---LEEETG 685
                 +++ F F S+ +RM +IV+    + +W   KGA  V+S+I   +      E+   
Sbjct: 929  HNLLGVIRSFEFVSELRRMSVIVKPYGENVFWGFTKGAPEVISEICNKSTLPANYEQILQ 988

Query: 686  NMAREGLRTLVIGRKKLNKKIYEQFQKEYNDASLSMLNRDQQMSQVITKYLEHDLELLGL 745
                 G R +    K L K+ +   QK         ++R++         +E ++E LG 
Sbjct: 989  QYTHNGYRVIACAGKTLPKRTWRFAQK---------VSREE---------VESNMEFLGF 1030

Query: 746  TGVEDKLQKDVKSSIELLRNAGIKIWMLTGDKVETARCVSISAKLISRGQ-YVHTITKVT 804
               E+KL+     ++  L++AGI+  M TGD V TA  V   + LI+    +V  I    
Sbjct: 1031 VVFENKLKPSTTPTLASLQDAGIRSIMCTGDNVLTAISVGRESGLITESHVFVPQINDNM 1090

Query: 805  RP-----------------EGAFNQLEYLKINRNACLLIDGESLGMFLKHYE--QEFFDV 845
             P                 +G    LE +  + +  + + G+   +  K+ E   E +  
Sbjct: 1091 DPNEDLIIWRDVDDCDLILDGV--TLEPMNGSSDYTIAVTGDVFRLLFKNNEVLPESYIN 1148

Query: 846  VVHLPTVIACRCTPQQKADVALVIRKMTGKRVCCIGDGGNDVSMIQCADVGVGIVGKEGK 905
            +V L + I  R +P +K ++   ++ +      C GDG ND   ++ ADVGV +   E  
Sbjct: 1149 MVLLKSSIYARMSPDEKHELVGQLQGLDYVVGFC-GDGANDCGALKAADVGVSLSEAE-- 1205

Query: 906  QASLAADFSITQF---CHLTELLLWHGRNSYKRSAKLAQFV--------------MHRGL 948
             AS+AA F+ + F   C L   ++  GR S   S    Q++                RG+
Sbjct: 1206 -ASVAAPFTSSVFEISCILD--VIKEGRASLTTSFSCFQYMSLYSAIQFVTVTMLYSRGI 1262

Query: 949  IIAICQAVYSICSLFEPIALYQGW 972
             +   Q +Y    L  PIA++  W
Sbjct: 1263 NLGDFQFLYIDLFLIVPIAIFMSW 1286

>KLLA0A08910g complement(779526..783368) similar to sp|P38929
           Saccharomyces cerevisiae YGL006w PMC1 Ca2+-transporting
           P-type ATPase, start by similarity
          Length = 1280

 Score =  102 bits (255), Expect = 8e-22,   Method: Compositional matrix adjust.
 Identities = 195/775 (25%), Positives = 313/775 (40%), Gaps = 136/775 (17%)

Query: 258 VITRNRS---IPSKDLKVGDLIKVHKGDRIPADLVLLQSSEPSGESFIKTDQLDGETDWK 314
           V+ RN     I   DL VGD+I +  GD +PAD VL+  S    ES      L GE+D  
Sbjct: 242 VVIRNGDEHLISIHDLLVGDVISLQTGDVVPADAVLISGSCECDES-----ALTGESDTI 296

Query: 315 LRVACPLTQNLSENDLINRISITASAPEKSIHKFLGKVTYKDSTSNPLSVDNTLWANTVL 374
            +VA  L   L +   I          EK     +G     +   +PL +  +       
Sbjct: 297 KKVA--LKPALEKYKQIF---------EKDPTIDIGSHGVGEKVPDPLLISGSKLL---- 341

Query: 375 ASSGFCIACVVYTGRDT---RQAMNTTTAKVKTGLLELEINSISKI-LCACVFALSILLV 430
             SG   A +   G ++   R  M   T    T L E   N    I +  C+ AL + ++
Sbjct: 342 --SGIGNAVITSVGENSVNGRIMMALKTESESTPLQERLSNLADNISIYGCMAALVLFII 399

Query: 431 AFAGF----HNDDWYIDIL------RYLILFSTII-------PVSLRVNLDLAKSVYAHQ 473
            F  F     N   Y D+       +++ +F T +       P  L + + LA +    +
Sbjct: 400 LFIRFLTYLPNGKKYHDLPPAQKGSKFMNIFITAVTVIVVAVPEGLPLAVTLALAFATTR 459

Query: 474 IEHDKTIPETIVRTSTIPEDLGRIEYLLSDKTGTLTQNDMQLKKIHLGTVSYT----SET 529
           +  D  +    VR     E +G    + SDKTGTLT+N M + K   G + +     +E 
Sbjct: 460 MTKDGNL----VRVLRACETMGSATAICSDKTGTLTENRMTVVKGFAGNLGFDDTTHAEN 515

Query: 530 LDIVSDYV------QSLVSS--KNDSLNNSKVALSTTR---KDMS----FRVRDMILTLA 574
            +I S  V       SL++    N SLN++      ++   KD+      + R  +   +
Sbjct: 516 KEIKSAVVLRSNCDASLLTDILSNISLNSTAFENKESQHKDKDVDENPYHKSRKSLFPWS 575

Query: 575 ICHNVTPTF-----EDDELTYQAASPDEIAIVKFTESVGLSLFKRDRHSISLLHEHSGKT 629
             +  +        E+DE      S  E A++ F +    SL  +D H +       G  
Sbjct: 576 RNNRTSQLIADAMKENDEQFL--GSKTETALLAFAQK---SLGMKDVHKLRTKPSDLGID 630

Query: 630 LNYEILQVFPFNSDSKRMGIIVRDEQLDEYWFMQKGADTVMSK-----------IVESND 678
              +++QV PF S  K   I V+      Y F  KGA  ++ K           IV  N 
Sbjct: 631 ---KVVQVIPFESSRKWGAIAVQLADNKGYRFYAKGAAEILLKVCSNQRNSDNSIVPMNQ 687

Query: 679 WLEEET----GNMAREGLRTLVIGRKKLNKKIYEQFQKEYNDAS-LSMLNRDQQMSQVIT 733
            L +E+     +MA   LRT+ +    +++   E   KE+ D++  S+ + D  M   + 
Sbjct: 688 DLYDESFKKIQDMASHALRTISL----VHRDFKEWPPKEFADSTDPSIASPDLVMGHELD 743

Query: 734 -KYLEHD-LELLGLTGVEDKLQKDVKSSIELLRNAGIKIWMLTGDKVETARCVSISAKLI 791
            K L  + + L  + G++D L++ VK S+E  + AG+ + M+TGD + TAR +S +  ++
Sbjct: 744 HKNLSSEGMTLDAMVGLQDPLREGVKESVEQCQRAGVTVRMVTGDNILTARAISRNCNIL 803

Query: 792 SRGQYVHTITKVTRPEGAFNQLEYLKINRNACLLIDGESLGMFLKHYEQEFFDVVVHLPT 851
           S   Y      +  P   F +L Y K+ R                         V+    
Sbjct: 804 SEEGYNDPECAMEGP--TFRKLPYKKMLR-------------------------VIPKLR 836

Query: 852 VIACRCTPQQKADVALVIRKMTGKRVCCIGDGGNDVSMIQCADVG--VGIVGKEGKQASL 909
           V+A R +P+ K  +   ++KM G+ V   GDG ND   ++ ADVG  +GI G E  + + 
Sbjct: 837 VLA-RSSPEDKRILVETLKKM-GEVVAVTGDGTNDAPALKLADVGFSMGISGTEVAREAS 894

Query: 910 AADFSITQFCHLTELLLWHGRNSYKRSAKLAQFVMHRGLIIAICQAVYSICSLFE 964
                   F  +   + W GR       K  QF +   +   I   V ++ S  E
Sbjct: 895 DIILMTDDFTAIVNAIKW-GRCVSVSIKKFIQFQLTVNITAVILTFVSAVASAEE 948

>AFR567W [3759] [Homologous to ScYOR291W - SH]
            complement(1455295..1459644) [4350 bp, 1449 aa]
          Length = 1449

 Score =  101 bits (252), Expect = 2e-21,   Method: Compositional matrix adjust.
 Identities = 178/787 (22%), Positives = 326/787 (41%), Gaps = 151/787 (19%)

Query: 265  IPSKDLKVGDLIKVHKGDR--IPADLVLLQSSEPSGESFIKTDQLDGETDWKLRVACPLT 322
            +PS DL  GD+ ++       +P D +L+     SG+  +    L GE+        P++
Sbjct: 552  VPSSDLVPGDIYELTDPSLSLLPCDSILI-----SGDCLVNESMLTGES-------VPVS 599

Query: 323  QNLSENDLINRISITASAPEKSIHKFLGKVTYKDSTSNPLSVDNTLWANT----VLASSG 378
            +               +A  +++ + L    + D+  +     + L+  T    V A++G
Sbjct: 600  K--------------VAATRETMLQLLDD--FMDTQLSSFVSKSFLFNGTKLIRVRATAG 643

Query: 379  FCIAC--VVYTGRDTRQA--MNTTTAKVKTGL--LELEINSISKILCACVFALSILLVAF 432
              IA   V  TG  T +   + +      TG    E     I  I    +F  ++  + F
Sbjct: 644  QSIALGMVARTGFSTTKGSLVRSMVFPKPTGFKFYEDSFKYIGYISIIALFGFAVSFIQF 703

Query: 433  AGFHNDDWYIDILRYLILFSTIIPVSLRVNLDLAKSVYAHQIEHDKTIPETIVRTSTIPE 492
                 D   + ILR L + + ++P +L  +L +      ++++       +  R +    
Sbjct: 704  LRLGLDKRTM-ILRALDIITVVVPPALPASLSIGTGFALNRLKKKGIFCISPTRVNV--- 759

Query: 493  DLGRIEYLLSDKTGTLTQNDMQLKKIHLGTVSYTSETLDIVSDYVQSLVSSKNDSLNNSK 552
              G+I+ +  DKTGTLT++ + +  +H+  V    + + I       LV+   D L +  
Sbjct: 760  -GGKIDVMCFDKTGTLTEDGLDVLGVHV--VQPLQQEMKI-----SKLVTDVKDLLQSLS 811

Query: 553  VALSTTRKDMSFRVRDMILTLAICHNVTPTFEDDELTYQAASPDEIAIVKFT-----ESV 607
            ++   + +DM  + ++ +++L  CH++     D EL      P +  +V+FT     E  
Sbjct: 812  LSDCVSTRDM--KAKNFLVSLLTCHSLR--MVDGELL---GDPFDFKMVQFTKWSDEEET 864

Query: 608  G----LSLFKRDRHSISLLHEHS------------GKTLNYE------ILQVFPFNSDSK 645
            G     SL++ +RH  S + E+S            G+ +  E      I++ F F S+ +
Sbjct: 865  GNRKVHSLYE-ERHDGSTMPENSRFAPAIVHPSGKGRFIEREPSNVIGIVRSFEFLSNLR 923

Query: 646  RMGIIVRDEQLDEYWFMQKGADTVMSKIVESNDW---LEEETGNMAREGLRTLVIGRKKL 702
            RM +IV+    + +    KGA  V+ ++          E    +    G R +    KKL
Sbjct: 924  RMSVIVKPFSENVFMSFTKGAPEVIFELCSKQTLPLDYEALLHHYTHNGYRVIACAGKKL 983

Query: 703  NKKIYEQFQKEYNDASLSMLNRDQQMSQVITKYLEHDLELLGLTGVEDKLQKDVKSSIEL 762
             ++ +   QK         ++R++         +E +LE LG    E+KL+   K ++E 
Sbjct: 984  TRQSWLYSQK---------VSREE---------IESNLEFLGFIIFENKLKGTTKETLES 1025

Query: 763  LRNAGIKIWMLTGDKVETARCVSISAKLISRGQ-YVHTITKV-TRPEG----------AF 810
            L  A I+  M TGD V TA  V   A L+   + +V  I  + T  EG          + 
Sbjct: 1026 LHRADIRTIMCTGDNVLTAISVGREAGLVESPRVFVSVINDIDTSQEGDIITWQNVANSS 1085

Query: 811  NQLEYLKINR------NACLLIDGESLGMFLKHYEQEFFDVV--VHLPTVIACRCTPQQK 862
            + L+ + +        +  L + GE   +  K  + +  +V+  + L T I  R +P +K
Sbjct: 1086 DTLDSVTLRPLSGDTDDYTLAVTGEVFRLLFKTDKSQIEEVINNILLKTSIYARMSPDEK 1145

Query: 863  ADVALVIRKMTGKRVCCIGDGGNDVSMIQCADVGVGIVGKEGKQASLAADFSITQF---C 919
             ++   ++ + G +V   GDG ND   ++ AD+G+ +   E   AS+AA F+   F   C
Sbjct: 1146 HELVERLQSI-GYQVGFCGDGANDCGALKAADIGISLSEAE---ASVAAPFTSRLFEISC 1201

Query: 920  HLTELLLWHGRNS---------YKRSAKLAQFVM-----HRGLIIAICQAVYSICSLFEP 965
             L   ++  GR +         Y       QFV       RG  +   Q +Y    L  P
Sbjct: 1202 VLD--VMKEGRAALVTSFACFQYMSLYSATQFVTILILYSRGSNLGDFQFLYIDLFLIVP 1259

Query: 966  IALYQGW 972
            +A++  W
Sbjct: 1260 LAVFMSW 1266

>YOR291W (YOR291W) [5075] chr15 (861172..865590) Member of the
            cation-translocating P-type ATPase superfamily of
            membrane transporters [4419 bp, 1472 aa]
          Length = 1472

 Score =  101 bits (252), Expect = 2e-21,   Method: Compositional matrix adjust.
 Identities = 136/606 (22%), Positives = 244/606 (40%), Gaps = 119/606 (19%)

Query: 444  ILRYLILFSTIIPVSLRVNLDLAKSVYAHQIEHDKTIPETIVRTSTIPEDLGRIEYLLSD 503
            ILR L + + ++P +L   L +  +    +++       +  R +      G+I+ +  D
Sbjct: 726  ILRALDIITIVVPPALPATLTIGTNFALSRLKEKGIFCISPTRLNIS----GKIDVMCFD 781

Query: 504  KTGTLTQNDMQLKKIHLGTVSYTSETLDIVSDYVQSLVSSKNDSLNNSKVALSTTRKDMS 563
            KTGTLT++ + +  + +      SE   +       L+S         K +L+     + 
Sbjct: 782  KTGTLTEDGLDVLGVQI------SEPNGVRGQKFGELLSDIRQVF--PKFSLNDCSSPLD 833

Query: 564  FRVRDMILTLAICHNVTPTFEDDELTYQAASPDEIAIVKFTE-SVGLSLFKRDRHSI--- 619
            F+ R+  ++L  CH++     D  L      P +  + +FT  S      KR  HS+   
Sbjct: 834  FKSRNFFMSLLTCHSLRSV--DGNLL---GDPLDFKMFQFTGWSFEEDFQKRAFHSLYEG 888

Query: 620  ---------------SLLHEHSGKTLN----------YEILQVFPFNSDSKRMGIIVRDE 654
                           +++H  S    N            +++ F F S+ +RM +IV+  
Sbjct: 889  RHEDDVFPENSEIIPAVVHPDSNNRENTFTDNDPHNFLGVVRSFEFLSELRRMSVIVKTN 948

Query: 655  QLDEYWFMQKGADTVMSKIVESNDW---LEEETGNMAREGLRTLVIGRKKLNKKIYEQFQ 711
              D YW   KGA  V+S+I   +      EE        G R +    K L K+ +   Q
Sbjct: 949  NDDVYWSFTKGAPEVISEICNKSTLPADFEEVLRCYTHNGYRVIACAGKTLPKRTWLYSQ 1008

Query: 712  KEYNDASLSMLNRDQQMSQVITKYLEHDLELLGLTGVEDKLQKDVKSSIELLRNAGIKIW 771
            K         ++R++         +E +LE LG    ++KL+K+   +++ L++A I+  
Sbjct: 1009 K---------VSREE---------VESNLEFLGFIIFQNKLKKETSETLKSLQDANIRTI 1050

Query: 772  MLTGDKVETARCVSISAKLIS--------------RGQYVHTITKVTRPEGAFN--QLEY 815
            M TGD + TA  V   A LI                G+ V     V  P+   +   L+ 
Sbjct: 1051 MCTGDNILTAISVGREAGLIQCSRVYVPSINDTPLHGEPVIVWRDVNEPDKILDTKTLKP 1110

Query: 816  LKINRNAC---------LLIDGESLGMFLK---HYEQEFFDVVVHLPTVIACRCTPQQKA 863
            +K+  N+          L + G+   +  +      +E+ + ++ L + I  R +P +K 
Sbjct: 1111 VKLGNNSVESLRECNYTLAVSGDVFRLLFRDENEIPEEYLNEIL-LNSSIYARMSPDEKH 1169

Query: 864  DVALVIRKMTGKRVCCIGDGGNDVSMIQCADVGVGIVGKEGKQASLAADFSITQF---CH 920
            ++ + ++K+      C GDG ND   ++ ADVG+ +   E   AS+AA F+   F   C 
Sbjct: 1170 ELMIQLQKLDYTVGFC-GDGANDCGALKAADVGISLSEAE---ASVAAPFTSKIFNISCV 1225

Query: 921  LTELLLWHGRNSYKRSAKLAQF--------------VMHRGLIIAICQAVYSICSLFEPI 966
            L   ++  GR +   S    Q+              +  RG  +   Q +Y    L  PI
Sbjct: 1226 LD--VIREGRAALVTSFACFQYMSLYSAIQFITITILYSRGSNLGDFQFLYIDLLLIVPI 1283

Query: 967  ALYQGW 972
            A+   W
Sbjct: 1284 AICMSW 1289

>CAGL0A00517g 58830..62198 similar to sp|P38929 Saccharomyces
           cerevisiae YGL006w PMC1, hypothetical start
          Length = 1122

 Score =  100 bits (249), Expect = 4e-21,   Method: Compositional matrix adjust.
 Identities = 170/746 (22%), Positives = 306/746 (41%), Gaps = 134/746 (17%)

Query: 269 DLKVGDLIKVHKGDRIPADLVLLQSSEPSGESFIKTDQLDGETDWKLRVACPLTQNLSEN 328
           +L VGDL+K+  GD +PAD VL++     GE       L GE++   ++  PL   L   
Sbjct: 174 NLLVGDLLKLQTGDVVPADCVLVR-----GECETDESALTGESNTIKKL--PLADALE-- 224

Query: 329 DLINRISITASAPEKSIHKFLGKVTYKDSTSNPLS--VDNTLWANTVLAS-----SGFCI 381
                            H   G     D++++  S   D++   + +L S     SG   
Sbjct: 225 ----------------YHSAHGGRDIGDTSASGASGAADDSRCPDCMLISGSRVLSGLAS 268

Query: 382 ACVVYTGRDT--RQAMNTTTAKVKTGLLELEINSISKILC--ACVFALSILLVAFA---- 433
           A V   G ++   + M +     +   L++ ++ ++  +    CV A+++ +V FA    
Sbjct: 269 AIVTNVGVNSVHGKTMASLKEDSEDTPLQMRLSQLTDNISVYGCVAAITLFVVLFARYLS 328

Query: 434 ------GFHND-------DWYIDILRYLILFSTIIPVSLRVNLDLAKSVYAHQIEHDKTI 480
                 G ++D         ++DI    I   T+I V++   L LA ++         T 
Sbjct: 329 YILPSGGKYHDLPPAEKGSKFMDIFITAI---TVIVVAVPEGLPLAVTLALAFATTRMTK 385

Query: 481 PETIVRTSTIPEDLGRIEYLLSDKTGTLTQNDMQLKKIHLGTVSYTSETLDI-------- 532
              +VR     E +G    + SDKTGTLT+N M + +  LG   +     D         
Sbjct: 386 DGNLVRVLRSCETMGSATAVCSDKTGTLTENIMTVVRGTLGRAGFDDIGADPSKSNLVFK 445

