Hit NameLength (aa)HSP LengthHSP ScoreHSP Significance
YIL047C (SYG1)90288747220.0
Scas_700.25*93191423850.0
CAGL0L00737g91192922400.0
Scas_704.3991692622110.0
Kwal_23.578585689221600.0
ADL080W86389319290.0
KLLA0F27467g84490515670.0
Sklu_2440.133812341604e-11
Kwal_47.187213832321471e-09
AAR127C3812431401e-08
KLLA0A02057g3842401401e-08
KLLA0F06160g8593211251e-06
YNR013C (PHO91)8943191152e-05
CAGL0F02871g3682181052e-04
Scas_625.169323151043e-04
YDR414C (ERD1)3621841025e-04
Scas_570.8353178980.001
AFR628C86948970.002
Kwal_33.13618891104930.006
YJL198W (PHO90)881227930.007
YCR037C (PHO87)92367920.010
Scas_689.169194910.011
KLLA0C03454g90042910.014
Kwal_27.127511093136880.028
CAGL0I05632g886304870.038
Sklu_2438.1455862840.077
CAGL0F02387g95249830.10
Scas_634.1591644820.13
Kwal_23.612981656810.19
ADR289C80751810.20
AGR223W1321131800.23
KLLA0E15774g1148137760.64
Scas_595.91148119750.84
CAGL0J07040g124545741.1
Scas_636.1283740731.6
YPL110C1223139731.7
Kwal_56.2341082530731.7
Kwal_56.2443620062701.9
KLLA0F14509g85142722.1
YNL268W (LYP1)611110722.1
Scas_633.1531178702.5
AGL020W84451712.6
CAGL0M00748g43771702.9
Sklu_2202.8136748713.1
CAGL0L10780g223331703.7
ADR098C20154674.8
Kwal_26.694057048677.1
Kwal_56.2288730978668.3
Kwal_23.620856057678.6
KLLA0E13585g580143669.0
BLASTP 2.2.26 [Sep-21-2011]

Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, 
Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), 
"Gapped BLAST and PSI-BLAST: a new generation of protein database search
programs",  Nucleic Acids Res. 25:3389-3402.

Reference for compositional score matrix adjustment: Altschul, Stephen F., 
John C. Wootton, E. Michael Gertz, Richa Agarwala, Aleksandr Morgulis,
Alejandro A. Schaffer, and Yi-Kuo Yu (2005) "Protein database searches
using compositionally adjusted substitution matrices", FEBS J. 272:5101-5109.

Query= YIL047C
         (887 letters)

Database: blastdb 
           34,618 sequences; 16,596,109 total letters

Searching..................................................done

                                                                 Score    E
Sequences producing significant alignments:                      (bits) Value