Query: 533 --VSDYVQSLVSSKNDSLNNSKVALSTTRKDMSFRVRDMILTLAICHNVTPTFE----DD 586
              SD +++++   N  LN++       +   ++   D      +   +T T +    DD
Sbjct: 446 KKCSDLLRTVIYD-NIVLNSTAFENKDYKDPNNYNSIDDSQPRRLIRRITQTLQKKKPDD 504

Query: 587 E---LTYQAASPDEIAIVKFTESVGLSLFKRDRH----SISLLHEHSGKTLNYE-ILQVF 638
           E   L + A    E  I   TE+  LSL ++       ++     H  K    E I+Q+ 
Sbjct: 505 EENLLAHAAEGRQEPYIGSKTETALLSLARKSFGLKFGALQSFRGHPEKLPTVETIVQII 564

Query: 639 PFNSDSKRMGIIVR-----DEQLDEYWFMQKGADTVMSKIV---------------ESND 678
           PF S  K   I+V+     + +  ++    KGA  +++K                 +S D
Sbjct: 565 PFESSRKWSAIVVKLNSNKENEGKKFRLYVKGAAEIVAKACTLKNVCNEGISEIDQKSKD 624

Query: 679 WLEEETGNMAREGLRTLVIGRKKLNKKIYEQFQKEYNDASLSMLNRDQQMSQVITKYLEH 738
            +EE+  ++A++ LR + +     +  + E   KE  D   S      ++      +LE 
Sbjct: 625 DIEEQIFSLAKDALRAISLAHMDFD--VNEWPPKELADPENSHEALAVKLIDPKKPHLEG 682

Query: 739 DLELLGLTGVEDKLQKDVKSSIELLRNAGIKIWMLTGDKVETARCVSISAKLISRGQYVH 798
            L L  + G++D L+++VK+S+   + AG+ + M+TGD + TA+ ++ +  ++S      
Sbjct: 683 -LTLDAIVGIQDPLRENVKNSVAQCQKAGVTVRMVTGDNLLTAKAIARNCGILSSKS--- 738

Query: 799 TITKVTRPEGAFNQLEYLKINRNACLLIDGESLGMFLKHYEQEFFDVVVHLPTVIACRCT 858
                              +N +AC + +G +   F K  + E   ++  L   +  R +
Sbjct: 739 -------------------LNDSACAM-EGPA---FRKLSDSERKRILPKL--RVLARSS 773

Query: 859 PQQKADVALVIRKMTGKRVCCIGDGGNDVSMIQCADVG--VGIVGKEGKQASLAADFSIT 916
           P+ K  +   +++M G+ V   GDG ND   ++ ADVG  +GI G E  + +        
Sbjct: 774 PEDKKILVRALKEM-GEVVAVTGDGTNDAPALKLADVGFSMGITGTEVAREASDIILMTD 832

Query: 917 QFCHLTELLLWHGRNSYKRSAKLAQF 942
            F  +   + W GR       K  QF
Sbjct: 833 DFSAIVNAIKW-GRCVAASIKKFIQF 857

>CAGL0K12034g complement(1161299..1164562) highly similar to
           sp|P13587 Saccharomyces cerevisiae YDR040c ENA1 or
           sp|Q01896 Saccharomyces cerevisiae YDR039c ENA2 or
           sp|Q12691 Saccharomyces cerevisiae YDR038c ENA5,
           hypothetical start
          Length = 1087

 Score = 95.9 bits (237), Expect = 1e-19,   Method: Compositional matrix adjust.
 Identities = 195/829 (23%), Positives = 325/829 (39%), Gaps = 174/829 (20%)

Query: 257 HVITRNRS--IPSKDLKVGDLIKVHKGDRIPADLVLL-QSSEPSGESFIKTDQL------ 307
           HVI    S  + S D+  GDL+ V  GD IPADL L+ Q +  + E+ +  + L      
Sbjct: 127 HVIRNGNSEVVDSTDVVPGDLVVVKVGDTIPADLRLVSQQNFETDEALLTGESLPVSKDA 186

Query: 308 ----DGETDWKLRVACPLTQNLSENDLINRISITASAPEKSIHKFLGKVTYKDSTSNPL- 362
               D ET    R+    + +         I+I     +  ++  +GK+       N L 
Sbjct: 187 NEIFDDETPVGDRINLAFSSSTVVKGRAQGIAI-----KTGLNTEIGKIAKSLRGGNELI 241

Query: 363 SVDNT-LWANTVLASSGFCIACVVYTGRDTRQAMNTTTAKVKTGLLELEINSISKILCAC 421
           S D    W      S+   +   + T + T               L  +++ ++ +L   
Sbjct: 242 SRDPAKTWYQNAWISTKRTVGAFLGTTQGTP--------------LHRKLSKLAVLLFWI 287

Query: 422 VFALSILLVAFAGFHNDDWYIDILRYLILFS-----TIIPVSLRVNLDLAKSVYAHQIEH 476
               +I+++A   F       D+ R + +++     ++IP SL V L +  SV A  +  
Sbjct: 288 AVVFAIVVMASQKF-------DVDRGVAIYAVCVALSMIPSSLVVVLTITMSVGAAVMAS 340

Query: 477 DKTIPETIVRTSTIPEDLGRIEYLLSDKTGTLTQNDMQLKKI---HLGTVSYTS------ 527
              I    +R     E LG +  + SDKTGTLTQ  M  K+I     GT+          
Sbjct: 341 RNVI----IRKLDSLEALGAVNDICSDKTGTLTQGKMIAKQIWVPKFGTLQVVGSNEPLN 396

Query: 528 -ETLDIVSDYVQSLVSSKNDSLNNSKVALSTTRKD----------MSFRVRDMILTLAIC 576
            E  DI  +++ +L   +        V +    KD            +++ D  L  A  
Sbjct: 397 PEKGDI--NFIPNLSPYEYSHNETEDVGIMQNFKDKYEGKSIPGNCQYQLFDKWLETASL 454

Query: 577 HNVTPTFEDDELTYQAA--SPDEIAIVKFTESVGLSLF----KRD-------RHSISLLH 623
            N+   F D E     A   P EIAI  F   + L       +RD         S+SL  
Sbjct: 455 ANIASVFTDPETKEWKAHGDPTEIAIQVFATRMDLPRHVLTGERDDMDEDEIMSSVSLSE 514

Query: 624 -EHSGKTLNYEILQVFPFNSDSKRMGIIVRDEQLDEYWFMQKGA---------------- 666
            + +     +     FPF+S  KRM  +        Y    KGA                
Sbjct: 515 KDATAANAKFRHAAEFPFDSTIKRMSSVYESRDYKTYEIYTKGAFESVLNCCTHWYGRDP 574

Query: 667 --DTVMSKIVESNDWLEEETGNMAREGLRTLVIGRKKLNKKIYEQFQKEYNDASLSMLNR 724
              TVM+      D ++E   +M+ EGLR L    K   K        + N+  L  + +
Sbjct: 575 NTATVMTD--ADVDTIKENIDSMSSEGLRVLAFANKSYPKS-------DVNEEKLQKILK 625

Query: 725 DQQMSQVITKYLEHDLELLGLTGVEDKLQKDVKSSIELLRNAGIKIWMLTGDKVETARCV 784
           ++        Y E  L  LGL G+ D  +++   +++    AGI + MLTGD   TA+ +
Sbjct: 626 ERD-------YAETGLTFLGLIGIYDPPREETAGAVKKFHQAGINVRMLTGDFPGTAKAI 678

Query: 785 SISAKLISRGQYVHTITKVTRPEGAFNQLEYLKINRNACLLIDGESLGMFLKHYEQEFFD 844
           +    ++    Y ++              E + I     +++ G+       +  ++  D
Sbjct: 679 AQEVGILPTNLYHYS-------------KEVVDI-----MVMTGKQ----FDNLSEDEID 716

Query: 845 VVVHLPTVIACRCTPQQKADVALVIRKMTGKRVCCI-GDGGNDVSMIQCADVGV--GIVG 901
            +  LP VIA RC+PQ K  +   + +   ++ C + GDG ND   ++ A+VG+  GI G
Sbjct: 717 NLPVLPLVIA-RCSPQTKVRMIEALHRR--EKFCAMTGDGVNDSPSLKMANVGIAMGING 773

Query: 902 KE-GKQAS--LAADFSITQFCHLTELLLWHGRNSYKRSAKLAQFVMHRGLIIAICQAVYS 958
            +  K AS  + +D +     +  E     GR   + S  + +FV+   L   + QA+Y 
Sbjct: 774 SDVAKDASDIVLSDDNFASILNAVE----EGR---RMSDNIQKFVLQL-LAENVAQALYL 825

Query: 959 ICSL-FE--------PIALYQGWLMVGYATCYTMAPVFSLTLD---HDI 995
           I  L F+        P+A  +   ++   +C+   P   L L+   HD+
Sbjct: 826 IVGLAFQDKEGKSVFPLAPVEVLWIIVVTSCF---PAMGLGLEKAAHDL 871

>AFL011W [3182] [Homologous to ScYGL006W (PMC1) - SH]
           complement(415265..418993) [3729 bp, 1242 aa]
          Length = 1242

 Score = 95.1 bits (235), Expect = 2e-19,   Method: Compositional matrix adjust.
 Identities = 167/711 (23%), Positives = 289/711 (40%), Gaps = 125/711 (17%)

Query: 258 VITRNRS---IPSKDLKVGDLIKVHKGDRIPADLVLLQSSEPSGESFIKTDQLDGETDWK 314
           V+ RN     I   DL VGDL+ +  GD +P D +L++      ES I      GE+D  
Sbjct: 186 VVVRNGDKHVISVHDLLVGDLLSLQTGDVVPVDCILVEGKCECDESGIT-----GESDTI 240

Query: 315 LRVACPLTQNLSENDLINRISITASAPEKSIHKFLGKVTYKDSTSNPLSVDNTLWANTVL 374
            +V+  ++  +         ++ A  P   I              + L  D  L + + L
Sbjct: 241 KKVSLAMSLQVYR-------TVAADNPSADIGS--------SDNGHSLVPDPMLISGSKL 285

Query: 375 ASS-GFCIACVVYTGRDTRQAMNTTTAKVKTGLLELEINSISKILC--ACVFALSILLVA 431
            S  G  +   V       + M    ++ +T  L+  +N+++  +     V A  + +V 
Sbjct: 286 LSGIGHAVVTAVGPHSVHGKMMLALKSEPETTPLQERLNTLADDISIYGSVAAFLLFVVL 345

Query: 432 FAGF----HNDDWYIDIL------RYLILFSTII-------PVSLRVNLDLAKSVYAHQI 474
           F  F         Y D+       R++ +F T +       P  L + + LA +    ++
Sbjct: 346 FLRFLSYLPKGRLYHDLPSARKGSRFMDIFITAVTVIVVAVPEGLPLAVTLALAFATTRM 405

Query: 475 EHDKTIPETIVRTSTIPEDLGRIEYLLSDKTGTLTQNDMQLKKIHLGTVSYTSETLD--- 531
             D  +    VR     E +G    + SDKTGTLTQN M + K  LG+  +   + D   
Sbjct: 406 TKDGNL----VRVLRACETMGSATTVCSDKTGTLTQNKMVVVKGFLGSSHFDDISEDSNC 461

Query: 532 IVSDYVQSLVSSK--NDSLNNSKVALSTTRKDMSFRVRDMILTLAICH----NVTPTFED 585
             SD ++  +S    ND L N  +AL++T  + + +V D ++T    H    ++ P   +
Sbjct: 462 AQSDALRQDMSQHTLNDILAN--IALNSTAFE-NKQVADPVITENPYHKPRRSLFPWSRN 518

Query: 586 DELTYQAASPDEIAIVKF-----TESVGLSLFKRDR--HSISLLHEHSGKTLNYEILQVF 638
           ++  Y A     +   +F     TE+  LSL K      S+  L +         I+Q+ 
Sbjct: 519 NKPKYPAPKDSSVQSAEFFIGSKTEAALLSLAKGSLGLESLQALRDDPHHIGIASIVQMI 578

Query: 639 PFNSDSKRMGIIVRDEQLDEYWFMQKGADTVMSK---IVESNDWL----EEETG------ 685
           PF S  K  G++VR    +  +F++  ++T+      +  SND +     ++ G      
Sbjct: 579 PFESSRKWAGLVVRLVDGNYRFFIKGASETIFKSCHYMRSSNDDVIKLSPQKHGEIFGLI 638

Query: 686 -NMAREGLRTLVIGRKKLNKKIYEQFQKEYNDAS------LSMLNRDQQMS------QVI 732
            N+A + LRT+ +  K     I      E  DAS        +L  D+ +        +I
Sbjct: 639 NNLASDALRTISLAHKDFTD-ISSWPPAELRDASDPSTASPDLLLGDEYVPTATDRPSII 697

Query: 733 TKYLEHDLELLGLTGVEDKLQKDVKSSIELLRNAGIKIWMLTGDKVETARCVSISAKLIS 792
           T      L L G+ G+ D L+  VK S++  + +G+ + M+TGD + T R ++ +  ++S
Sbjct: 698 TNN-NSGLILDGVVGIHDPLRPGVKESVKNCQQSGVTVRMITGDNITTGRAIARACGILS 756

Query: 793 RGQYVHTITKVTRPEGAFNQLEYLKINRNACLLIDGESLGMFLKHYEQEFFDVVVHLPTV 852
             +Y      +  P                          +F K   ++  D    L   
Sbjct: 757 ESEYADHECAMEGP--------------------------VFRKLSRRQMMDAAPKLK-- 788

Query: 853 IACRCTPQQKADVALVIRKMTGKRVCCIGDGGNDVSMIQCADVG--VGIVG 901
           +  R +P+ K     +++KM  + V   GDG ND   +  ADVG  +GI G
Sbjct: 789 VLARSSPEDKRIFVDILKKMN-EVVAVTGDGTNDAPALTLADVGFSMGISG 838

>YGL006W (PMC1) [1966] chr7 (485923..489444) Vacuolar
           Ca2+-transporting P-type ATPase, member of the cation
           transporting (E1-E2) P-type ATPase superfamily,
           functions to pump Ca2+ into the vacuole [3522 bp, 1173
           aa]
          Length = 1173

 Score = 92.8 bits (229), Expect = 8e-19,   Method: Compositional matrix adjust.
 Identities = 184/775 (23%), Positives = 308/775 (39%), Gaps = 150/775 (19%)

Query: 272 VGDLIKVHKGDRIPADLVLLQSSEPSGESFIKTDQLDGETDWKLRVACPLTQNLSENDLI 331
           VGD+I +  GD +PAD V++     + ES I      GE++   +   P+  +L +    
Sbjct: 212 VGDVISLQTGDVVPADCVMISGKCEADESSIT-----GESNTIQKF--PVDNSLRDFKKF 264

Query: 332 NRISITASAPEKSIHKFLGKVTYKDSTSNPLSVDNTLWANTVLASSGFCIACVVYTGRDT 391
           N  SI +    K +   +G V   +   N ++    +  + +L+  G  +   V      
Sbjct: 265 N--SIDSHNHSKPLD--IGDV---NEDGNKIADCMLISGSRILSGLGRGVITSVGINSVY 317

Query: 392 RQAMNTTTAKVKTGLLELEINSISKILC--ACVFALSILLVAF-----------AGFHND 438
            Q M +  A+ ++  L+L ++ ++  +    CV A+ + LV F             FH+ 
Sbjct: 318 GQTMTSLNAEPESTPLQLHLSQLADNISVYGCVSAIILFLVLFTRYLFYIIPEDGRFHDL 377

Query: 439 DWYIDILRYLILFST---IIPVSLRVNLDLAKSVYAHQIEHDKTIPETIVRTSTIPEDLG 495
           D      +++ +F T   +I V++   L LA ++         T    +VR     E +G
Sbjct: 378 DPAQKGSKFMNIFITSITVIVVAVPEGLPLAVTLALAFATTRMTKDGNLVRVLRSCETMG 437

Query: 496 RIEYLLSDKTGTLTQNDMQLKKIHLGTVSYTSETLDIVSDYVQSLVSSKNDSLNNSKV-- 553
               + SDKTGTLT+N M + +   G   +         D  +SL  S+   LN+ KV  
Sbjct: 438 SATAVCSDKTGTLTENVMTVVRGFPGNSKF---------DDSKSLPVSEQRKLNSKKVFE 488

Query: 554 --ALSTTRKDM---------SFRVRD-------------MILTLAI---CHNVTPTF--- 583
               S+ R D+         +F  RD             M   L+    C +    F   
Sbjct: 489 ENCSSSLRNDLLANIVLNSTAFENRDYKKNDKNTNGSKNMSKNLSFLDKCKSRLSFFKKG 548

Query: 584 --EDDE---LTYQAASPDEIAIVKFTESVGLSLFKR----DRHSISLLHEHSGKTLNYE- 633
             EDDE            E  I   TE+  LSL +         +  L +   +  N E 
Sbjct: 549 NREDDEDQLFKNVNKGRQEPFIGSKTETALLSLARLSLGLQPGELQYLRDQPMEKFNIEK 608

Query: 634 ILQVFPFNSDSKRMGIIVRDEQLDE----YWFMQKGADTVMSKIVE----SNDWLEE--- 682
           ++Q  PF S  K  G++V+ ++       Y F  KGA  ++SK       S+D LEE   
Sbjct: 609 VVQTIPFESSRKWAGLVVKYKEGKNKKPFYRFFIKGAAEIVSKNCSYKRNSDDTLEEINE 668

Query: 683 --------ETGNMAREGLRTLVIGRK---KLNKKIYEQFQKE--YNDASLSMLNRDQQMS 729
                   E  N+A + LR + +  K   + +    EQ + +   N A+L +L   Q+  
Sbjct: 669 DNKKETDDEIKNLASDALRAISVAHKDFCECDSWPPEQLRDKDSPNIAALDLLFNSQK-- 726

Query: 730 QVITKYLEHDLELLGLTGVEDKLQKDVKSSIELLRNAGIKIWMLTGDKVETARCVSISAK 789
                     L L GL G++D L+  V+ S++  + AG+ + M+TGD +       ++AK
Sbjct: 727 ---------GLILDGLLGIQDPLRAGVRESVQQCQRAGVTVRMVTGDNI-------LTAK 770

Query: 790 LISRGQYVHTITKVTRPEGAFNQLEYLKINRNACLLIDGESLGMFLKHYEQEFFDVVVHL 849
            I+R   + +    +    A    E+ K+ +N  + I                      L
Sbjct: 771 AIARNCAILSTDISSEAYSAMEGTEFRKLTKNERIRI----------------------L 808

Query: 850 PTV-IACRCTPQQKADVALVIRKMTGKRVCCIGDGGNDVSMIQCADVG--VGIVGKEGKQ 906
           P + +  R +P+ K  +   ++ M G  V   GDG ND   ++ ADVG  +GI G E  +
Sbjct: 809 PNLRVLARSSPEDKRLLVETLKGM-GDVVAVTGDGTNDAPALKLADVGFSMGISGTEVAR 867

Query: 907 ASLAADFSITQFCHLTELLLWHGRNSYKRSAKLAQFVMHRGLIIAICQAVYSICS 961
            +         F  +   + W GR       K  QF +   +   I   V S+ S
Sbjct: 868 EASDIILMTDDFSAIVNAIKW-GRCVSVSIKKFIQFQLIVNITAVILTFVSSVAS 921

>KLLA0F20658g 1919851..1923099 similar to sp|Q12691 Saccharomyces
           cerevisiae YDR038c ENA5 P-type ATPase involved in Na+
           efflux, start by similarity
          Length = 1082

 Score = 91.7 bits (226), Expect = 2e-18,   Method: Compositional matrix adjust.
 Identities = 127/504 (25%), Positives = 210/504 (41%), Gaps = 99/504 (19%)

Query: 453 TIIPVSLRVNLDLAKSVYAHQIEHDKTIPETIVRTSTIPEDLGRIEYLLSDKTGTLTQND 512
           ++IP SL V L +  S  A  +         IVR     E LG +  + SDKTGTLTQ  
Sbjct: 323 SMIPSSLVVVLTITMSAGAKVM----ATRNVIVRKLDSLEALGAVNDICSDKTGTLTQGK 378

Query: 513 MQLKKIHLG-----TVSYTSETLDIVSDYVQ-----SLVSSKNDSLNNSKVA-------L 555
           M  K++ +      TV  ++E  +     +      S    K+D   +  +        L
Sbjct: 379 MIAKQVWIPQFGTITVQESNEPFNPTIGEIHLIPKFSPYQYKHDDEEDVGIIPDFKSKYL 438

Query: 556 STTRKDMSFRVRDMILTLAICHNVTPTFEDDELTYQAA--SPDEIAIVKFTESVGLSLFK 613
           +     ++  + D  L  A   N+   F+D E     A   P EIAI  F   + L    
Sbjct: 439 AGELGPLNVSLFDQWLYTATLANIATVFQDSETQDWKAHGDPTEIAIQVFATRMDLP--- 495

Query: 614 RDRHSISLLHEHSGKTL----NYEILQVFPFNSDSKRMGIIVRDEQ-------------- 655
             RH ++   +   K      ++E +  FPF+S  KRM  I ++ +              
Sbjct: 496 --RHVLTGEDKDDEKDARANSSFEHVAEFPFDSSVKRMSAIYKNTEDPATPIYEVFTKGA 553

Query: 656 -------LDEYWFMQKGADTVMSKIVESNDWLEEETGNMAREGLRTLVIGRKKLNKKIYE 708
                   D ++    G  + +SK  E  + +++    ++ EGLR L   +K  N     
Sbjct: 554 FERVLQCCDSWYTTPDGKPSPLSK--EDLETIQKNVDTLSSEGLRVLAFAKKSFN----- 606

Query: 709 QFQKEYNDASLSMLNRDQQMSQVITKYLEHDLELLGLTGVEDKLQKDVKSSIELLRNAGI 768
             + E+N       N+D+ + +    ++E  L  LGL G+ D  +++  ++++    AGI
Sbjct: 607 --ESEFN------ANKDKLLKE--RDFVECKLTFLGLIGIYDPPRQESLAAVKKCHQAGI 656

Query: 769 KIWMLTGDKVETARCVSISAKLISRGQYVHTITKVTRPEGAFNQLEYLKINRNACLLIDG 828
            + MLTGD   TA+ ++    ++    Y H   +V              +N       D 
Sbjct: 657 NVHMLTGDFPGTAKSIAQEVGILPHNLY-HYPKEV--------------VNFMVMAATDF 701

Query: 829 ESLGMFLKHYEQEFFDVVVHLPTVIACRCTPQQKADVALVIRKMTGKRVCCI-GDGGNDV 887
           ++L       +QE  D+ V LP VIA RC PQ K  +   + + +  + C + GDG ND 
Sbjct: 702 DALS------DQEIDDLRV-LPLVIA-RCAPQTKVRMIEALHRRS--KFCAMTGDGVNDS 751

Query: 888 SMIQCADVGV--GIVGKE-GKQAS 908
             ++ A+VG+  GI G +  K AS
Sbjct: 752 PSLKIANVGIAMGINGSDVAKDAS 775

 Score = 32.3 bits (72), Expect = 2.5,   Method: Compositional matrix adjust.
 Identities = 18/39 (46%), Positives = 24/39 (61%), Gaps = 2/39 (5%)

Query: 257 HVITRNR--SIPSKDLKVGDLIKVHKGDRIPADLVLLQS 293
           HVI      +I SK+L  GD+  +  GD +PADL LL+S
Sbjct: 133 HVIRDGNDITIQSKELVPGDICIIKVGDTVPADLRLLES 171

>CAGL0I04312g complement(382354..385209) highly similar to sp|P13586
           Saccharomyces cerevisiae YGL167c PMR1 Ca2+-transporting
           P-type ATPase, start by similarity
          Length = 951

 Score = 90.5 bits (223), Expect = 4e-18,   Method: Compositional matrix adjust.
 Identities = 166/757 (21%), Positives = 300/757 (39%), Gaps = 171/757 (22%)

Query: 195 KFFYNLY---FLVVALSQAVPALRIGYLSSYI-VPLAFVLTVTMAKEAXXXXXXXXXXXE 250
           KF  N      +++ +  A+ ++ +G +   I + +A V+ VT+               E
Sbjct: 95  KFLSNFVEDRLILLLMGSAIISVFLGNIDDAISITMAIVIVVTVG---FVQEYRSEKSLE 151

Query: 251 SNNELY----HVI--TRNRSIPSKDLKVGDLIKVHKGDRIPADLVLLQSSEPSGESFIKT 304
           + N+L     H+I   R  ++ + +L  GDL++   GDRIPAD+ +++ ++ +    I  
Sbjct: 152 ALNKLVPQECHLIRGGRESNVLATNLVPGDLVRFRIGDRIPADIRIIECNDLT----IDE 207

Query: 305 DQLDGETDWKLRVACPLTQNLSENDLINRISITASAPEKSIHKFLGKVTYKDSTSN--PL 362
             L GETD                            P    +K L + +Y D  ++  P+
Sbjct: 208 SNLTGETD----------------------------PVHKSYKALSRDSYNDQPNSIVPV 239

Query: 363 SVDNTLWANTVLASSGFCIACVVYTGRDTRQA----MNTTTAKVKTGLLELEINSISKIL 418
           +    +     L   G     VV TGR+T       M ++  K KT  L+L ++ + K L
Sbjct: 240 AERTNIAYMGTLVKEGNGRGIVVGTGRETSFGNVFEMMSSIEKPKTP-LQLTMDKLGKDL 298

Query: 419 CACVFALSILLVAFAGFHNDDWYIDILRYLILFSTIIPVSLRVNLDLAKSVYAHQIEHDK 478
               F +  ++          W       + L    IP  L + + +  ++   ++   K
Sbjct: 299 SLASFVVIGIICVVGIIQGRSWLEMFQISVSLAVAAIPEGLPIIVTVTLALGVLRMAKRK 358

Query: 479 TIPETIVRTSTIPEDLGRIEYLLSDKTGTLTQNDMQLKKI-HLGTVSYTSETLDIVSDYV 537
                IVR     E LG +  + SDKTGTLT N M + KI  LG+++     L       
Sbjct: 359 ----AIVRRLPSVETLGSVNVICSDKTGTLTSNHMTVSKIWCLGSMANKLNVL------- 407

Query: 538 QSLVSSKNDSLNNSKVALSTTRKDMSFRVRDMILTLAICHNVTPTFEDDELTYQAASPDE 597
            SL  +K  +L N           ++  V+  +L   +C+N   ++  +   Y   +P +
Sbjct: 408 -SLDKNKGGNLKNY----------LTDDVKTTLLCGNLCNNA--SYSQEHAKY-LGNPTD 453

Query: 598 IAIVKFTESVGLSLFKRDRHSISLLHEHSGKTLNYEILQVFPFNSDSKRMGIIVRDEQLD 657
           +A+++  +   L+  + +                Y  ++   FNS  K M   ++D +  
Sbjct: 454 VALLEQLQKFELADVRSE----------------YTKVKELSFNSKRKMMATKIQDNEKK 497

Query: 658 EYWFMQKGADTVMSKIVESNDWLEEE-----------------TGNMAREGLRTLVIGRK 700
              F++   + ++ K   S+ +L E+                    +A EGLR L   ++
Sbjct: 498 TTLFIKGAFERILDK---SSSYLTEKGKIEKLTAGHRETIIDCANTLASEGLRVLAFAKR 554

Query: 701 KLNKKIYEQFQKEYNDASLSMLNRDQQMSQVITKYLEHDLELLGLTGVEDKLQKDVKSSI 760
            +             D+S  ++  D             DL   GL G+ D  +  VK +I
Sbjct: 555 AM------------TDSSSKLVEDDIS-----------DLVFTGLIGMNDPPRSSVKFAI 591

Query: 761 ELLRNAGIKIWMLTGDKVETARCVSISAKLISRGQYVHTITKVTRPEGAFNQLEYLKINR 820
           +     GI I M+TGD   TA  V+I+ ++            V  P+ +           
Sbjct: 592 DQFLQGGIHIIMITGDSENTA--VNIARQI---------GIPVIDPKLS----------- 629

Query: 821 NACLLIDGESLGMFLKHYEQEFFDVVVHLPTVIACRCTPQQKADVALVIRKMTGKRVCCI 880
               ++ G+ L    +  + +  +V+ H+   I  R TP+ K ++   +R+  G  V   
Sbjct: 630 ----VLSGDKLN---EMTDDQLANVIDHVN--IFARATPEHKLNIVRALRR-RGDVVAMT 679

Query: 881 GDGGNDVSMIQCADVGVGIVGKEGKQ-ASLAADFSIT 916
           GDG ND   ++ AD+GV + G+ G   A  A+D  +T
Sbjct: 680 GDGVNDAPALKLADIGVSM-GRMGTDVAKEASDMILT 715

>CAGL0M11308g 1110211..1114569 similar to sp|Q12697 Saccharomyces
            cerevisiae YOR291w, hypothetical start
          Length = 1452

 Score = 90.9 bits (224), Expect = 4e-18,   Method: Compositional matrix adjust.
 Identities = 175/789 (22%), Positives = 306/789 (38%), Gaps = 150/789 (19%)

Query: 264  SIPSKDLKVGDLIKVHKGDR--IPADLVLLQSSEPSGESFIKTDQLDGETDWKLRVACPL 321
            SI S +L  GD+ ++   +   +P D +LL     SG+  +    L GE+        P+
Sbjct: 551  SIHSSELVPGDIYEISDPNLNLLPCDSILL-----SGDCIVNESMLTGES-------VPV 598

Query: 322  TQNLSENDLINRISITASAPEKSIHKFLGKVTYKDSTSNPLSVDNTLWANTVLASSGFCI 381
            ++  +  + I  + +        I  FL K    + T        TL    +       +
Sbjct: 599  SKYPASEETI--LQLFDDFQSTQISTFLSKSFLFNGT--------TLIRAKIPNGGSVAL 648

Query: 382  ACVVYTG-RDTRQAMNTTTAKVKTGLLELEINSISKILCACV---FALSILLVAFAGFHN 437
            A  V TG   T+ ++  +    K    +   +S   I    +   F  SI  + F     
Sbjct: 649  AMAVRTGFSTTKGSLIRSMVFPKPSGFKFYSDSFKYIGFMAIIAFFGFSISCINFIKLGL 708

Query: 438  DDWYIDILRYLILFSTIIPVSLRVNLDLAKSVYAHQIEHDKTIPETIVRTSTIPEDLGRI 497
            D   + ILR L + + ++P +L   L +  S   ++++          R +      G+I
Sbjct: 709  DKRTM-ILRALDIITIVVPPALPATLTIGTSFALNRLKEKGIFCIAPTRVNI----GGKI 763

Query: 498  EYLLSDKTGTLTQNDMQLKKIHLGTVSYTSETLDIVSDYVQSLVSSKNDSLNNSKVALST 557
            + +  DKTGTLT++ + +    LG     + T +  S     L+S  +D     K +L  
Sbjct: 764  DVMCFDKTGTLTEDGLDV----LGVRVSCAATRNKAS--FSDLISDTHDIF--PKFSLKD 815

Query: 558  TRKDMSFRVRDMILTLAICHNVTPTFEDDELTYQAASPDEIAIVKFTESVGLSLFKRD-- 615
                  ++ R+ +++L  CH++     D EL      P +  + +FT   G S ++ D  
Sbjct: 816  CSNPDDYKRRNFLISLLTCHSLRVV--DGELL---GDPLDFKMFQFT---GWS-YEEDFQ 866

Query: 616  RHSISLLHEHSGKTLNYE-------------------------------ILQVFPFNSDS 644
             H    L+E   +  N+                                I++ F F S+ 
Sbjct: 867  NHQFHSLYEERHEGQNFPENNDIIPAIVHPNDSDERNKFVQNDPNNILGIIRSFEFLSEL 926

Query: 645  KRMGIIVRDEQLDEYWFMQKGADTVMSKIVE----SNDWLEEETGNMAREGLRTLVIGRK 700
            +RM +IV+    + YW   KGA  V+  I       +D+ ++        G R +    K
Sbjct: 927  RRMSVIVKPNNENVYWAYTKGAPEVIIDICNPATLPSDY-DDILNFYTHSGYRVIACAGK 985

Query: 701  KLNKKIYEQFQKEYNDASLSMLNRDQQMSQVITKYLEHDLELLGLTGVEDKLQKDVKSSI 760
             L K  +   QK         + R++         +E ++E LG    ++KL+     ++
Sbjct: 986  TLPKNTWLYSQK---------VRREE---------VESNMEFLGFIIFQNKLKDATSPTL 1027

Query: 761  ELLRNAGIKIWMLTGDKVETARCVSISAKLISRGQ-YVHTIT-------------KVTRP 806
              L+ A I+  M TGD V TA  V    +LI+  + YV T+              +++  
Sbjct: 1028 SKLKTANIRTVMCTGDNVLTAISVGKECQLITEDRVYVPTVAYSDMTVQPVIHWNEISNA 1087

Query: 807  EGAFNQLEYLKINRNA---CLLIDGESLGMFLK---HYEQEFFDVVVHLPTVIACRCTPQ 860
            E   +      I+  +    L I GE   +      +Y +E+ + ++ L   I  R +P 
Sbjct: 1088 EHILDTFTLQPIDDYSGPYTLAITGEVFRIIFSNQDNYSEEYVNEIL-LKGSIFARMSPD 1146

Query: 861  QKADVALVIRKMTGKRVCCIGDGGNDVSMIQCADVGVGIVGKEGKQASLAADFSITQF-- 918
            +K ++   ++KM      C GDG ND   ++ ADVG+ +   E   AS+AA F+   F  
Sbjct: 1147 EKHELVEQLQKMDYTVGFC-GDGANDCGALKAADVGISLSEAE---ASVAAPFTSKIFDI 1202

Query: 919  -CHLTELLLWHGRNSYKRSAKLAQF--------------VMHRGLIIAICQAVYSICSLF 963
             C L   ++  GR S   S    Q+              +  RG  +   Q +Y    L 
Sbjct: 1203 TCVLD--VIKEGRASLVTSFACFQYMSLYSAIQFISITILYSRGSNLGDFQFLYIDLLLI 1260

Query: 964  EPIALYQGW 972
             PIA+   W
Sbjct: 1261 IPIAVTMSW 1269

>Kwal_47.17547
          Length = 1240

 Score = 89.0 bits (219), Expect = 1e-17,   Method: Compositional matrix adjust.
 Identities = 180/792 (22%), Positives = 300/792 (37%), Gaps = 144/792 (18%)

Query: 250 ESNNELYHVITRNRS---IPSKDLKVGDLIKVHKGDRIPADLVLLQSSEPSGESFIKTDQ 306
           +  N+   ++ RN     I   D+ VGD++ +  GD +PAD +L++ S    ES      
Sbjct: 181 DKKNDREVIVLRNGDEHLISIHDILVGDILSLQTGDVVPADCILVKGSCECDES-----A 235

Query: 307 LDGETDWKLRVACPLT----QNLSENDLINRISITASAPEKSIHKFLGKVTYKDSTSNPL 362
           L GE+    + A  +     + LS  D    I I     EK                +P+
Sbjct: 236 LTGESATIKKAAIDVCYEKYKQLSATDAA--IDIGTPGAEK--------------VPDPM 279

Query: 363 SVDNTLWANTVLASSGFCIACVVYTGRDTRQAMNTTTAKVKTGLLELE------INSISK 416
            +  +         SG   A V   G ++         KV+     L+       NSIS 
Sbjct: 280 LISGSKLL------SGLGRAVVTSVGVNSMHGRTLMALKVEAETTPLQERLDSLANSISV 333

Query: 417 ILCACVFALS-ILLVAF-AGFHNDDWYIDIL------RYLILFS---TIIPVSLRVNLDL 465
              A    L  IL + F A         D+       R++ +F    T+I V++   L L
Sbjct: 334 YGSAAALLLFFILFMRFLANLKKGGELHDLTPAQKGSRFMNIFIVGITVIVVAVPEGLPL 393

Query: 466 AKSVYAHQIEHDKTIPETIVRTSTIPEDLGRIEYLLSDKTGTLTQNDMQLKKIHLGTV-- 523
           A ++              +VR     E +G    + SDKTGTLT+N M + K  LG+   
Sbjct: 394 AVTLALAFATTRMAKDGNLVRVLRACETMGSATAVCSDKTGTLTENRMTVVKGFLGSTFF 453

Query: 524 ----------SYTSETLDIVSDYVQSLVSSKNDSLNNSKVALSTTRKDMSFRVRDMILTL 573
                     S T   L I ++  + L   K D L N  + L++T  +      D +   
Sbjct: 454 DEAESVGPSDSETDVDLAIANECSEEL---KKDVLTN--ITLNSTAFENKENEEDKVSNE 508

Query: 574 AICHNVTPTF-------------EDDELTYQAAS--PDEIAIVKFTESVGLSLFKRDRHS 618
              H    +                 EL   AA+  P E  +   TE+  L+  +++   
Sbjct: 509 NPFHKPRKSLFPWSRNNKSKKPATAKELVENAAADQPKEPFLGSKTETALLAFAQKNLGM 568

Query: 619 ISLLH-EHSGKTLNYE-ILQVFPFNSDSKRMGIIVR-DEQLDEYWF-----------MQK 664
            +L H       L  E I+Q+ PF S  K  GI+V+    L  ++            MQK
Sbjct: 569 QNLHHYRDEPDCLGIEKIVQIIPFESSRKWGGIVVKYKNGLHRFYIKGAAELLLRRCMQK 628

Query: 665 GADTVMSKIVESNDWLEEETG--NMAREGLRTLVIGRKKLNK-------KIYEQFQKEYN 715
            A      ++   D+ EE     N+A E LR + +  +           ++ ++ + E  
Sbjct: 629 RASDSKLTLISQKDFDEESQTITNLAAEALRAISLAHRDYPNCPNWPPSELQDEVEPEAA 688

Query: 716 DASL---SMLNRDQQMSQVITKYLEHDLELLGLTGVEDKLQKDVKSSIELLRNAGIKIWM 772
              L     ++R   +S+   + L   + L G+ G++D L+K V+ S+E  + AG+ + M
Sbjct: 689 SPDLLFGDEVSRSDSVSEP-AQELVSPMVLDGIVGIQDPLRKGVRKSVEQCQKAGVTVRM 747

Query: 773 LTGDKVETARCVSISAKLISRGQYVHTITKVTRPEGAFNQLEYLKINRNACLLIDGESLG 832
           +TGD + TA  ++    ++S  Q          PE +     + K++    + I      
Sbjct: 748 VTGDNILTATAIAKKCSILSEEQ-------AENPESSMEGPRFRKLSNKERVRI------ 794

Query: 833 MFLKHYEQEFFDVVVHLPTV-IACRCTPQQKADVALVIRKMTGKRVCCIGDGGNDVSMIQ 891
                           LP + +  R +P+ K  +   ++KM G  V   GDG ND   ++
Sbjct: 795 ----------------LPNLRVLARSSPEDKRILVETLKKM-GDVVAVTGDGTNDAPALK 837

Query: 892 CADVG--VGIVGKEGKQASLAADFSITQFCHLTELLLWHGRNSYKRSAKLAQFVMHRGLI 949
            ADVG  +GI G E  + +         F  +   + W GR       K  QF +   + 
Sbjct: 838 LADVGFSMGIAGTEVAREASDIILMTDDFSAIVNAIKW-GRCVSTSIKKFIQFQLTVNVT 896

Query: 950 IAICQAVYSICS 961
             +   V ++ S
Sbjct: 897 AVVLTFVSAVAS 908

>YGL167C (PMR1) [1823] chr7 complement(187620..190472)
           Ca2+-transporting P-type ATPase of Golgi membrane
           involved in Ca2+ and Mn2+ import into Golgi [2853 bp,
           950 aa]
          Length = 950

 Score = 87.4 bits (215), Expect = 3e-17,   Method: Compositional matrix adjust.
 Identities = 164/662 (24%), Positives = 268/662 (40%), Gaps = 150/662 (22%)

Query: 273 GDLIKVHKGDRIPADLVLLQSSEPSGESFIKTDQLDGETDWKLRVACPLTQNLSENDLIN 332
           GDL+    GDRIPAD+ ++++ + S    I    L GE +   + +  + ++ S ND  N
Sbjct: 172 GDLVHFRIGDRIPADIRIIEAIDLS----IDESNLTGENEPVHKTSQTIEKS-SFNDQPN 226