YIL047C (SYG1) [2620] chr9 complement(265114..267822) Protein fo...  1823   0.0  
Scas_700.25*                                                          923   0.0  
CAGL0L00737g complement(90349..93084) similar to sp|P40528 Sacch...   867   0.0  
Scas_704.39                                                           856   0.0  
Kwal_23.5785                                                          836   0.0  
ADL080W [1661] [Homologous to ScYIL047C (SYG1) - SH] complement(...   747   0.0  
KLLA0F27467g complement(2541110..2543644) similar to sp|P40528 S...   608   0.0  
Sklu_2440.13 YDR414C, Contig c2440 19959-21104 reverse complement      66   4e-11
Kwal_47.18721                                                          61   1e-09
AAR127C [314] [Homologous to ScYDR414C (ERD1) - SH] (568957..570...    59   1e-08
KLLA0A02057g 186220..187374 gi|1169545|sp|P41771|ERD1_KLULA Kluy...    59   1e-08
KLLA0F06160g 598549..601128 similar to sp|P27514 Saccharomyces c...    53   1e-06
YNR013C (PHO91) [4596] chr14 complement(649027..651711) Member o...    49   2e-05
CAGL0F02871g complement(278122..279228) similar to sp|P16151 Sac...    45   2e-04
Scas_625.16                                                            45   3e-04
YDR414C (ERD1) [1239] chr4 complement(1295586..1296674) Protein ...    44   5e-04
Scas_570.8                                                             42   0.001
AFR628C [3820] [Homologous to ScYJL198W (PHO90) - SH; ScYCR037C ...    42   0.002
Kwal_33.13618                                                          40   0.006
YJL198W (PHO90) [2728] chr10 (60843..63488) Phosphate transporte...    40   0.007
YCR037C (PHO87) [571] chr3 complement(194409..197180) Member of ...    40   0.010
Scas_689.1                                                             40   0.011
KLLA0C03454g 311611..314313 similar to sp|P25360 Saccharomyces c...    40   0.014
Kwal_27.12751                                                          39   0.028
CAGL0I05632g 531308..533968 similar to sp|P27514 Saccharomyces c...    38   0.038
Sklu_2438.14 YOR348C, Contig c2438 29357-31033                         37   0.077
CAGL0F02387g complement(229207..232065) similar to sp|P25360 Sac...    37   0.10 
Scas_634.15                                                            36   0.13 
Kwal_23.6129                                                           36   0.19 
ADR289C [2030] [Homologous to ScYNR013C (PHO91) - SH] (1193040.....    36   0.20 
AGR223W [4534] [Homologous to ScYPL110C - SH] complement(1167870...    35   0.23 
KLLA0E15774g 1402940..1406386 similar to sp|P17442 Saccharomyces...    34   0.64 
Scas_595.9                                                             33   0.84 
CAGL0J07040g 675389..679126 similar to tr|Q02979 Saccharomyces c...    33   1.1  
Scas_636.12                                                            33   1.6  
YPL110C (YPL110C) [5334] chr16 complement(341067..344738) Member...    33   1.7  
Kwal_56.23410                                                          33   1.7  
Kwal_56.24436                                                          32   1.9  
KLLA0F14509g complement(1345334..1347889) weakly similar to sp|P...    32   2.1  
YNL268W (LYP1) [4340] chr14 (138549..140384) High affinity lysin...    32   2.1  
Scas_633.15                                                            32   2.5  
AGL020W [4291] [Homologous to ScYFL004W (VTC2) - SH; ScYPL019C (...    32   2.6  
CAGL0M00748g complement(84109..85422) similar to tr|Q06200 Sacch...    32   2.9  
Sklu_2202.8 YPL110C, Contig c2202 8829-12932                           32   3.1  
CAGL0L10780g complement(1149588..1156289) highly similar to sp|Q...    32   3.7  
ADR098C [1839] [Homologous to ScYDL135C (RDI1) - SH] (885299..88...    30   4.8  
Kwal_26.6940                                                           30   7.1  
Kwal_56.22887                                                          30   8.3  
Kwal_23.6208                                                           30   8.6  
KLLA0E13585g complement(1195444..1197186) some similarities with...    30   9.0  

>YIL047C (SYG1) [2620] chr9 complement(265114..267822) Protein for
           which truncation and overexpression can suppress
           lethality of Gpa1p deficiency, member of the divalent
           anion:Na+ (DASS) family of membrane transporters [2709
           bp, 902 aa]
          Length = 902

 Score = 1823 bits (4722), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 875/887 (98%), Positives = 875/887 (98%)

Query: 1   MKFADHLTESAIPEWRDKYIDYKVGKKKLRRYKEKLDAEEEQSSSYRSWMPSVSVYQTAF 60
           MKFADHLTESAIPEWRDKYIDYKVGKKKLRRYKEKLDAEEEQSSSYRSWMPSVSVYQTAF
Sbjct: 1   MKFADHLTESAIPEWRDKYIDYKVGKKKLRRYKEKLDAEEEQSSSYRSWMPSVSVYQTAF 60

Query: 61  QQREPGKSRSDGDYRSGPAFKKDYSALQREFVADFIEDWLISFQLSKCNEFYLWLLKECD 120
           QQREPGKSRSDGDYRSGPAFKKDYSALQREFVADFIEDWLISFQLSKCNEFYLWLLKECD
Sbjct: 61  QQREPGKSRSDGDYRSGPAFKKDYSALQREFVADFIEDWLISFQLSKCNEFYLWLLKECD 120