Query: 333 RISITASAPEKSIHKFLGKVTYKDSTSNPLSVDNTLWANTVLASSGFCIACVVYTGRDTR 392
            I       E+S   ++G                       L   G     VV TG +T 
Sbjct: 227 SI---VPISERSCIAYMG----------------------TLVKEGHGKGIVVGTGTNTS 261

Query: 393 QA----MNTTTAKVKTGLLELEINSISKILCACVFALSILLVAFAGFHNDDWYIDILRYL 448
                 M     K KT L +L ++ + K L    F + I ++   G      ++++ +  
Sbjct: 262 FGAVFEMMNNIEKPKTPL-QLTMDKLGKDLSLVSF-IVIGMICLVGIIQGRSWLEMFQIS 319

Query: 449 I-LFSTIIPVSLRVNLDLAKSVYAHQIEHDKTIPETIVRTSTIPEDLGRIEYLLSDKTGT 507
           + L    IP  L + + +  ++   ++   K I    VR     E LG +  + SDKTGT
Sbjct: 320 VSLAVAAIPEGLPIIVTVTLALGVLRMAKRKAI----VRRLPSVETLGSVNVICSDKTGT 375

Query: 508 LTQNDMQLKKIHLGTVSYTSETLDIVSDYVQSLVSSKNDSLNNSKVALSTTRKDMSFRVR 567
           LT N M + K+           LD +S+ +  L   KN    NS   L   +  ++  VR
Sbjct: 376 LTSNHMTVSKLW---------CLDSMSNKLNVLSLDKNKKTKNSNGNL---KNYLTEDVR 423

Query: 568 DMILTLAICHNVTPTFEDDELTYQAASPDEIAIVKFTESVGLSLFKRDRHSISLLHEHSG 627
           + +    +C+N +  F  +   +   +P ++A++   E +        R+++  + E   
Sbjct: 424 ETLTIGNLCNNAS--FSQEHAIF-LGNPTDVALL---EQLANFEMPDIRNTVQKVQE--- 474

Query: 628 KTLNYEILQVFPFNSDSKRMGIIVRD--------------EQLDEY---WFMQKGADTVM 670
                      PFNS  K M   + +              E++ EY   +   KG  T  
Sbjct: 475 ----------LPFNSKRKLMATKILNPVDNKCTVYVKGAFERILEYSTSYLKSKGKKT-- 522

Query: 671 SKIVESNDWLEEETGN-MAREGLRTLVIGRKKLNKKIYEQFQKEYNDASLSMLNRDQQMS 729
            K+ E+      E  N MA EGLR  V G  KL            +D+S  +        
Sbjct: 523 EKLTEAQKATINECANSMASEGLR--VFGFAKLT----------LSDSSTPL-------- 562

Query: 730 QVITKYLEHDLELLGLTGVEDKLQKDVKSSIELLRNAGIKIWMLTGDKVETARCVSISAK 789
              T+ L  DL   GL G+ D  + +VK +IE L   G+ I M+TGD   TA  V+I AK
Sbjct: 563 ---TEDLIKDLTFTGLIGMNDPPRPNVKFAIEQLLQGGVHIIMITGDSENTA--VNI-AK 616

Query: 790 LISRGQYVHTITKVTRPEGAFNQLEYLKINRNACLLIDGESLGMFLKHYEQEFFDVVVHL 849
            I           V  P+ +               ++ G+ L    +  + +  +V+ H+
Sbjct: 617 QIG--------IPVIDPKLS---------------VLSGDKLD---EMSDDQLANVIDHV 650

Query: 850 PTVIACRCTPQQKADVALVIRKMTGKRVCCIGDGGNDVSMIQCADVGV--GIVGKE-GKQ 906
              I  R TP+ K ++   +RK  G  V   GDG ND   ++ +D+GV  G +G +  K+
Sbjct: 651 N--IFARATPEHKLNIVRALRK-RGDVVAMTGDGVNDAPALKLSDIGVSMGRIGTDVAKE 707

Query: 907 AS 908
           AS
Sbjct: 708 AS 709

>KLLA0E14630g complement(1297636..1300884) similar to sp|Q01896
           Saccharomyces cerevisiae YDR039c ENA2 P-type ATPase
           involved in Na+ efflux, hypothetical start
          Length = 1082

 Score = 86.3 bits (212), Expect = 9e-17,   Method: Compositional matrix adjust.
 Identities = 141/562 (25%), Positives = 230/562 (40%), Gaps = 113/562 (20%)

Query: 453 TIIPVSLRVNLDLAKSVYAHQIEHDKTIPETIVRTSTIPEDLGRIEYLLSDKTGTLTQND 512
           ++IP SL V L +  S  A  +         I+R     E LG +  + SDKTGTLTQ  
Sbjct: 323 SMIPSSLVVVLTITMSAGAKVM----ATRHVIIRKLDSLEALGAVNDICSDKTGTLTQGK 378

Query: 513 MQLKKI---HLGTVSY--TSETLDIVSDYVQ-----SLVSSKNDSLNNSKVALSTTRKD- 561
           M  K++     GT++   ++E  +     +Q     S    K+D  +   V + T  K  
Sbjct: 379 MIAKQVWIPQFGTINVQNSNEPFNPTIGEIQLIPKFSPYQYKHD--DEEDVGMITDFKSK 436

Query: 562 --------MSFRVRDMILTLAICHNVTPTFEDDELTYQAA--SPDEIAIVKFTESVGLS- 610
                   ++  +    L  A   N+   F D E     A   P EIAI  F   + L  
Sbjct: 437 YYADELGPLNVSLFTQWLYTATLANIATVFRDPETQDWKAHGDPTEIAIQVFATRMDLPR 496

Query: 611 --LFKRDRHSISLLHEHSGKTLNYEILQVFPFNSDSKRMGII---VRDEQLDEYWFMQKG 665
             L   D      +H      + +E +  +PF+S  KRM  I   V + +   Y    KG
Sbjct: 497 RVLTGEDNDDEKNIHND----ITFEHVAEYPFDSSVKRMSAIYKNVEEPKAPIYEVFTKG 552

Query: 666 ADTVMSKIVES-NDWLEEETGN------------------MAREGLRTLVIGRKKLNKKI 706
           A     ++++  N W     G+                  ++ EGLR L   +K  N+  
Sbjct: 553 A---FERVLQCCNSWYTTPDGSPQPLTEEDLETVQKNVDTLSSEGLRVLAFAKKTFNES- 608

Query: 707 YEQFQKEYNDASLSMLNRDQQMSQVITKYLEHDLELLGLTGVEDKLQKDVKSSIELLRNA 766
             QF           +N+D+ + +    ++E++L  LGL G+ D  +++  ++++    A
Sbjct: 609 --QFT----------INKDKLLKE--RDFVENNLTFLGLVGIYDPPRRESLAAVKKCHLA 654

Query: 767 GIKIWMLTGDKVETARCVSISAKLISRGQYVHTITKVTRPEGAFNQLEYLKINRNACLLI 826
           GI + MLTGD   TA+ ++    ++    Y +       P+   N +     + +A  L 
Sbjct: 655 GINVHMLTGDFPGTAKSIAQEVGILPHNLYHY-------PKEVVNFMVMTATDFDA--LS 705

Query: 827 DGESLGMFLKHYEQEFFDVVVHLPTVIACRCTPQQKADVALVIRKMTGKRVCCI-GDGGN 885
           D E              D +  LP VIA RC PQ K  +   + +    R C + GDG N
Sbjct: 706 DKE-------------IDELPVLPLVIA-RCAPQTKVRMIEALHRR--NRFCAMTGDGVN 749

Query: 886 DVSMIQCADVGV--GIVGKE-GKQAS--LAADFSITQFCHLTELLLWHGRNSYKRSAKLA 940
           D   ++ A+VG+  GI G +  K AS  + +D +     +  E     GR   + S  + 
Sbjct: 750 DSPSLKIANVGIAMGINGSDVAKDASDIVLSDDNFASILNAVE----EGR---RMSDNIQ 802

Query: 941 QFVMHRGLIIAICQAVYSICSL 962
           +FV+   L   + QA+Y +  L
Sbjct: 803 KFVLQL-LAENVAQALYLMVGL 823

>Kwal_14.1498
          Length = 939

 Score = 83.2 bits (204), Expect = 6e-16,   Method: Compositional matrix adjust.
 Identities = 151/669 (22%), Positives = 263/669 (39%), Gaps = 157/669 (23%)

Query: 273 GDLIKVHKGDRIPADLVLLQSSEPSGESFIKTDQLDGETDWKLRVACPLTQNLSENDLIN 332
           GD+++   GDRIPADL ++++ + S    I+   L GE +   +    + +   + +L +
Sbjct: 167 GDVVRFRVGDRIPADLRIIEAVDLS----IEESNLTGENEPVHKSTATVNKEFYKENLGS 222

Query: 333 RISITASAPEKSIHKFLGKVTYKDSTSNPLSVDNTLWANTVLASSGFCIACVVYTGRDTR 392
            + ++    E+S   F+G                       L   G     V+ T ++T 
Sbjct: 223 IVPVS----ERSCIAFMG----------------------TLVREGHGRGIVIGTAKNTA 256

Query: 393 QA----MNTTTAKVKTGLLELEINSISKILCACVFALSILLVAFAGFHNDDWY----IDI 444
                 M     K KT L +  ++ + K L    F +  ++          W     I +
Sbjct: 257 FGKVFEMMNAIEKPKTPL-QTAMDKLGKDLSFMSFIVIGIICLIGVIQGRSWLEMFQISV 315

Query: 445 LRYLILFSTIIPVSLRVNLDLAKSVYAHQIEHDKTIPETIVRTSTIPEDLGRIEYLLSDK 504
              +      +P+ + V L L     A +          I+R     E LG +  + SDK
Sbjct: 316 SLAVAAIPEGLPIIVTVTLALGVLRMAKR--------RAIIRRLPSVETLGSVNVICSDK 367

Query: 505 TGTLTQNDMQLKKI-HLGTVSYTSETLDIVSDYVQSLVSSKNDSLNNSKVALSTTRKDMS 563
           TGTLT N M + K+  LG++S  S  L +                   K    + +K+++
Sbjct: 368 TGTLTANHMSVNKVWCLGSMSNKSNILKL------------------DKATSGSFKKNLT 409

Query: 564 FRVRDMILTLAICHNVTPTFEDDELTYQAASPDEIAIVKFTESVGLSLFKRDRHSISLLH 623
             +R  + T  +C+N   T+  +   Y   +P +IA+++     GL   + +R  ++   
Sbjct: 410 EDLRATLRTGNLCNN--STYSHEHAKY-LGNPTDIALLEVLHKFGL---EDERPQVTRSD 463

Query: 624 EHSGKTLNYEILQVFPFNSDSKRMGIIVRDEQLDEYWFMQKGA-DTVM----------SK 672
           E S             FNS  K M + V+ E   ++    KGA + ++          +K
Sbjct: 464 EIS-------------FNSKRKFMAVKVK-EANGKFVVHVKGAYEKILEKSTHFINAENK 509

Query: 673 IVESNDWLEEETGN----MAREGLRTLVIGRKKLNKKIYEQFQKEYNDASLSMLNRDQQM 728
           +V+ +  L +   +    +A +GLRTL               Q E ++ +   L  D   
Sbjct: 510 VVKLDSNLRQAITDSADALASDGLRTLAFA------------QLELSNGNSKKLTEDDI- 556

Query: 729 SQVITKYLEHDLELLGLTGVEDKLQKDVKSSIELLRNAGIKIWMLTGDKVETARCVSISA 788
                    + L   GL G+ D  +  VK+++E L    + I M+TGD   TA  VSI+ 
Sbjct: 557 ---------NGLTFAGLLGMNDPPRPSVKAAVERLSEGSVHIIMITGDAENTA--VSIAR 605

Query: 789 KLISRGQYVHTITKVTRPEGAFNQLEYLKINRNACLLIDGESLGMFLKHYEQEFFDVVVH 848
           ++            V  PE A               ++ G+ L       E +   ++ H
Sbjct: 606 QI---------GIPVVNPETA---------------VLTGDKLDHM---SEDQLASIIDH 638

Query: 849 LPTVIACRCTPQQKADVALVIRKMTGKRVCCIGDGGNDVSMIQCADVGVGIVGKEGKQ-A 907
           +   I  R TP+ K ++   ++K  G  V   GDG ND   ++ AD+GV + GK G   A
Sbjct: 639 VN--IFARATPEHKLNIVRALQK-RGDIVAMTGDGVNDAPALKLADIGVSM-GKMGTDVA 694

Query: 908 SLAADFSIT 916
             A+D  +T
Sbjct: 695 KEASDMVLT 703

>AEL301W [2204] [Homologous to ScYGL167C (PMR1) - SH]
           complement(75104..77977) [2874 bp, 957 aa]
          Length = 957

 Score = 82.0 bits (201), Expect = 1e-15,   Method: Compositional matrix adjust.
 Identities = 148/653 (22%), Positives = 261/653 (39%), Gaps = 118/653 (18%)

Query: 273 GDLIKVHKGDRIPADLVLLQSSEPSGESFIKTDQLDGETDWKLRVACPLTQNLSENDLIN 332
           GDL+    GDRIPAD+ +++S++ S    +    L GET+   +   P+           
Sbjct: 178 GDLVYFKVGDRIPADVRIIESTDLS----LDESTLTGETEPVHKSCTPVNS--------- 224

Query: 333 RISITASAPEKSIHKFLGKVTYKDSTSN--PLSVDNTLWANTVLASSGFCIACVVYTGRD 390
                               TY D      P+    ++     L   G     VV TG+ 
Sbjct: 225 -------------------ATYSDVPGGIIPIGERTSIAYMGTLVREGHGKGIVVATGKH 265

Query: 391 TRQA----MNTTTAKVKTGLLELEINSISKILCACVFALSILLVAFAGFHNDDWYIDILR 446
           T       M  +  K KT L ++ ++++ + L    F LS ++          W      
Sbjct: 266 TMFGAVFEMMNSIEKPKTPL-QMAMDTLRRDLSYVRFVLSGIIFLLGVIQGRSWLEMFQI 324

Query: 447 YLILFSTIIPVSLRVNLDLAKSVYAHQIEHDKTIPETIVRTSTIPEDLGRIEYLLSDKTG 506
            + L    IP  L + + +  ++   ++ + K I    VR     E LG +  + SDKTG
Sbjct: 325 SVSLAVAAIPEGLPIIVTVTLALGVLRMANRKAI----VRRLPSVETLGSVNVICSDKTG 380

Query: 507 TLTQNDMQLKKI-HLGTVSYTSETLDIVSDYVQSLVSSKNDSLNNSKVALSTTRKDMSFR 565
           TLT N M   KI  LG+++  +  L        SL +  +  L      L   +  +S  
Sbjct: 381 TLTANHMTASKIWCLGSMANKNNVL--------SLEAKSSGGLPGK---LPNLKNYLSDD 429

Query: 566 VRDMILTLAICHNVTPTFEDDELTYQAASPDEIAIVKFTESVGLSLFKRDRHSISLLHEH 625
           V+  +   +IC+N   +F  +   Y   +P +IA+++  +   L   +     +  L  +
Sbjct: 430 VKATLRIGSICNNA--SFSHEHGKY-LGNPTDIALLEVLQKFDLVDERPTTTRVDELTFN 486

Query: 626 SGKTLNYEILQV-FPFNSDSKRMGIIVRDEQLDEYWFMQKGADTVMSKIVESNDWLEEET 684
           S +   Y  ++V  P NS    + +    E++ E      G    + K+ +S+  L  + 
Sbjct: 487 SKR--KYMAVKVDSPANSGKHIIYVKGAFERILERSASFIGGAGKVEKLSDSHKSLINDC 544

Query: 685 G-NMAREGLRTLVIGRKKLNKKIYEQFQKEYNDASLSMLNRDQQMSQVITKYLEHDLELL 743
             ++A EGLRTL   + + +        K  ND+++                   +L  +
Sbjct: 545 AKSLASEGLRTLAFAQLECST------NKPMNDSTI------------------QNLTFV 580

Query: 744 GLTGVEDKLQKDVKSSIELLRNAGIKIWMLTGDKVETARCVSISAKLISRGQYVHTITKV 803
           GL G++D  +  V+ +IE L   G+ + M+TGD   TA  V+I+ ++            V
Sbjct: 581 GLIGMKDPPRSTVRPAIEELLQGGVHVIMITGDAENTA--VNIARQI---------GIPV 629

Query: 804 TRPEGAFNQLEYLKINRNACLLIDGESLGMFLKHYEQEFFDVVVHLPTVIACRCTPQQKA 863
             PE +               ++ G+ L    +  + +   V+ H+   I  R TP+ K 
Sbjct: 630 INPEIS---------------VLTGDRLD---QMTDDQLAGVIDHVN--IFARATPEHKL 669

Query: 864 DVALVIRKMTGKRVCCIGDGGNDVSMIQCADVGVGIVGKEGKQASLAADFSIT 916
           ++   ++K  G  V   GDG ND   ++ AD+GV +       A  A+D  +T
Sbjct: 670 NIVRALQK-RGDIVAMTGDGVNDAPALKLADIGVAMGHMGTDVAKEASDMVLT 721

>Scas_707.48*
          Length = 741

 Score = 80.1 bits (196), Expect = 5e-15,   Method: Compositional matrix adjust.
 Identities = 158/669 (23%), Positives = 260/669 (38%), Gaps = 158/669 (23%)

Query: 273 GDLIKVHKGDRIPADLVLLQSSEPSGESFIKTDQLDGETDWKLRVACPLTQNLSENDLIN 332
           GDL+    GDRIPADL ++++ + S    I    L GE +                    
Sbjct: 172 GDLVHFKIGDRIPADLRIIEAVDLS----IDESNLTGENE-------------------- 207

Query: 333 RISITASAPEKSIHKFLGKVTYKDSTSN--PLSVDNTLWANTVLASSGFCIACVVYTGRD 390
                   P     K + K ++ D  ++  P+S    +     L   G     VV  G++
Sbjct: 208 --------PVHKSAKEVNKDSFNDQPNSIIPISDRTCVAYMGTLVKEGHGKGIVVGIGKN 259

Query: 391 TRQA----MNTTTAKVKTGLLELEINSISKILCACVFALSILLVAFAGFHNDDWYIDILR 446
           T       M +   K KT  L+  ++ + K L    F + I L+   G      ++++ +
Sbjct: 260 TSFGAIFEMLSNIEKPKTP-LQNAMDKLGKDLSLFSF-IVIGLICLVGILQGRSWLEMFQ 317

Query: 447 YLI-LFSTIIPVSLRVNLDLAKSVYAHQIEHDKTIPETIVRTSTIPEDLGRIEYLLSDKT 505
             + L    IP  L + + +  ++   ++   K     IVR     E LG +  + SDKT
Sbjct: 318 ISVSLAVAAIPEGLPIIVTVTLALGVLRMAKRK----AIVRRLPSVETLGSVNVICSDKT 373

Query: 506 GTLTQNDMQLKKIHLGTVSYTSETLDIVSDY--VQSLVSSKNDSLNNSKVALSTTRKDMS 563
           GTLT N M   KI           LD +++   V SL  SK+ SL N           ++
Sbjct: 374 GTLTSNHMTASKIW---------CLDSMANKANVLSLEKSKSGSLKNY----------LT 414

Query: 564 FRVRDMILTLAICHNVTPTFEDDELTYQAASPDEIAIVKFTESVGLSLFKRDRHSISLLH 623
             V+  +    IC+N   +F  +   Y   +P +IA+++      LS  +          
Sbjct: 415 EDVKSTLTIGNICNNA--SFSQEHGKY-LGNPTDIALLEQLSKFDLSDIRP--------- 462

Query: 624 EHSGKTLNYEILQVFPFNSDSKRMGIIVRDEQLDEYWFMQKGA-DTVMSKIVE------- 675
                   ++ +Q  PFNS  K M + + + +  +Y    KGA + V+S+          
Sbjct: 463 -------TFKKVQEIPFNSKRKFMAVKIVNSE-GKYSLCVKGAFEKVLSQCSHYLNQKGK 514

Query: 676 -------SNDWLEEETGNMAREGLRTLVIGRKKLNKKIYEQFQKEYNDASLSMLNRDQQM 728
                    D + E   ++A EGLR L   +  L                          
Sbjct: 515 TEKLTQGQRDVIIETANSLASEGLRMLAFAKTTL-----------------------PDS 551

Query: 729 SQVITKYLEHDLELLGLTGVEDKLQKDVKSSIELLRNAGIKIWMLTGDKVETARCVSISA 788
             ++T+    DL   GL G+ D  +  VK +IE L   G+ I M+TGD   TA  V+I+ 
Sbjct: 552 PTLLTEESVGDLIFTGLIGMNDPPRPTVKPAIEQLLQGGVHIIMITGDSENTA--VNIAR 609

Query: 789 KLISRGQYVHTITKVTRPEGAFNQLEYLKINRNACLLIDGESLGMFLKHYEQEFFDVVVH 848
           ++            V  P+   + L   K+N                +  + +  +V+ H
Sbjct: 610 QI---------GIPVLDPK--LSVLSGDKLN----------------EMSDDQLANVIDH 642

Query: 849 LPTVIACRCTPQQKADVALVIRKMTGKRVCCIGDGGNDVSMIQCADVGVGIVGKEGKQ-A 907
           +   I  R TP+ K ++   +RK  G  V   GDG ND   ++ AD+GV + G+ G   A
Sbjct: 643 VN--IFARATPEHKLNIVRALRK-RGDVVAMTGDGVNDAPALKLADIGVSM-GRMGTDVA 698

Query: 908 SLAADFSIT 916
             A+D  +T
Sbjct: 699 KEASDMVLT 707

>KLLA0A03157g complement(281313..284129) gi|3288523|emb|CAA04476.1
           Kluyveromyces lactis Ca++ ATPase, start by similarity
          Length = 938

 Score = 80.1 bits (196), Expect = 7e-15,   Method: Compositional matrix adjust.
 Identities = 164/697 (23%), Positives = 266/697 (38%), Gaps = 179/697 (25%)

Query: 252 NNELYHVITRNRSIPSKDLKVGDLIKVHKGDRIPADLVLLQSSEPSGESFIKTDQLDGET 311
           + +L HV+  N       L  GDL++   GDRIPADL +++S +                
Sbjct: 153 SGQLSHVLASN-------LVPGDLVRFKVGDRIPADLRIVESID---------------- 189

Query: 312 DWKLRVACPLTQNLSENDLINRISITASAPEKSIHKFLGKVTYKDSTSNPLSV-----DN 366
                  C    NL+  +             + +HK  G V  K+ +  P S+      N
Sbjct: 190 ------LCVDESNLTGEN-------------EPVHKSSGAVDPKNYSHIPGSIIPVGDRN 230

Query: 367 TLWANTVLASSGFCIACVVYTGRDTRQA----MNTTTAKVKTGLLELEINSISKILCACV 422
            +     L   G     V+ TG+ T       M +   K KT L +  ++ + + L    
Sbjct: 231 CIGFMGTLVREGHGKGIVIATGKHTVFGSVFEMMSGIDKPKTPL-QTAMDKLGQDLSYMS 289

Query: 423 FALSILLVAFAGFHNDDWYIDILRYLILFSTIIPVSLRVNLDLAKSVYAHQIEHDKTIPE 482
           F L  ++          W       + L    IP  L + + +  ++   ++   K I  
Sbjct: 290 FVLIGIICLIGIIQGRSWLEMFQIAVSLAVAAIPEGLPIIVTVTLALGVLRMAKRKAI-- 347

Query: 483 TIVRTSTIPEDLGRIEYLLSDKTGTLTQNDMQLKKI-HLGTVSYTSETLDIVSDYVQSLV 541
             VR     E LG +  + SDKTGTLT N M + KI  LG++   +  L           
Sbjct: 348 --VRRLPSVETLGSVNVICSDKTGTLTANHMTVSKIWCLGSMENKTNCL----------- 394

Query: 542 SSKNDSLNNSKVALSTTRKDMSFRVRDMILTLAI---CHNVTPTFEDDELTYQAASPDEI 598
                       ALS  ++      +D+  TL I   C+N   T+  + L Y   +P +I
Sbjct: 395 ------------ALSKVKERPIKMEQDVATTLRIGNICNN--GTYSQEHLKY-LGNPTDI 439

Query: 599 AIVKFTESVGLSLFKRDRHSISLLHEHSGKTLNYEILQVFPFNSDSKRMGIIVRDEQLDE 658
           AI++  +  G++     R+S++ ++E              PFNS  K M +   D   D+
Sbjct: 440 AILESLQHFGIN---DCRNSVNKINE-------------IPFNSKRKFMAVKTIDAN-DK 482

Query: 659 YWFMQKGADTVMSKIVES----------------ND--WLEEETGNMAREGLRTLVIGRK 700
                KGA     KIVE                 ND   + +    +A EGLRTL     
Sbjct: 483 VVVYVKGA---FEKIVEKSINYIGRDGKVHKLKPNDKAIINDAAVALASEGLRTLAFAEL 539

Query: 701 KLNKKIYEQFQKEYNDASLSMLNRDQQMSQVITKYLEHDLELLGLTGVEDKLQKDVKSSI 760
           +++        KE+N+                   +   L   GL  + D  +  V+S+I
Sbjct: 540 EVSAT---HGDKEFNED------------------MVEGLTFTGLIAMNDPPRPTVRSAI 578

Query: 761 ELLRNAGIKIWMLTGDKVETARCVSISAKLISRGQYVHTITKVTRPEGAFNQLEYLKINR 820
           E L    + + M+TGD   TA  VSI+ ++            V  PE +           
Sbjct: 579 EELLQGSVHVIMITGDAENTA--VSIARQIG---------IPVINPEYS----------- 616

Query: 821 NACLLIDGESLGMFLKHYEQEFFDVVVHLPTVIACRCTPQQKADVALVIRKMTGKRVCCI 880
               ++ G+ L    +  + +   V+ H+   +  R TP+ K ++   ++K  G  V   
Sbjct: 617 ----VLSGDKLD---QMTDDQLASVIDHVN--VFARATPEHKLNIVRALQK-RGDIVAMT 666

Query: 881 GDGGNDVSMIQCADVGVGIVGKEGKQ-ASLAADFSIT 916
           GDG ND   ++ AD+GV + GK G   A  A+D  +T
Sbjct: 667 GDGVNDAPALKLADIGVSM-GKMGTDVAKEASDMVLT 702

>AGL097C [4215] [Homologous to ScYDR039C (ENA2 ) - NSH]
           (520915..524205) [3291 bp, 1096 aa]
          Length = 1096

 Score = 79.3 bits (194), Expect = 1e-14,   Method: Compositional matrix adjust.
 Identities = 174/761 (22%), Positives = 300/761 (39%), Gaps = 155/761 (20%)

Query: 273 GDLIKVHKGDRIPADLVLLQSSEPSGESFIKTDQ--LDGETDWKLRVACPLTQNLS---E 327
           GD+++V  GD +PADL L+++        ++TD+  L GE       A P+ ++ +   E
Sbjct: 153 GDIVQVRVGDTVPADLRLVEALN------LETDEALLTGE-------ALPVAKDPAAVFE 199

Query: 328 ND--LINRISITASAPEKSIHKFLGKVTYKDSTSNPLSVDNTLWANTVLASSGFCIACVV 385
            D  + +R+++  ++   S  +  G V      S    +  +L     L S         
Sbjct: 200 QDTPVGDRLNLAFASSTVSKGRATGIVVRTGLRSEIGKIAESLQGKQSLIS--------- 250

Query: 386 YTGRD-TRQAMNTTTAKVKTGL-----------LELEINSISKILCACVFALSILLVAFA 433
              RD  +  +  T   VK  +           L  ++  ++ IL A     +++++A  
Sbjct: 251 ---RDENKSGLQNTVLTVKASVGSFLGTNVGTPLHRKLAKLALILFAIAVLFALIVMATQ 307

Query: 434 GFHNDDWYIDILRYLILFS-TIIPVSLRVNLDLAKSVYAHQIEHDKTIPETIVRTSTIPE 492
            F  +    ++  Y I  + ++IP SL V L +  S  A  +    +    IVR     E
Sbjct: 308 KFIVNR---EVAIYAICVALSMIPSSLVVVLTITMSAGAKVM----STRNVIVRRLDSLE 360

Query: 493 DLGRIEYLLSDKTGTLTQNDMQLKKI---HLGTVSYTSETLDI---VSDYVQSLVSS--- 543
            LG +  + SDKTGTLTQ  M LK++     GTV      +     V D   SL+     
Sbjct: 361 ALGAVNDICSDKTGTLTQGKMILKQLWVPEFGTVVVNRSNVPFDPTVGDV--SLIPRFSP 418

Query: 544 ---KNDSLNNSKVALS--------TTRKDMSFRVRDMILTLAICHNVTPTFED-DELTYQ 591
              ++D   +  +  +        +  K ++ R  +  L  A   N+   F+D D   ++
Sbjct: 419 WEYQHDEEEDVGIIANFKQRWQSNSLPKGLNPRKFESWLHTATLANIATVFKDSDSKEWR 478

Query: 592 A-ASPDEIAIVKFTESV-----GLSLFKRDRHSISLLHEHSGKTLNYEILQVFPFNSDSK 645
           A   P EIAI  F   +      L+  + +  S S     + +   YE    FPF+S  K
Sbjct: 479 AHGDPTEIAIQVFATRMDHPHHALTTEQDEEDSDSSQQNDAARI--YEHAAEFPFDSSIK 536

Query: 646 RMGII---VRDEQLDEY---------------WFMQKGADTVMSKIVESNDWLEEETGNM 687
           RM  +   +RD+                    W +  G         +  + +++    +
Sbjct: 537 RMSAVYINLRDKNTRHVFTKGAFERVLKCCTRWKLDPGTGVTHPLTEDDLEIIQKNVDTL 596

Query: 688 AREGLRTLVIGRKKLNKKIYEQFQKEYNDASLSMLNRDQQMSQVITKYLEHDLELLGLTG 747
           + EGLR L    K +  +  E   +         L +D+        ++E DL   GL G
Sbjct: 597 SNEGLRVLAFATKTIPAEEAESLGER--------LTKDRD-------FVESDLIFQGLVG 641

Query: 748 VEDKLQKDVKSSIELLRNAGIKIWMLTGDKVETARCVSISAKLISRGQYVHTITKVTRPE 807
           + D  + +   +++    AGI + MLTGD   TA+ ++    ++    Y +    V    
Sbjct: 642 IYDPPRVETAGAVKKCHRAGINVHMLTGDFPGTAKAIAQEVGILPHNLYHYPKEVVDIMV 701

Query: 808 GAFNQLEYLKINRNACLLIDGESLGMFLKHYEQEFFDVVVHLPTVIACRCTPQQKADVAL 867
               Q + L                        E  D +  LP VIA RC PQ K  +  
Sbjct: 702 MTATQFDSLT----------------------DEELDQLPVLPLVIA-RCAPQTKVRMID 738

Query: 868 VIRKMTGKRVCCI-GDGGNDVSMIQCADVGV--GIVGKE-GKQAS--LAADFSITQFCHL 921
            + +   ++ C + GDG ND   ++ A+VG+  GI G +  K AS  + +D +     + 
Sbjct: 739 ALHRR--EKFCAMTGDGVNDSPSLKKANVGIAMGINGSDVAKDASDIVLSDDNFASILNA 796

Query: 922 TELLLWHGRNSYKRSAKLAQFVMHRGLIIAICQAVYSICSL 962
            E     GR   + S  + +FV+   L   + QA+Y +  L
Sbjct: 797 VE----EGR---RMSDNIQKFVLQL-LAANVAQAIYLMLGL 829

>CAGL0J01870g 181666..184506 highly similar to sp|P13586
           Saccharomyces cerevisiae YGL167c PMR1, hypothetical
           start
          Length = 946

 Score = 75.1 bits (183), Expect = 3e-13,   Method: Compositional matrix adjust.
 Identities = 167/743 (22%), Positives = 282/743 (37%), Gaps = 181/743 (24%)

Query: 197 FYNLYFLVVALSQAVPALRIGYLSSYI-VPLAFVLTVTMAKEAXXXXXXXXXXXESNNEL 255
           F     +++ +  AV +  IG +   + + LA ++ VT+               E+ N+L
Sbjct: 102 FVEDRLILLLIGSAVLSFAIGQIDDAVSISLAILIVVTVG---FIQEYRSEKSLEALNKL 158

Query: 256 Y----HVIT--RNRSIPSKDLKVGDLIKVHKGDRIPADLVLLQSSEPSGESFIKTDQLDG 309
                H+I   R  +  + +L  GDL++   GDRIPAD+ ++++ + S    I    L G
Sbjct: 159 VPTKCHLIRYGRESNTLASELVPGDLVRFKIGDRIPADVRIIEAVDLS----IDESNLTG 214

Query: 310 ETDWKLRVACPLTQNLSENDLINRISITASAPEKSIHKFLGKVTYKDSTSNPLSVDNTLW 369
           ET+       PL ++    D           PE+            D+ + P+S  + + 
Sbjct: 215 ETE-------PLHKDAQTID-----------PEE-----------YDNRNVPVSERSCIA 245

Query: 370 ANTVLASSGFCIACVVYTGRDTRQA----MNTTTAKVKTGLLELEINSISKILCACVFAL 425
               L   G     V+ TG +T       M  +  K KT L E  ++ +   L    F +
Sbjct: 246 YMGTLVKEGHGKGIVIGTGTNTSYGAIFEMVNSIEKPKTPLQET-MDRLGTELSYISFFI 304

Query: 426 SILLVAFAGFHNDDWYIDILRYLILFSTIIPVSLRVNLDLAKSVYAHQIEHDKTIPETIV 485
             ++        +   +     + L    IP  L + + +  ++   ++    T    IV
Sbjct: 305 IAIISIVGIIRGNSLLMMFQVSVSLAVAAIPEGLPIIVTVTLALGVLRM----TKQNAIV 360

Query: 486 RTSTIPEDLGRIEYLLSDKTGTLTQNDMQLKKIHLGTVSYTSETLDIVSDYVQSLVSSKN 545
           R     E LG +  + +DKTGTLT N M + K+           LD    Y ++ +S + 
Sbjct: 361 RRLPSVETLGSVNVICTDKTGTLTTNHMTVSKLF---------CLDSSGTY-ENAISPEE 410

Query: 546 DSLNNSKVALSTTRKDMSFRVRD----MILTLA-ICHNVTPTFEDDELTYQAASPDEIAI 600
           DS                F V D      LT+A IC+N   +   +E      +P ++A+
Sbjct: 411 DS---------------EFDVHDNDVKETLTIANICNNAKYS---EEHNLYIGNPTDVAL 452

Query: 601 VKFTESVGLSLFKRDRHSISLLHEHSGKTLNYEILQVFPFNSDSKRMGIIVRDEQLDEYW 660
           ++     G+   +RD H               E ++   FNS  K M I    E   E+ 
Sbjct: 453 IEVLTKFGIP-DQRDSH---------------EKMEELSFNSKRKYMAIKSSKES-GEHV 495

Query: 661 FMQKGADTVMSKIVESNDWLEEETGNM------------------AREGLRTLVIGRKKL 702
              KGA     +I++ + +  ++ G +                  A +GLRT+    K  
Sbjct: 496 LYIKGA---FERILDKSSYYLDKAGEVREFDEHSKVMVLEAAHSCASDGLRTIACAFKPT 552

Query: 703 NKKIYEQFQKEYNDASLSMLNRDQQMSQVITKYLEHDLELLGLTGVEDKLQKDVKSSIEL 762
           +                           VI++   + L   GL G+ D  + +VK+SIE 
Sbjct: 553 DS------------------------DNVISEDDINGLTFTGLFGLADPPRPNVKASIEK 588

Query: 763 LRNAGIKIWMLTGDKVETARCVSISAKLISRGQYVHTITKVTRPEGAFNQLEYLKINRNA 822
           L   G+ I M+TGD V TA  VSI+ K+                         L +    
Sbjct: 589 LHRGGVHIIMITGDSVNTA--VSIAEKI------------------------GLSVQDRE 622

Query: 823 CLLIDGESLGMFLKHYEQEFFDVVVHLPTVIACRCTPQQKADVALVIRKMTGKRVCCIGD 882
             ++ G+ +    +    +  D V      I  R TP+ K ++   +RK  G  V   GD
Sbjct: 623 SSVMTGDKVSELTEDELSKVIDKVN-----IFARATPENKLNIVKALRK-RGDIVAMTGD 676

Query: 883 GGNDVSMIQCADVGV--GIVGKE 903
           G ND   ++ AD+G+  GI G +
Sbjct: 677 GVNDAPALKLADIGIAMGISGTD 699

>AFR354C [3546] [Homologous to ScYEL031W (SPF1) - SH]
           (1078275..1081907) [3633 bp, 1210 aa]
          Length = 1210

 Score = 65.5 bits (158), Expect = 2e-10,   Method: Compositional matrix adjust.
 Identities = 147/684 (21%), Positives = 259/684 (37%), Gaps = 181/684 (26%)

Query: 274 DLIKVHKGDR---IPADLVLLQSSEPSGESFIKTDQLDGETDWKLRVACPL--------T 322
           DLI V + D    +  D++L+      G   +    L GE+   L+ +  L         
Sbjct: 276 DLISVTRTDEDSALSCDMILV-----DGTCIVNEAMLSGESTPLLKESVKLRSSEEKLQV 330

Query: 323 QNLSENDLINRIS--ITASAPEKSIHKFLGKVTYKDSTSNPLSVDNTLWANTVLASSGFC 380
           + L +N +++  +  +  +APEK             S+S P   D            G  
Sbjct: 331 EGLDKNSVLHGGTKVLQVTAPEKG------------SSSIPAPPD------------GGA 366

Query: 381 IACVVYTGRDTRQA-----MNTTTAKVKTGLLELEINSISKILCACVFALSILLVAFAGF 435
           +A V  TG +T Q      M  ++ +V  G  E           A  F L +L+ A A  
Sbjct: 367 LAVVSKTGFETSQGALVRVMIYSSERVSVGNKE-----------ALYFILFLLIFAIAA- 414

Query: 436 HNDDWYI-------------DILRYLILFSTIIPVSLRVNLDLAKSVYAHQIEHDKTIPE 482
               WY+              IL  +++ ++++P  L + L +A       + +   +  
Sbjct: 415 ---SWYVWVEGTRMGRVQSKLILDCILIITSVVPSELPMELTMA-------VNNSLAVLS 464

Query: 483 TIVRTSTIPEDL---GRIEYLLSDKTGTLTQNDMQLKKIHLGTVSYTSETLDIVSDYVQS 539
                 T P  +   GRI+    DKTGTLT  D+  + +                    +
Sbjct: 465 KFYVYCTEPFRIPLAGRIDVCCFDKTGTLTGEDLVFEGL--------------------A 504

Query: 540 LVSSKNDSLNN----SKVALSTTRKDMSFRVRDMILTLAICHNVTPTFEDDELTYQAASP 595
            ++ KN  +N+    ++V L T             L +   H +    +DDE+      P
Sbjct: 505 GLAGKNQPVNHLFKGTEVPLDTN------------LVIGAAHALV-RLDDDEVV---GDP 548

Query: 596 DEIAIVKFTESVGLSLFKRDRHSISLLHEHSGKTLNYEILQVFPFNSDSKRMGII-VRDE 654
            E A +  T   G  +  +D    SL +E  G   +  IL+ F F+S  KR   I V ++
Sbjct: 549 MEKATLAAT---GWKVGVKD----SLSNEKVG---DISILRRFQFSSALKRSSTIAVHNK 598

Query: 655 QLDEYWFMQKGADTVMSKIVESNDWLEEETGNMAREGLRTLVIGRKKLNKKIYEQFQKEY 714
           Q   Y  ++   +T+  ++ +     ++   +  R G R L +  KKL     +Q +K  
Sbjct: 599 Q--HYSAVKGAPETIRERLSQVPTDYDQVYKSFTRAGSRVLALASKKLPSMSIKQIEKLE 656