Query: 121 KKFEVLQSQLHYYSLQKNYERDNLNRSSSNVDMSTSLYAAGLAGRSDSRVNSIDSDSRSV 180
           KKFEVLQSQLHYYSLQKNYERDNLNRSSSNVDMSTSLYAAGLAGRSDSRVNSIDSDSRSV
Sbjct: 121 KKFEVLQSQLHYYSLQKNYERDNLNRSSSNVDMSTSLYAAGLAGRSDSRVNSIDSDSRSV 180

Query: 181 MYGSMPCTKEAKKPRLSLLAYCQKVLKDNRLLPSWPKRGFSLLQDLRQDASSRGRETFAF 240
           MYGSMPCTKEAKKPRLSLLAYCQKVLKDNRLLPSWPKRGFSLLQDLRQDASSRGRETFAF
Sbjct: 181 MYGSMPCTKEAKKPRLSLLAYCQKVLKDNRLLPSWPKRGFSLLQDLRQDASSRGRETFAF 240

Query: 241 GASFLETMTTTQARNLLSNAIIEYYLYLQLVKSFRDINVTGFRKMVKKFDKTCHTRELTT 300
           GASFLETMTTTQARNLLSNAIIEYYLYLQLVKSFRDINVTGFRKMVKKFDKTCHTRELTT
Sbjct: 241 GASFLETMTTTQARNLLSNAIIEYYLYLQLVKSFRDINVTGFRKMVKKFDKTCHTRELTT 300

Query: 301 FMSYARTHYTLFKHADANVQLVAQKMQQITSSQPTPTSELSSAQRDKEPITWLETQITEW 360
           FMSYARTHYTLFKHADANVQLVAQKMQQITSSQPTPTSELSSAQRDKEPITWLETQITEW
Sbjct: 301 FMSYARTHYTLFKHADANVQLVAQKMQQITSSQPTPTSELSSAQRDKEPITWLETQITEW 360

Query: 361 FTTALTNSPKDRKHNTHKLKKLTIQYSISEQMVHRNNRSIVQMLVVGLGIGVSMTLITYT 420
           FTTALTNSPKDRKHNTHKLKKLTIQYSISEQMVHRNNRSIVQMLVVGLGIGVSMTLITYT
Sbjct: 361 FTTALTNSPKDRKHNTHKLKKLTIQYSISEQMVHRNNRSIVQMLVVGLGIGVSMTLITYT 420

Query: 421 LYLGISSEETSFTHKILFPLWGGWYMVLLIAFLFLVNCFIWHRTGINYRFIMLGEIQSKN 480
           LYLGISSEETSFTHKILFPLWGGWYMVLLIAFLFLVNCFIWHRTGINYRFIMLGEIQSKN
Sbjct: 421 LYLGISSEETSFTHKILFPLWGGWYMVLLIAFLFLVNCFIWHRTGINYRFIMLGEIQSKN 480

Query: 481 GTQFFNNDFATSKIPLKLYFLTFFIVPCAVCSMLSFALEKLTPLGFLYIGIVSFLFLCPS 540
           GTQFFNNDFATSKIPLKLYFLTFFIVPCAVCSMLSFALEKLTPLGFLYIGIVSFLFLCPS
Sbjct: 481 GTQFFNNDFATSKIPLKLYFLTFFIVPCAVCSMLSFALEKLTPLGFLYIGIVSFLFLCPS 540

Query: 541 GLIPYWDKVVHTRKWLVVTLIRLMMSGFFPVEFGDFFLGDIICSLTYSIADIAMFFCVYS 600
           GLIPYWDKVVHTRKWLVVTLIRLMMSGFFPVEFGDFFLGDIICSLTYSIADIAMFFCVYS
Sbjct: 541 GLIPYWDKVVHTRKWLVVTLIRLMMSGFFPVEFGDFFLGDIICSLTYSIADIAMFFCVYS 600