Query: 715 NDASLSMLNRDQQMSQVITKYLEHDLELLGLTGVEDKLQKDVKSSIELLRNAGIKIWMLT 774
            +A                  +E DLE  G       L+ D   +I++L  +  +  M+T
Sbjct: 657 REA------------------VESDLEFKGFLVFHCPLKDDAIETIKMLNESSHRCIMIT 698

Query: 775 GDKVETARCVSISAKLISRGQYV------------------HTITKVTRPEGAFNQLEYL 816
           GD   TA  V+    ++ R   +                   TI     PE   +  E+ 
Sbjct: 699 GDNPLTAVHVAKEVAIVERETLILDEPIDGSSHALVFRNIEETIVNPFNPEK--DTFEHS 756

Query: 817 KINRNACLLIDGESLGMFLKHYEQEFFDVVVHLPTVIACRCTPQQKADVALVIRKMTGKR 876
           K+     + + G +L +   H   +  +++ H  T +  R +P QK  +   ++ M  + 
Sbjct: 757 KLFAKYDIAVTGHALQLLSGH--SQLNELIRH--TWVYARVSPAQKEFIMNSLKDMGYQT 812

Query: 877 VCCIGDGGNDVSMIQCADVGVGIV 900
           + C GDG NDV  ++ A VG+ ++
Sbjct: 813 LMC-GDGTNDVGALKQAHVGIALL 835

>CAGL0L01419g 156123..159767 highly similar to sp|P39986
           Saccharomyces cerevisiae YEL031w SPF1 P-type ATPase,
           hypothetical start
          Length = 1214

 Score = 58.9 bits (141), Expect = 2e-08,   Method: Compositional matrix adjust.
 Identities = 97/423 (22%), Positives = 161/423 (38%), Gaps = 84/423 (19%)

Query: 495 GRIEYLLSDKTGTLTQNDMQLKKIHLGTVSYTSETLDIVSDYVQSLVSSKNDSLNNSKVA 554
           GRI+    DKTGTLT  D+  +    G    +S+  DI   Y      S  D  N++   
Sbjct: 477 GRIDVCCFDKTGTLTGEDLVFE----GLAGLSSDPKDIRHLY------SATDCPNSTS-- 524

Query: 555 LSTTRKDMSFRVRDMILTLAICHNVTPTFEDDELTYQAASPDEIAIVKFTESVGLSLFKR 614
                           L +   H +    ED E+         +  +K+T   G  +F  
Sbjct: 525 ----------------LVVGAAHALV-RLEDGEIVGDPMEKATLKALKWTVEKGDKVF-- 565

Query: 615 DRHSISLLHEHSGKTLNYEILQVFPFNSDSKRMG-IIVRDEQLDEYWFMQKGADTVMSKI 673
                   +E +G+     IL+ F F+S  KR   +   D +L  Y  ++   +T+  ++
Sbjct: 566 --------NEKNGQV---TILRRFQFSSALKRSSSVATHDGKL--YSAVKGAPETIRERL 612

Query: 674 VESNDWLEEETGNMAREGLRTLVIGRKKLNKKIYEQFQKEYNDASLSMLNRDQQMSQVIT 733
                  +E   +  R G R L +  KKL K      Q +  DA                
Sbjct: 613 FTIPANYDEIYKSFTRSGSRVLALASKKLEK----MSQSQIEDAD--------------R 654

Query: 734 KYLEHDLELLGLTGVEDKLQKDVKSSIELLRNAGIKIWMLTGDK----VETARCVSIS-- 787
           ++ E DLE  G       L+ D   +I++L  +  +  M+TGD     V  A+ V I   
Sbjct: 655 EHFERDLEFNGFLIFHCPLKHDAIETIQMLNESAHRCVMITGDNPLTAVHVAKEVGIVKG 714

Query: 788 ----AKLISRGQYVHTITKVTRPEGAF------NQLEYLKINRNACLLIDGESLGMFLKH 837
                 ++  G     + +      +F      +  E   I     L + G +L     H
Sbjct: 715 ETLIVDMVDNGNDDKLVFRNVEETLSFEFVVSKDSFEKYGIFDKYDLAVTGHALEALKGH 774

Query: 838 YEQEFFDVVVHLPTVIACRCTPQQKADVALVIRKMTGKRVCCIGDGGNDVSMIQCADVGV 897
           ++ +  D++ H    I  R +P QK  +   ++ M  + + C GDG NDV  ++ A VGV
Sbjct: 775 HQLQ--DLIRH--AWIYARVSPAQKEFILNNLKDMGYQTLMC-GDGTNDVGALKQAHVGV 829

Query: 898 GIV 900
            ++
Sbjct: 830 ALL 832

>Scas_583.14*
          Length = 875

 Score = 57.8 bits (138), Expect = 4e-08,   Method: Compositional matrix adjust.
 Identities = 105/435 (24%), Positives = 177/435 (40%), Gaps = 88/435 (20%)

Query: 495 GRIEYLLSDKTGTLTQNDMQLKKIHLGTVSYTSETLDIVSDYVQSLVSSKNDSLNNSKVA 554
           GRI+    DKTGTLT  D+  +   L  +S  SE        V+ L SS++ S       
Sbjct: 133 GRIDVCCFDKTGTLTGEDLVFEG--LAGLSDKSED-------VRHLFSSEDAS------- 176

Query: 555 LSTTRKDMSFRVRDMILTLAICHNVTPTFEDDELTYQAASPDEIAIVKFTESVGLSLFKR 614
                       ++ IL +   H +    +D E+      P E A +K   ++G  +   
Sbjct: 177 ------------QETILVVGAAHALV-KLDDGEIV---GDPMEKATLK---ALGWKVEGN 217

Query: 615 DRHSISLLHEHSGKTLNYEILQVFPFNSDSKRMGIIVRDEQLDEYWFMQKGA-DTVMSKI 673
           D  S         KT   +IL+ F F+S  KR   +   +  D+ +   KGA +T+  ++
Sbjct: 218 DFTS-------RPKTGKLQILRRFQFSSALKRSSSVASHK--DKLFTAVKGAPETIRERL 268

Query: 674 VESNDWLEEETGNMAREGLRTLVIGRKKLNKKIYEQFQKEYNDASLSMLNRDQQMSQVIT 733
                  +E   +  R G R L +  K L     +Q         L  L+RD+       
Sbjct: 269 AVVPKNYDEIYKSFTRSGSRVLALASKSLPNLSSKQ---------LDDLDRDE------- 312

Query: 734 KYLEHDLELLGLTGVEDKLQKDVKSSIELLRNAGIKIWMLTGDKVETARCVSISAKLISR 793
             +E  L   G       L+ D   +I++L  +  +  M+TGD   TA  V+    +++ 
Sbjct: 313 --IETGLTFNGFLVFHCPLKPDAVETIKMLNESAHRSIMITGDNPLTAVHVAKEVAIVT- 369

Query: 794 GQYVHTITKVTRPEGA---FNQLEYLKINRNAC--------------LLIDGESLGMFLK 836
           G+ +      T  +G    FN  E +KI  +                + + G +L +   
Sbjct: 370 GETLILDKSETVGDGKLLFFNVEETIKIPFDPASDKFDHRELFDKYDIAVTGYALNLLED 429

Query: 837 HYEQEFFDVVVHLPTVIACRCTPQQKADVALVIRKMTGKRVCCIGDGGNDVSMIQCADVG 896
           H   +  D++ H  T +  R +P QK  +   +++M  + + C GDG NDV  ++ A VG
Sbjct: 430 H--SQLKDLIRH--TWVYARVSPSQKEFILNNLKEMGYQTLMC-GDGTNDVGALKQAHVG 484

Query: 897 VGIVGKEGKQASLAA 911
           V ++   G + S+ A
Sbjct: 485 VALL--NGTEESMTA 497

>KLLA0E22352g 1984522..1988142 highly similar to sp|P39986
           Saccharomyces cerevisiae YEL031w SPF1 P-type ATPase,
           start by similarity
          Length = 1206

 Score = 58.2 bits (139), Expect = 4e-08,   Method: Compositional matrix adjust.
 Identities = 68/290 (23%), Positives = 122/290 (42%), Gaps = 48/290 (16%)

Query: 631 NYEILQVFPFNSDSKRMGIIVRDEQLDEYWFMQKGA-DTVMSKIVESNDWLEEETGNMAR 689
           N  IL+ F F+S  KR   I    Q + ++   KGA +T+  ++       ++   +  R
Sbjct: 571 NIRILRRFQFSSSLKRSASIA--SQSNRFFAAVKGAPETIRERLNSVPSDYDDIYKSFTR 628

Query: 690 EGLRTLVIGRKKLNKKIYEQFQKEYNDASLSMLNRDQQMSQVITKYLEHDLELLGLTGVE 749
            G R L +  K L K          +++ +  ++RD+         +E  L         
Sbjct: 629 SGSRVLALAYKDLPK---------MSNSQIDNIDRDE---------IETGLTFGAFLVFH 670

Query: 750 DKLQKDVKSSIELLRNAGIKIWMLTGDKVETARCVSISAKLISRGQYV------------ 797
             L+ D   +I++L  +  +  M+TGD   TA  V+    ++ R   +            
Sbjct: 671 CPLKDDAIETIKMLNESSHRSIMITGDNPLTAVHVAKEVGIVDRETLILDEPIDGSSHAL 730

Query: 798 ------HTITKVTRPEG-AFNQLEYLKINRNACLLIDGESLGMFLKHYEQEFFDVVVHLP 850
                  TI K   P+   F++ E   I +   L + G +L +   H  ++  DV+ H  
Sbjct: 731 VMRDVNETIVKPFNPDADTFDEKE---IFQKYDLAVTGHALKLLQGH--KQLRDVIRH-- 783

Query: 851 TVIACRCTPQQKADVALVIRKMTGKRVCCIGDGGNDVSMIQCADVGVGIV 900
           T I  R +P QK  + + ++ M  + + C GDG NDV  ++ A VG+ ++
Sbjct: 784 TWIYARVSPSQKEFILITLKDMGYQTLMC-GDGTNDVGALKQAHVGIALL 832

>Scas_688.1
          Length = 913

 Score = 55.8 bits (133), Expect = 2e-07,   Method: Compositional matrix adjust.
 Identities = 99/470 (21%), Positives = 173/470 (36%), Gaps = 128/470 (27%)

Query: 433 AGFHNDDWYIDILRYLILFSTI-IPVSLRVNLDLAKSVYAHQIEHDKTIPETIVRTSTIP 491
           A F+  D  + ILRY +  + + +PV L   +    +V A  +       + IV+  +  
Sbjct: 306 ASFYRTDGIVRILRYTLGITIVGVPVGLPAVVTTTMAVGAAYLAKK----QAIVQKLSAI 361

Query: 492 EDLGRIEYLLSDKTGTLTQNDMQLKKIHLGTVSYTSETLDIVSDYVQSLVSSKNDSLNNS 551
           E L  +E L SDKTGTLT+N + L +       YT E +            S +D +  +
Sbjct: 362 ESLAGVEILCSDKTGTLTKNKLSLHE------PYTVEGV------------SADDLMLTA 403

Query: 552 KVALSTTRKDMSFRVRDMILTLAICHNVTPTFEDDELTYQAASPDEIAIVKFTESVGLSL 611
            +A S  +K +    +  + +LA               Y AA                  
Sbjct: 404 CLAASRKKKGLDAIDKAFLKSLA--------------QYPAA------------------ 431

Query: 612 FKRDRHSISLLHEHSGKTLNYEILQVFPFNSDSKRMGIIVRDEQLDEYWFMQKGADTVMS 671
               +++++           Y++L+  PF+  SK++  +V   +  E     KGA   + 
Sbjct: 432 ----KNALT----------KYKVLEFHPFDPVSKKVTAVVESPE-GERIICVKGAPLFVL 476

Query: 672 KIVESNDWLEEETGNMAREGLRTLVIGRKKLNKKIYEQFQKEYNDASLSMLNRDQQMSQV 731
           K VE                           +  I E   + Y +    + +R  +   V
Sbjct: 477 KTVEE--------------------------DHPIPEDIHENYENKVAELASRGFRALGV 510

Query: 732 ITKYLEHDLELLGLTGVEDKLQKDVKSSIELLRNAGIKIWMLTGDKVETARCVSISAKLI 791
             K  E   E+LG+    D  + D   ++   R  G+++ MLTGD V  A+    + + +
Sbjct: 511 ARKRGEGHWEILGVMPCMDPPRDDTGETVAEARRLGLRVKMLTGDAVGIAKE---TCRQL 567

Query: 792 SRGQYVHTITKVTRPEGAFNQLEYLKINRNACLLIDGESLGMFLKHYEQEFFDVVVHLPT 851
             G  V+   ++    G                 + G  L  F+++ +  F +V      
Sbjct: 568 GLGTNVYNAERLGLSGGGD---------------MPGSELADFVENADG-FAEVF----- 606

Query: 852 VIACRCTPQQKADVALVIRKMTGKRVCCIGDGGNDVSMIQCADVGVGIVG 901
                  PQ K  V  ++ +  G  V   GDG ND   ++ AD G+ + G
Sbjct: 607 -------PQDKYRVVEIL-QTRGYLVAMTGDGVNDAPSLKKADTGIAVEG 648

>YGL008C (PMA1) [1965] chr7 complement(479913..482669)
           H+-transporting P-type ATPase of the plasma membrane
           required for nutrient uptake and pH homeostasis,
           activity is rate limiting for growth at low pH [2757 bp,
           918 aa]
          Length = 918

 Score = 54.3 bits (129), Expect = 5e-07,   Method: Compositional matrix adjust.
 Identities = 51/157 (32%), Positives = 74/157 (47%), Gaps = 11/157 (7%)

Query: 365 DNTLWANTVLASSGFCIACVVYTGRDT---RQAMNTTTAKVKTGLLELEINSISKILCAC 421
           D T  ++TV    GF +  V  TG +T   R A     A    G     +N I  IL   
Sbjct: 243 DQTFSSSTVKRGEGFMV--VTATGDNTFVGRAAALVNKAAGGQGHFTEVLNGIGIILLVL 300

Query: 422 VFALSILLVAFAGFHNDDWYIDILRYLILFSTI-IPVSLRVNLDLAKSVYAHQIEHDKTI 480
           V A ++LLV  A F+  +  + ILRY +  + I +PV L   +    +V A  +      
Sbjct: 301 VIA-TLLLVWTACFYRTNGIVRILRYTLGITIIGVPVGLPAVVTTTMAVGAAYLAKK--- 356

Query: 481 PETIVRTSTIPEDLGRIEYLLSDKTGTLTQNDMQLKK 517
            + IV+  +  E L  +E L SDKTGTLT+N + L +
Sbjct: 357 -QAIVQKLSAIESLAGVEILCSDKTGTLTKNKLSLHE 392

 Score = 42.0 bits (97), Expect = 0.003,   Method: Compositional matrix adjust.
 Identities = 73/350 (20%), Positives = 129/350 (36%), Gaps = 76/350 (21%)

Query: 575 ICHNVTPTFEDDEL------TYQAASPDEIAIVKFTESVGLSLFKRDRHSI------SLL 622
           +C + T T   ++L      T +  SPD++ +   T  +  S  K+   +I      SL 
Sbjct: 375 LCSDKTGTLTKNKLSLHEPYTVEGVSPDDLML---TACLAASRKKKGLDAIDKAFLKSLK 431

Query: 623 HEHSGKTL--NYEILQVFPFNSDSKRMGIIVRDEQLDEYWFMQKGADTVMSKIVESNDWL 680
                K     Y++L+  PF+  SK++  +V   +  E     KGA   + K VE +   
Sbjct: 432 QYPKAKDALTKYKVLEFHPFDPVSKKVTAVVESPE-GERIVCVKGAPLFVLKTVEED--- 487

Query: 681 EEETGNMAREGLRTLVIGRKKLNKKIYEQFQKEYNDASLSMLNRDQQMSQVITKYLEHDL 740
                                    I E   + Y +    + +R  +   V  K  E   
Sbjct: 488 -----------------------HPIPEDVHENYENKVAELASRGFRALGVARKRGEGHW 524

Query: 741 ELLGLTGVEDKLQKDVKSSIELLRNAGIKIWMLTGDKVETARCVSISAKLISRGQYVHTI 800
           E+LG+    D  + D   ++   R+ G+++ MLTGD V  A+    + + +  G  ++  
Sbjct: 525 EILGVMPCMDPPRDDTAQTVSEARHLGLRVKMLTGDAVGIAKE---TCRQLGLGTNIYNA 581

Query: 801 TKVTRPEGAFNQLEYLKINRNACLLIDGESLGMFLKHYEQEFFDVVVHLPTVIACRCTPQ 860
            ++                      + G  L  F+++ +  F +V             PQ
Sbjct: 582 ERLG---------------LGGGGDMPGSELADFVENADG-FAEVF------------PQ 613

Query: 861 QKADVALVIRKMTGKRVCCIGDGGNDVSMIQCADVGVGIVGKEGKQASLA 910
            K  V  +++   G  V   GDG ND   ++ AD G+ + G      S A
Sbjct: 614 HKYRVVEILQN-RGYLVAMTGDGVNDAPSLKKADTGIAVEGATDAARSAA 662

>YEL031W (SPF1) [1394] chr5 (90258..93905) Putative
           Ca2+-transporting ATPase, member of the P-type ATPase
           superfamily of membrane transporters [3648 bp, 1215 aa]
          Length = 1215

 Score = 53.1 bits (126), Expect = 1e-06,   Method: Compositional matrix adjust.
 Identities = 96/427 (22%), Positives = 167/427 (39%), Gaps = 92/427 (21%)

Query: 495 GRIEYLLSDKTGTLTQNDMQLKKIHLGTVSYTSETLDIVSDYVQSLVSSKNDSLNNSKVA 554
           GRI+    DKTGTLT  D+  +   L  +S  SE +  +    ++  S+           
Sbjct: 479 GRIDVCCFDKTGTLTGEDLVFEG--LAGISADSENIRHLYSAAEAPEST----------- 525

Query: 555 LSTTRKDMSFRVRDMILTLAICHNVTPTFEDDELTYQAASPDEIAIVKFTESVGLSLFKR 614
                          IL +   H +    ED ++      P E A +K   +VG ++ ++
Sbjct: 526 ---------------ILVIGAAHALV-KLEDGDIV---GDPMEKATLK---AVGWAVERK 563

Query: 615 DRHSISLLHEHSGKTLNYEILQVFPFNSDSKRMGIIVRDEQLDEYWFMQKGA-DTVMSKI 673
           + +      E +GK    +I++ F F+S  KR   I      D  +   KGA +T+  ++
Sbjct: 564 NSN----YREGTGK---LDIIRRFQFSSALKRSASIASHN--DALFAAVKGAPETIRERL 614

Query: 674 VESNDWLEEETGNMAREGLRTLVIGRKKLNKKIYEQFQKEYNDASLSMLNRDQQMSQVIT 733
            +     +E   +  R G R L +  K L K      Q + +D     LNRD        
Sbjct: 615 SDIPKNYDEIYKSFTRSGSRVLALASKSLPK----MSQSKIDD-----LNRDD------- 658

Query: 734 KYLEHDLELLGLTGVEDKLQKDVKSSIELLRNAGIKIWMLTGDKVETARCVSISAKLISR 793
             +E +L   G       L+ D   +I++L  +  +  M+TGD   TA  V+    ++  
Sbjct: 659 --VESELTFNGFLIFHCPLKDDAIETIKMLNESSHRSIMITGDNPLTAVHVAKEVGIV-- 714

Query: 794 GQYVHTITKVTRPEGAFNQLEYLKINRNACLLID--------------------GESLGM 833
             +  T+      +   NQL +  +     +  D                    G +L  
Sbjct: 715 --FGETLILDRAGKSDDNQLLFRDVEETVSIPFDPSKDTFDHSKLFDRYDIAVTGYALNA 772

Query: 834 FLKHYEQEFFDVVVHLPTVIACRCTPQQKADVALVIRKMTGKRVCCIGDGGNDVSMIQCA 893
              H   +  D++ H  T +  R +P QK  +   ++ M  + + C GDG NDV  ++ A
Sbjct: 773 LEGH--SQLRDLLRH--TWVYARVSPSQKEFLLNTLKDMGYQTLMC-GDGTNDVGALKQA 827

Query: 894 DVGVGIV 900
            VG+ ++
Sbjct: 828 HVGIALL 834

>KLLA0A09031g 787768..790467 gi|1346734|sp|P49380|PMA1_KLULA
           Kluyveromyces lactis Plasma membrane ATPase (Proton
           pump), start by similarity
          Length = 899

 Score = 49.7 bits (117), Expect = 2e-05,   Method: Compositional matrix adjust.
 Identities = 101/479 (21%), Positives = 175/479 (36%), Gaps = 128/479 (26%)

Query: 433 AGFHNDDWYIDILRYLILFSTI-IPVSLRVNLDLAKSVYAHQIEHDKTIPETIVRTSTIP 491
           A F+  +  + ILRY +  + + +PV L   +    +V A  +       + IV+  +  
Sbjct: 292 ASFYRTNKIVRILRYTLAITIVGVPVGLPAVVTTTMAVGAAYLAKK----QAIVQKLSAI 347

Query: 492 EDLGRIEYLLSDKTGTLTQNDMQLKKIHLGTVSYTSETLDIVSDYVQSLVSSKNDSLNNS 551
           E L  +E L SDKTGTLT+N + L +       YT E +D             +D +  +
Sbjct: 348 ESLAGVEILCSDKTGTLTKNKLSLHE------PYTVEGVD------------PDDLMLTA 389

Query: 552 KVALSTTRKDMSFRVRDMILTLAICHNVTPTFEDDELTYQAASPDEIAIVKFTESVGLSL 611
            +A S  +K +                +   F    ++Y  A   + A+ K+        
Sbjct: 390 CLAASRKKKGLD--------------AIDKAFLKSLISYPRA---KAALTKY-------- 424

Query: 612 FKRDRHSISLLHEHSGKTLNYEILQVFPFNSDSKRMGIIVRDEQLDEYWFMQKGADTVMS 671
                    LL  H             PF+  SK++  IV   +  E     KGA   + 
Sbjct: 425 --------KLLEFH-------------PFDPVSKKVTAIVESPE-GERIICVKGAPLFVL 462

Query: 672 KIVESNDWLEEETGNMAREGLRTLVIGRKKLNKKIYEQFQKEYNDASLSMLNRDQQMSQV 731
           K VE    + E+               R+    K+ E            + +R  +   V
Sbjct: 463 KTVEEEHPIPEDV--------------RENYENKVAE------------LASRGFRALGV 496

Query: 732 ITKYLEHDLELLGLTGVEDKLQKDVKSSIELLRNAGIKIWMLTGDKVETARCVSISAKLI 791
             K  E   E+LG+    D  + D   ++   R+ G+++ MLTGD V  A+    + + +
Sbjct: 497 ARKRGEGHWEILGVMPCMDPPRDDTAQTVNEARHLGLRVKMLTGDAVGIAKE---TCRQL 553

Query: 792 SRGQYVHTITKVTRPEGAFNQLEYLKINRNACLLIDGESLGMFLKHYEQEFFDVVVHLPT 851
             G  ++   ++                      + G  L  F+++ +  F +V      
Sbjct: 554 GLGTNIYNAERLG---------------LGGGGDMPGSELADFVENADG-FAEVF----- 592

Query: 852 VIACRCTPQQKADVALVIRKMTGKRVCCIGDGGNDVSMIQCADVGVGIVGKEGKQASLA 910
                  PQ K +V  ++++  G  V   GDG ND   ++ AD G+ + G      S A
Sbjct: 593 -------PQHKYNVVEILQQ-RGYLVAMTGDGVNDAPSLKKADTGIAVEGATDAARSAA 643

>YPL036W (PMA2) [5403] chr16 (482839..485682) H[+]-transporting
           P-type ATPase of the plasma membrane, expression not
           detected under normal growth conditions [2844 bp, 947
           aa]
          Length = 947

 Score = 48.5 bits (114), Expect = 3e-05,   Method: Compositional matrix adjust.
 Identities = 49/157 (31%), Positives = 71/157 (45%), Gaps = 11/157 (7%)

Query: 365 DNTLWANTVLASSGFCIACVVYTGRDT---RQAMNTTTAKVKTGLLELEINSISKILCAC 421
           D    ++TV     F +  V  TG +T   R A     A    G     +N I  IL   
Sbjct: 272 DEVFSSSTVKTGEAFMV--VTATGDNTFVGRAAALVGQASGVEGHFTEVLNGIGIILLVL 329

Query: 422 VFALSILLVAFAGFHNDDWYIDILRYLILFSTI-IPVSLRVNLDLAKSVYAHQIEHDKTI 480
           V A ++LLV  A F+     + ILRY +  + I +PV L   +    +V A  +      
Sbjct: 330 VIA-TLLLVWTACFYRTVGIVSILRYTLGITIIGVPVGLPAVVTTTMAVGAAYLAKK--- 385

Query: 481 PETIVRTSTIPEDLGRIEYLLSDKTGTLTQNDMQLKK 517
            + IV+  +  E L  +E L SDKTGTLT+N + L +
Sbjct: 386 -QAIVQKLSAIESLAGVEILCSDKTGTLTKNKLSLHE 421

 Score = 46.6 bits (109), Expect = 1e-04,   Method: Compositional matrix adjust.
 Identities = 76/350 (21%), Positives = 130/350 (37%), Gaps = 76/350 (21%)

Query: 575 ICHNVTPTFEDDEL------TYQAASPDEIAIVKFTESVGLSLFKRDRHSI------SLL 622
           +C + T T   ++L      T +  SPD++ +   T  +  S  K+   +I      SL+
Sbjct: 404 LCSDKTGTLTKNKLSLHEPYTVEGVSPDDLML---TACLAASRKKKGLDAIDKAFLKSLI 460

Query: 623 HEHSGKTL--NYEILQVFPFNSDSKRMGIIVRDEQLDEYWFMQKGADTVMSKIVESNDWL 680
                K     Y++L+  PF+  SK++  +V   +  E     KGA   + K VE +   
Sbjct: 461 EYPKAKDALTKYKVLEFHPFDPVSKKVTAVVESPE-GERIVCVKGAPLFVLKTVEED--- 516

Query: 681 EEETGNMAREGLRTLVIGRKKLNKKIYEQFQKEYNDASLSMLNRDQQMSQVITKYLEHDL 740
                                    I E   + Y +    + +R  +   V  K  E   
Sbjct: 517 -----------------------HPIPEDVHENYENKVAELASRGFRALGVARKRGEGHW 553

Query: 741 ELLGLTGVEDKLQKDVKSSIELLRNAGIKIWMLTGDKVETARCVSISAKLISRGQYVHTI 800
           E+LG+    D  + D   +I   RN G++I MLTGD V  A+    + + +  G  ++  
Sbjct: 554 EILGVMPCMDPPRDDTAQTINEARNLGLRIKMLTGDAVGIAKE---TCRQLGLGTNIYNA 610

Query: 801 TKVTRPEGAFNQLEYLKINRNACLLIDGESLGMFLKHYEQEFFDVVVHLPTVIACRCTPQ 860
            ++                      + G  L  F+++ +  F +V             PQ
Sbjct: 611 ERLG---------------LGGGGDMPGSELADFVENADG-FAEVF------------PQ 642

Query: 861 QKADVALVIRKMTGKRVCCIGDGGNDVSMIQCADVGVGIVGKEGKQASLA 910
            K  V  +++   G  V   GDG ND   ++ AD G+ + G      S A
Sbjct: 643 HKYRVVEILQN-RGYLVAMTGDGVNDAPSLKKADTGIAVEGATDAARSAA 691

>AGL085C [4226] [Homologous to ScYGL008C (PMA1) - SH; ScYPL036W
           (PMA2) - NSH] (546285..549014) [2730 bp, 909 aa]
          Length = 909

 Score = 46.2 bits (108), Expect = 1e-04,   Method: Compositional matrix adjust.
 Identities = 57/271 (21%), Positives = 105/271 (38%), Gaps = 59/271 (21%)

Query: 631 NYEILQVFPFNSDSKRMGIIVRDEQLDEYWFMQKGADTVMSKIVESNDWLEEETGNMARE 690
            Y++L+  PF+  SK++  IV   +  E     KGA   + K VE N  + E+       
Sbjct: 423 KYKVLEFHPFDPVSKKVTAIVESPE-GERIVCVKGAPLFVLKTVEENHLIPEDV------ 475

Query: 691 GLRTLVIGRKKLNKKIYEQFQKEYNDASLSMLNRDQQMSQVITKYLEHDLELLGLTGVED 750
                               ++ Y +    + +R  +   V  K  E   E+LG+    D
Sbjct: 476 --------------------KENYENKVAELASRGYRALGVARKRGEGHWEILGVMPCMD 515

Query: 751 KLQKDVKSSIELLRNAGIKIWMLTGDKVETARCVSISAKLISRGQYVHTITKVTRPEGAF 810
             + D   ++   R+ G+++ MLTGD V  A+    + + +  G  ++   ++       
Sbjct: 516 PPRDDTAQTVNEARHLGLRVKMLTGDAVGIAKE---TCRQLGLGTNIYNAERLG------ 566

Query: 811 NQLEYLKINRNACLLIDGESLGMFLKHYEQEFFDVVVHLPTVIACRCTPQQKADVALVIR 870
                          + G  L  F+++ +  F +V             PQ K +V  +++
Sbjct: 567 ---------LGGGGDMPGSELADFVENADG-FAEVF------------PQHKYNVVEILQ 604

Query: 871 KMTGKRVCCIGDGGNDVSMIQCADVGVGIVG 901
           +  G  V   GDG ND   ++ AD G+ + G
Sbjct: 605 Q-RGYLVAMTGDGVNDAPSLKKADTGIAVEG 634

 Score = 41.2 bits (95), Expect = 0.005,   Method: Compositional matrix adjust.
 Identities = 49/157 (31%), Positives = 71/157 (45%), Gaps = 11/157 (7%)

Query: 365 DNTLWANTVLASSGFCIACVVYTGRDT---RQAMNTTTAKVKTGLLELEINSISKILCAC 421
           D T  ++TV    GF I  V  TG  T   R A     A   +G     +N I  IL   
Sbjct: 224 DATFSSSTVKRGEGFMI--VTATGDSTFVGRAAALVNKASAGSGHFTEVLNGIGTILLIL 281

Query: 422 VFALSILLVAFAGFHNDDWYIDILRYLILFSTI-IPVSLRVNLDLAKSVYAHQIEHDKTI 480
           V    +++   A F+     + ILRY +  + + +PV L   +    +V A  +   K I
Sbjct: 282 VILTLLVVYV-ACFYRSIDIVTILRYTLAITVVGVPVGLPAVVTTTMAVGAAYLAKKKAI 340

Query: 481 PETIVRTSTIPEDLGRIEYLLSDKTGTLTQNDMQLKK 517
              + + S I E L  +E L SDKTGTLT+N + L +
Sbjct: 341 ---VQKLSAI-ESLAGVEILCSDKTGTLTKNKLSLHE 373

>Scas_710.41
          Length = 904

 Score = 42.7 bits (99), Expect = 0.002,   Method: Compositional matrix adjust.
 Identities = 65/291 (22%), Positives = 108/291 (37%), Gaps = 64/291 (21%)

Query: 615 DRHSISLLHEHSGKTLN----YEILQVFPFNSDSKRMGIIVRDEQLDEYWFMQKGADTVM 670
           DR  +  L+++  K +N    Y+IL+  PF+  SK++  +V+  +  E     KGA   +
Sbjct: 410 DRAFLKSLNQYP-KAMNALPKYKILEFHPFDPVSKKVTAVVKSPE-GETITCVKGAPLFV 467

Query: 671 SKIVESNDWLEEETGNMAREGLRTLVIGRKKLNKKIYEQFQKEYNDASLSMLNRDQQMSQ 730
            K VE +                            + E   + Y +    + +R  +   
Sbjct: 468 LKTVEED--------------------------HPVPEDVHENYENKVAELASRGFRSLG 501

Query: 731 VITKYLEHDLELLGLTGVEDKLQKDVKSSIELLRNAGIKIWMLTGDKVETARCVSISAKL 790
           V  K  E   E+LG+    D  + D   +I   R  G+++ MLTGD V  A+  S    L
Sbjct: 502 VARKRGEGYWEILGVMPCMDPPRDDTARTIAEARTLGLRVKMLTGDAVGIAKETSRQLGL 561

Query: 791 ISRGQYVHTITKVTRPEGAFNQLEYLKINRNACLLIDGESLGMFLKHYEQEFFDVVVHLP 850
                               N     K+       + G  L  F+++ +  F +V     
Sbjct: 562 ------------------GVNIYNAEKLGLGGGGDMPGSELADFVENADG-FAEVF---- 598

Query: 851 TVIACRCTPQQKADVALVIRKMTGKRVCCIGDGGNDVSMIQCADVGVGIVG 901
                   PQ K  V  +++   G  V   GDG ND   ++ AD G+ + G
Sbjct: 599 --------PQHKYKVVEILQN-RGYLVAMTGDGVNDAPSLKKADTGIAVEG 640

 Score = 40.4 bits (93), Expect = 0.010,   Method: Compositional matrix adjust.
 Identities = 64/259 (24%), Positives = 103/259 (39%), Gaps = 63/259 (24%)

Query: 263 RSIPSKDLKVGDLIKVHKGDRIPADLVLLQSSEPSGESFIKTDQ--LDGETDWKLRVACP 320
           + IP+ ++  GD++++ +G  IPAD  L+  +      F++ DQ  + GE+         
Sbjct: 176 QEIPANEIVPGDILELDEGTIIPADGRLVTENR-----FLQVDQSAITGES--------- 221

Query: 321 LTQNLSENDLINRISITASAPEKSIHKFLGKVTYKDSTSNPLSVDNTLWANTVLASSGFC 380
                                  ++ K  G VT+  ST                  +G  
Sbjct: 222 ----------------------LAVDKNYGDVTFSSST----------------VKTGTS 243

Query: 381 IACVVYTGRDT---RQAMNTTTAKVKTGLLELEINSISKILCACVFALSILLVAFAGFHN 437
           +  V  TG +T   R A     A    G     +N I  IL   V    +L+   A F+ 
Sbjct: 244 VMVVTATGDNTFVGRAAALVGEASGGQGHFTDILNDIGTILLVLVIITLLLVWT-ACFYR 302

Query: 438 DDWYIDILRYLILFSTI-IPVSLRVNLDLAKSVYAHQIEHDKTIPETIVRTSTIPEDLGR 496
            D  + ILR+ +  + I +PV L   +    +V A  +       + IV+  +  E L  
Sbjct: 303 TDGIVMILRFTLGITIIGVPVGLPAVVTTTMAVGAAYLAKK----QAIVQKLSAIESLAG 358

Query: 497 IEYLLSDKTGTLTQNDMQL 515
           +E L SDKTGTLT+N + L
Sbjct: 359 VEILCSDKTGTLTKNKLSL 377

>Kwal_47.17522
          Length = 899

 Score = 42.4 bits (98), Expect = 0.002,   Method: Compositional matrix adjust.
 Identities = 72/350 (20%), Positives = 128/350 (36%), Gaps = 76/350 (21%)

Query: 575 ICHNVTPTFEDDEL------TYQAASPDEIAIVKFTESVGLSLFKRDRHSI------SLL 622
           +C + T T   ++L      T +   PD++ +   T  +  S  K+   +I      SL+
Sbjct: 356 LCSDKTGTLTKNKLSLHEPYTVEGVEPDDLML---TACLAASRKKKGLDAIDKAFLKSLI 412

Query: 623 HEHSGKTL--NYEILQVFPFNSDSKRMGIIVRDEQLDEYWFMQKGADTVMSKIVESNDWL 680
                K     Y++L   PF+  SK++  +V   +  E     KGA   + K VE +   
Sbjct: 413 QYPRAKNALTKYKVLDFHPFDPVSKKVTAVVESPE-GERIICVKGAPLFVLKTVEED--- 468

Query: 681 EEETGNMAREGLRTLVIGRKKLNKKIYEQFQKEYNDASLSMLNRDQQMSQVITKYLEHDL 740
                                    I E   + Y +    + +R  +   V  K  E   
Sbjct: 469 -----------------------HPIPEDVHENYENKVAELASRGFRALGVARKRGEGHW 505

Query: 741 ELLGLTGVEDKLQKDVKSSIELLRNAGIKIWMLTGDKVETARCVSISAKLISRGQYVHTI 800
           E+LG+    D  + D   ++   R  G+++ MLTGD V  A+    + + +  G  ++  
Sbjct: 506 EILGVMPCMDPPRDDTAQTVHEARRLGLRVKMLTGDAVGIAKE---TCRQLGLGTNIYNA 562

Query: 801 TKVTRPEGAFNQLEYLKINRNACLLIDGESLGMFLKHYEQEFFDVVVHLPTVIACRCTPQ 860
            ++                      + G  L  F+++ +  F +V             PQ
Sbjct: 563 ERLG---------------LGGGGDMPGSELADFVENADG-FAEVF------------PQ 594

Query: 861 QKADVALVIRKMTGKRVCCIGDGGNDVSMIQCADVGVGIVGKEGKQASLA 910
            K  V  ++++  G  V   GDG ND   ++ AD G+ + G      S A
Sbjct: 595 HKYSVVEILQQ-RGYLVAMTGDGVNDAPSLKKADTGIAVEGATDAARSAA 643

 Score = 41.6 bits (96), Expect = 0.004,   Method: Compositional matrix adjust.
 Identities = 51/157 (32%), Positives = 72/157 (45%), Gaps = 11/157 (7%)

Query: 365 DNTLWANTVLASSGFCIACVVYTGRDT---RQAMNTTTAKVKTGLLELEINSISKILCAC 421
           D T  ++TV    GF I  V  TG +T   R A     A    G     +N I  IL   
Sbjct: 224 DTTFSSSTVKRGEGFMI--VTATGDNTFVGRAAALVNQAAGDQGHFTEVLNGIGTILLVL 281

Query: 422 VFALSILLVAFAGFHNDDWYIDILRYLILFSTI-IPVSLRVNLDLAKSVYAHQIEHDKTI 480
           V    +L+   A F+  D  + ILRY +  + I +PV L   +    +V A  +   + I
Sbjct: 282 VIVTLLLVWT-ACFYRTDRIVRILRYTLGITIIGVPVGLPAVVTTTMAVGAAYLAKKQAI 340

Query: 481 PETIVRTSTIPEDLGRIEYLLSDKTGTLTQNDMQLKK 517
              + + S I E L  +E L SDKTGTLT+N + L +
Sbjct: 341 ---VQKLSAI-ESLAGVEILCSDKTGTLTKNKLSLHE 373

>KLLA0F07447g 700685..703612 similar to sp|P38995 Saccharomyces
           cerevisiae YDR270w CCC2 probable copper-transporting
           ATPase, start by similarity
          Length = 975

 Score = 42.0 bits (97), Expect = 0.003,   Method: Compositional matrix adjust.
 Identities = 29/90 (32%), Positives = 45/90 (50%), Gaps = 15/90 (16%)

Query: 692 LRTLVIGRKKLNKKIYEQFQKEYNDASLSMLNRDQQMSQVITKYLEHDLELLGLTGVEDK 751
           + T+ IG KKL           + D SLS    D   S +   Y+  D  L+G   + D+
Sbjct: 706 IHTITIGNKKL-----------FPDESLS----DIASSTLTESYVSIDGSLVGKFEISDR 750

Query: 752 LQKDVKSSIELLRNAGIKIWMLTGDKVETA 781
           +++D    +E L+N GIK  M+TGD  ++A
Sbjct: 751 VKEDAHFVVEYLQNLGIKCCMVTGDAHQSA 780

 Score = 35.4 bits (80), Expect = 0.36,   Method: Compositional matrix adjust.
 Identities = 27/93 (29%), Positives = 47/93 (50%), Gaps = 5/93 (5%)

Query: 807 EGAFNQLEYLKINRNACLLIDGESLGMFLKHYEQEFFDVVVHLPTVIACRCTPQQKADVA 866
           E A   +EYL+     C ++ G++    LK  +Q    + +    V +   TP+QK D+ 
Sbjct: 753 EDAHFVVEYLQNLGIKCCMVTGDAHQSALKVAQQ----LGISANDVFS-EVTPEQKRDIV 807

Query: 867 LVIRKMTGKRVCCIGDGGNDVSMIQCADVGVGI 899
           + ++    +RV  +GDG ND   +  AD+G+ I
Sbjct: 808 IQLQNNGTERVAFVGDGINDSPALVEADLGISI 840

>CAGL0A00495g complement(55014..57722) highly similar to sp|P05030
           Saccharomyces cerevisiae YGL008c PMA1 or sp|P19657
           Saccharomyces cerevisiae YPL036w PMA2, hypothetical
           start
          Length = 902

 Score = 40.0 bits (92), Expect = 0.011,   Method: Compositional matrix adjust.
 Identities = 55/271 (20%), Positives = 100/271 (36%), Gaps = 59/271 (21%)

Query: 631 NYEILQVFPFNSDSKRMGIIVRDEQLDEYWFMQKGADTVMSKIVESNDWLEEETGNMARE 690
            Y++++  PF+  SK++  +V   +  E     KGA   + K VE +             
Sbjct: 426 KYKVIEFHPFDPVSKKVTAVVESPE-GERIVCVKGAPLFVLKTVEED------------- 471

Query: 691 GLRTLVIGRKKLNKKIYEQFQKEYNDASLSMLNRDQQMSQVITKYLEHDLELLGLTGVED 750
                          I E   + Y +    + +R  +   V  K  E   E+LG+    D
Sbjct: 472 -------------HPIPEDVHENYENKVAELASRGFRALGVARKRGEGHWEILGVMPCMD 518

Query: 751 KLQKDVKSSIELLRNAGIKIWMLTGDKVETARCVSISAKLISRGQYVHTITKVTRPEGAF 810
             + D   ++   R  G+++ MLTGD V  A+    + + +  G  ++   ++       
Sbjct: 519 PPRDDTAETVNEARRLGLRVKMLTGDAVGIAKE---TCRQLGLGTNIYNAERLG------ 569

Query: 811 NQLEYLKINRNACLLIDGESLGMFLKHYEQEFFDVVVHLPTVIACRCTPQQKADVALVIR 870
                          + G  L  F+++ +  F +V             PQ K  V  +++
Sbjct: 570 ---------LGGGGDMPGSELADFVENADG-FAEVF------------PQHKYKVVEILQ 607

Query: 871 KMTGKRVCCIGDGGNDVSMIQCADVGVGIVG 901
              G  V   GDG ND   ++ AD G+ + G
Sbjct: 608 N-RGYLVAMTGDGVNDAPSLKKADTGIAVEG 637

 Score = 39.3 bits (90), Expect = 0.019,   Method: Compositional matrix adjust.
 Identities = 28/86 (32%), Positives = 44/86 (51%), Gaps = 5/86 (5%)

Query: 433 AGFHNDDWYIDILRYLILFSTI-IPVSLRVNLDLAKSVYAHQIEHDKTIPETIVRTSTIP 491
           A F+  D  + ILR+ +  + I +PV L   +    +V A  +       + IV+  +  
Sbjct: 295 ACFYRTDNIVKILRFTLGITIIGVPVGLPAVVTTTMAVGAAYLAKK----QAIVQKLSAI 350

Query: 492 EDLGRIEYLLSDKTGTLTQNDMQLKK 517
           E L  +E L SDKTGTLT+N + L +
Sbjct: 351 ESLAGVEILCSDKTGTLTKNKLSLHE 376

>Scas_227.0d
          Length = 307

 Score = 39.7 bits (91), Expect = 0.012,   Method: Compositional matrix adjust.
 Identities = 63/255 (24%), Positives = 104/255 (40%), Gaps = 59/255 (23%)

Query: 503 DKTGTLTQNDMQLKKIHLG----------------TVSYTSETLDIVS-----------D 535
           DKTGTLT+N M + +  +G                T S+  ++++I             D
Sbjct: 11  DKTGTLTENVMSVVRGFVGDSYFNDSDNALLTSVATDSHIKKSIEIFKKNGECSENLEKD 70

Query: 536 YVQSLVSSKN--------DSLNNSKVALSTTRKDMS--FRVRDMILT---LAICHNVTPT 582
           ++ ++V +          DS NN  +  ST  +D S   R  + + T   ++I  +    
Sbjct: 71  FLTNIVLNSTAFENKDFVDSANN--LPFSTDERDPSQVKRAFEFVRTHTRISISRDDNSD 128

Query: 583 FEDDELTYQAASPDEIAIVKFTESVGLSLFKRDRH----SISLLHEHSGKTLNY-EILQV 637
             DD +        E  I   TE+  L+L K+  +    S+  L E+        EI Q+
Sbjct: 129 SGDDLIQNAIKGRQEPYIGSKTETALLTLAKKSMNLRFGSLRALRENPVDRFEVSEIAQI 188

Query: 638 FPFNSDSKRMGIIVRDEQLDEYWFMQKGADTVMSKIVES------------NDWLEEETG 685
            PF S  K  GIIV+ ++ + Y F  KGA  ++S    S             D + +E  
Sbjct: 189 IPFESTRKWGGIIVKYKESNLYRFFIKGAAEIVSNNCHSKRNSDDSIVTLNKDQINKEIE 248

Query: 686 NMAREGLRTLVIGRK 700
           N+A + LR L +  +
Sbjct: 249 NLANDALRALSLAHR 263

>Scas_297.1
          Length = 800

 Score = 40.0 bits (92), Expect = 0.012,   Method: Compositional matrix adjust.
 Identities = 46/190 (24%), Positives = 73/190 (38%), Gaps = 34/190 (17%)

Query: 775 GDKVETARCVSISAKLISRGQYVHTITKVTRPEGAFNQLEYLKINRNACLLIDGESLGMF 834
           GD + TAR ++ +  ++S   Y+        PE A                I+G      
Sbjct: 1   GDNILTARAIARNCNILSEETYLI-------PECA----------------IEGPKFRTL 37

Query: 835 LKHYEQEFFDVVVHLPTV-IACRCTPQQKADVALVIRKMTGKRVCCIGDGGNDVSMIQCA 893
            K       + +  LP + +  R +P+ K  +   ++ M G  V   GDG ND   ++ A
Sbjct: 38  TKQ------ERIKMLPNLRVMARSSPEDKRLLVETLKGM-GDVVAVTGDGTNDAPALKLA 90

Query: 894 DVG--VGIVGKEGKQASLAADFSITQFCHLTELLLWHGRNSYKRSAKLAQFVMHRGLIIA 951
           DVG  +GI G E  + +         F  + + + W GR       K  QF +   +   
Sbjct: 91  DVGFSMGISGTEVAREASDIILMTDDFAAIVDAIKW-GRCVSISIKKFIQFQLIVNITAV 149

Query: 952 ICQAVYSICS 961
           I   V SI S
Sbjct: 150 ILAFVSSIAS 159

 Score = 32.0 bits (71), Expect = 3.2,   Method: Compositional matrix adjust.
 Identities = 17/44 (38%), Positives = 26/44 (59%), Gaps = 5/44 (11%)

Query: 269 DLKVGDLIKVHKGDRIPADLVLLQSSEPSGESFIKTDQLDGETD 312
           +L VGD+I +  GD IPAD VL++     G+  +    + GE+D
Sbjct: 615 NLLVGDIITLQTGDVIPADGVLVE-----GQCEVDESSITGESD 653

>Scas_569.0d
          Length = 468

 Score = 39.3 bits (90), Expect = 0.019,   Method: Compositional matrix adjust.
 Identities = 39/120 (32%), Positives = 60/120 (50%), Gaps = 17/120 (14%)

Query: 849 LPTVIACRCTPQQKADVALVIRKMTGKRVCCI-GDGGNDVSMIQCADVGV--GIVGKE-G 904
           LP VIA RC+PQ K  +   + +    + C + GDG ND   ++ A+VG+  GI G +  
Sbjct: 101 LPLVIA-RCSPQTKVRMIEALHRR--DKFCAMTGDGVNDSPSLKMANVGIAMGINGSDVA 157

Query: 905 KQAS--LAADFSITQFCHLTELLLWHGRNSYKRSAKLAQFVMHRGLIIAICQAVYSICSL 962
           K AS  + +D +     +  E     GR   + S  + +FV+   L   + QA+Y IC L
Sbjct: 158 KDASDIVLSDDNFASILNAIE----EGR---RMSDNIQKFVLQL-LAENVAQALYLICGL 209

>KLLA0D04092g complement(344666..348124) some similarities with
           sp|P38995 Saccharomyces cerevisiae YDR270w CCC2 probable
           copper-transporting ATPase P16.2.f2.1, hypothetical
           start
          Length = 1152

 Score = 37.7 bits (86), Expect = 0.065,   Method: Compositional matrix adjust.
 Identities = 15/41 (36%), Positives = 27/41 (65%)

Query: 745 LTGVEDKLQKDVKSSIELLRNAGIKIWMLTGDKVETARCVS 785
           +   +D+++ + K  I+ LR +GI+ WM++GD   TAR V+
Sbjct: 924 MCAAKDEIRPEAKDVIKELRRSGIECWMISGDNEVTARAVA 964

>AGL041C [4270] [Homologous to ScYDR270W - NSH] (628428..632129) [3702
            bp, 1233 aa]
          Length = 1233

 Score = 37.0 bits (84), Expect = 0.10,   Method: Compositional matrix adjust.
 Identities = 19/71 (26%), Positives = 36/71 (50%), Gaps = 7/71 (9%)

Query: 747  GVEDKLQKDVKSSIELLRNAGIKIWMLTGDKVETARCVSISAKLISRGQYVHTITKVTRP 806
             V D+L+ + K  ++ L   GI+ WM++GD    A  V++   +       H I  V  P
Sbjct: 1015 AVRDELRPEAKEVVQALHERGIECWMISGDNSLAANAVALEVGI------KHVIADVL-P 1067

Query: 807  EGAFNQLEYLK 817
            EG   ++++++
Sbjct: 1068 EGKAEKIQWIR 1078

 Score = 33.5 bits (75), Expect = 1.3,   Method: Compositional matrix adjust.
 Identities = 20/57 (35%), Positives = 30/57 (52%), Gaps = 3/57 (5%)

Query: 859  PQQKADVALVIRKMTGKRVCC--IGDGGNDVSMIQCADVGVGIVGKEGKQASLAADF 913
            P+ KA+    IR+ +G+ V    +GDG ND   I  ADVG+ +       A ++ DF
Sbjct: 1067 PEGKAEKIQWIRETSGQGVAIAMVGDGMNDAPAIAAADVGISLASGS-DLAMISCDF 1122

>Kwal_55.21575
          Length = 989

 Score = 37.0 bits (84), Expect = 0.11,   Method: Compositional matrix adjust.
 Identities = 16/47 (34%), Positives = 27/47 (57%)

Query: 261 RNRSIPSKDLKVGDLIKVHKGDRIPADLVLLQSSEPSGESFIKTDQL 307
           + R IP + L+VGD +++  G +IP D V+++      ES I  + L
Sbjct: 418 KAREIPVEFLQVGDTVEIKPGAKIPTDGVIIEGESEVDESLITGESL 464

>CAGL0M08602g complement(856349..859387) similar to sp|P38995
           Saccharomyces cerevisiae YDR270w CCC2, start by
           similarity
          Length = 1012

 Score = 34.3 bits (77), Expect = 0.65,   Method: Compositional matrix adjust.
 Identities = 25/83 (30%), Positives = 44/83 (53%), Gaps = 5/83 (6%)

Query: 735 YLEHDLELLGLTGVEDKLQKDVKSSIELLRNAGIKIWMLTGDKVETARCVSISAKLISRG 794
           YL  D ++ G   + D+++ D K  I  LRN   +++M+TGD  ++A  V+    +    
Sbjct: 748 YLAIDDKVCGRFELLDEVKSDAKDVIRYLRNNNYEVFMVTGDTHKSAMKVAEMVDIPPNN 807

Query: 795 QYVHTITKVTRPEGAFNQLEYLK 817
            Y    ++VT P+G    +EYL+
Sbjct: 808 VY----SEVT-PDGKSQTVEYLR 825

>YBR295W (PCA1) [472] chr2 (792805..796455) P-type copper-transporting
            ATPase, involved in resistance to cadmium [3651 bp, 1216
            aa]
          Length = 1216

 Score = 33.1 bits (74), Expect = 1.6,   Method: Compositional matrix adjust.
 Identities = 18/43 (41%), Positives = 27/43 (62%), Gaps = 2/43 (4%)

Query: 748  VEDKLQKDVKSSIELLRNAGIKIWMLTGDKVETARCVSISAKL 790
            +ED L+ D  S+I LLR  GI + +L+GD     R  S++A+L
Sbjct: 1022 LEDSLRADAVSTINLLRQRGISLHILSGDDDGAVR--SMAARL 1062

>AGR259C [4570] [Homologous to ScYOR168W (GLN4) - SH]
            (1227069..1229465) [2397 bp, 798 aa]
          Length = 798

 Score = 32.3 bits (72), Expect = 2.8,   Method: Compositional matrix adjust.
 Identities = 17/60 (28%), Positives = 31/60 (51%), Gaps = 5/60 (8%)

Query: 990  TLDHDIEESLTKIYPELYKELTEGKSLSYKTFFVWVLLSLFQGSVI-----QLFSQAFTS 1044
            +L+ D    +T+I+     +  +GK    KT+  WV ++   GS I     ++++Q FTS
Sbjct: 647  SLERDANGKITRIHAHYENDTPDGKPRKPKTYIQWVPIAPRHGSPIPVAETRVYNQLFTS 706

>YDL079C (MRK1) [789] chr4 complement(312951..314044,314337..314748)
           Member of the GSK-3 subfamily of protein kinases [1506
           bp, 501 aa]
          Length = 501

 Score = 32.0 bits (71), Expect = 3.1,   Method: Compositional matrix adjust.
 Identities = 27/123 (21%), Positives = 55/123 (44%), Gaps = 2/123 (1%)

Query: 516 KKIHLGTVSYTSETLDIVSDYVQSLVSSKNDSLNNSKVALSTTRKDMSFRVRDMILTLAI 575
           +K H GT+  +  T ++V      +V +      N KVA+    +D  ++ R++     +
Sbjct: 153 RKNHGGTIDISYPTTEVVGHGSFGVVVTTVIIETNQKVAIKKVLQDRRYKNRELETMKML 212

Query: 576 CHNVTPTFEDDELTYQAASPDEIAIVKFTESVGLSLFKRDRHSISLLHEHSGKTLNYEIL 635
           CH  T   +     Y+    DE+ +    + +  SL++R RH ++L  +     + +   
Sbjct: 213 CHPNTVGLQ--YYFYEKDEEDEVYLNLVLDYMPQSLYQRLRHFVNLKMQMPRVEIKFYAY 270

Query: 636 QVF 638
           Q+F
Sbjct: 271 QLF 273

>YDL024C (DIA3) [837] chr4 complement(408448..409854) Protein
           involved in invasive and pseudohyphal growth, has
           similarity to acid phosphatases [1407 bp, 468 aa]
          Length = 468

 Score = 31.6 bits (70), Expect = 4.1,   Method: Compositional matrix adjust.
 Identities = 39/169 (23%), Positives = 65/169 (38%), Gaps = 23/169 (13%)

Query: 531 DIVSDYVQSLVSSKNDSLNNSKVALSTTRKDMS--FRVRDMILTLAICHNVTPTFEDDEL 588
           DI+  Y +  + + +D LN+    L+ +RKD +  F      L      N+   F   EL
Sbjct: 226 DILMSYSRDYLENISDRLNDENKGLNLSRKDAAALFSWCAFELNAKGYSNICDIFSAAEL 285

Query: 589 TYQAASPDEIAI------VKFTESVGLSLF-------KRDRH---SISLLHEHSGKTLNY 632
            + +   D  +        K  +S+G +LF       ++  H    + L   H    LNY
Sbjct: 286 IHYSYETDLTSFYQNGPGYKLIKSIGANLFNATVKLIRQSAHLDQKVWLSFTHDTDILNY 345

Query: 633 EILQVFPFNSDSKRMG---IIVRDEQLDEYWFMQKGADTVMSKIVESND 678
             L       D++ +    +  RD      W++ +GA     K   SND
Sbjct: 346 --LTTAGLIDDTRNLTTNHVPFRDHSYHRSWYIPQGARVYTEKFQCSND 392

>YMR139W (RIM11) [4096] chr13 (546124..547236) Member of the GSK3
           subfamily of protein kinases, required for induction of
           IME2 by Ime1p [1113 bp, 370 aa]
          Length = 370

 Score = 31.6 bits (70), Expect = 4.2,   Method: Compositional matrix adjust.
 Identities = 24/90 (26%), Positives = 42/90 (46%), Gaps = 4/90 (4%)

Query: 550 NSKVALSTTRKDMSFRVRDMILTLAICH-NVTPTFEDDELTYQAASPDEIAIVKFTESVG 608
           N KVA+    +D  F+ R++ +   + H N+    +     Y+  S DEI +    E + 
Sbjct: 62  NEKVAIKKVLQDKRFKNRELEIMKMLSHINI---IDLKYFFYERDSQDEIYLNLILEYMP 118

Query: 609 LSLFKRDRHSISLLHEHSGKTLNYEILQVF 638
            SL++R RH +      S   + Y + Q+F
Sbjct: 119 QSLYQRLRHFVHQRTPMSRLEIKYYMFQLF 148

>YKL139W (CTK1) [3128] chr11 (182963..184549) C-terminal domain
           (CTD) kinase alpha subunit, cyclin-dependent protein
           kinase that phosphorylates C-terminal domain of RNA
           polymerase II large subunit Rpo21p [1587 bp, 528 aa]
          Length = 528

 Score = 31.6 bits (70), Expect = 4.5,   Method: Compositional matrix adjust.
 Identities = 25/66 (37%), Positives = 36/66 (54%), Gaps = 3/66 (4%)

Query: 704 KKIYEQFQKEYNDASLSMLNRDQQMSQVITKYLEHDLELLGLTGVEDK--LQKDVKSSIE 761
           K +Y  F+   ND S  +LN++ Q+S    K+L   L LLG+  + D   L +DVK S  
Sbjct: 254 KTVYMIFEYADNDLSGLLLNKEVQISHSQCKHLFKQL-LLGMEYLHDNKILHRDVKGSNI 312

Query: 762 LLRNAG 767
           L+ N G
Sbjct: 313 LIDNQG 318

>Scas_709.33
          Length = 585

 Score = 31.2 bits (69), Expect = 5.5,   Method: Compositional matrix adjust.
 Identities = 16/57 (28%), Positives = 32/57 (56%), Gaps = 2/57 (3%)

Query: 625 HSGKTLNYEILQVFP--FNSDSKRMGIIVRDEQLDEYWFMQKGADTVMSKIVESNDW 679
           H G  ++Y+I Q     F+S      I  ++EQ D + F ++ + T+++ I+E+N +
Sbjct: 207 HGGNNIDYQIPQSTTSLFDSIIDESNITYKEEQTDSHDFFKRISPTMLNDIIENNSF 263

  Database: blastdb
    Posted date:  Apr 3, 2006  3:33 PM
  Number of letters in database: 16,596,109
  Number of sequences in database:  34,618
  
Lambda     K      H
   0.320    0.135    0.392 

Gapped
Lambda     K      H
   0.267   0.0410    0.140 

Matrix: BLOSUM62
Gap Penalties: Existence: 11, Extension: 1
Number of Sequences: 34618
Number of Hits to DB: 34,958,304
Number of extensions: 1485115
Number of successful extensions: 4730
Number of sequences better than 10.0: 100
Number of HSP's gapped: 4645
Number of HSP's successfully gapped: 175
Length of query: 1131
Length of database: 16,596,109
Length adjustment: 112
Effective length of query: 1019
Effective length of database: 12,718,893
Effective search space: 12960551967
Effective search space used: 12960551967
Neighboring words threshold: 11
Window for multiple hits: 40
X1: 16 ( 7.4 bits)
X2: 38 (14.6 bits)
X3: 64 (24.7 bits)
S1: 41 (21.8 bits)
S2: 67 (30.4 bits)