Query: 601 HTPNNLCGSSHSRAMGVLSCLPSYWRFMQCLRRFADSGDWFPHLLNAAKYTLGIAYNATL 660
           HTPNNLCGSSHSRAMGVLSCLPSYWRFMQCLRRFADSGDWFPHLLNAAKYTLGIAYNATL
Sbjct: 601 HTPNNLCGSSHSRAMGVLSCLPSYWRFMQCLRRFADSGDWFPHLLNAAKYTLGIAYNATL 660

Query: 661 CAYRLSDRSEQRRTPFIVCATLNSILTSAWDLVMDWSFAHNTTSYNWLLRDDLYLAGKKN 720
           CAYRLSDRSEQRRTPFIVCATLNSILTSAWDLVMDWSFAHNTTSYNWLLRDDLYLAGKKN
Sbjct: 661 CAYRLSDRSEQRRTPFIVCATLNSILTSAWDLVMDWSFAHNTTSYNWLLRDDLYLAGKKN 720

Query: 721 WENGSYSFSRKLVYYFAMIWDILIRFEWIVYAIAPQTIQQSAVTSFILALLEVLRRFVWI 780
           WENGSYSFSRKLVYYFAMIWDILIRFEWIVYAIAPQTIQQSAVTSFILALLEVLRRFVWI
Sbjct: 721 WENGSYSFSRKLVYYFAMIWDILIRFEWIVYAIAPQTIQQSAVTSFILALLEVLRRFVWI 780

Query: 781 IFRVENEHVANVHLFRVTGDAPLPYPIAQVXXXXXXXXXXXXKAFSSLNDIPITPSHDNN 840
           IFRVENEHVANVHLFRVTGDAPLPYPIAQV            KAFSSLNDIPITPSHDNN
Sbjct: 781 IFRVENEHVANVHLFRVTGDAPLPYPIAQVGDDSMDSSDLGSKAFSSLNDIPITPSHDNN 840

Query: 841 PHSFAEPMPAYRGTFRRRSSVFENISRSIPWAHATDFQRPTVNTVDD 887
           PHSFAEPMPAYRGTFRRRSSVFENISRSIPWAHATDFQRPTVNTVDD
Sbjct: 841 PHSFAEPMPAYRGTFRRRSSVFENISRSIPWAHATDFQRPTVNTVDD 887

>Scas_700.25*
          Length = 931

 Score =  923 bits (2385), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 466/914 (50%), Positives = 618/914 (67%), Gaps = 37/914 (4%)

Query: 1   MKFADHLTESAIPEWRDKYIDYKVGKKKLRRYKEKL--DAEEEQSSSYRSWMPSVSVYQT 58
           MKF DHL ES IPEW+DKY++YKVGKKKL+ +K+KL  D +E  + S  +   S S+  T
Sbjct: 1   MKFGDHLNESMIPEWKDKYVEYKVGKKKLKTFKQKLQNDIDETTTDSLLNASVSDSIEST 60

Query: 59  AFQQREPGKSRSDGDYRSGPAFKKDYSALQREFVADFIEDWLISFQLSKCNEFYLWLLKE 118
              Q           Y    + +KDYS ++++ V +F++DWLI  QL+KCN+FY  L+ +
Sbjct: 61  YIDQENSTPVTPSHVY----SIQKDYSPVKKKIVQEFVKDWLIGEQLNKCNDFYEELIND 116

Query: 119 CDKKFEVLQSQLHYYSLQKNYERDNLNRSSSNVDMSTSLYAAGLAGRSDSRVNSIDSDSR 178
           C KK+ +L++Q+ +Y++Q++   +   R+   V  S S+        S  +     +  R
Sbjct: 117 CRKKYNILENQIRFYNIQRHSIDNKKTRNLLIVSSSESVDVENTPIDSTIQHPYAPNRGR 176

Query: 179 SVMYGSMPCTKEAKKPRLSLLAYCQK---VLKDNRLLPSWPKRGFSLLQDLRQDASSRGR 235
            +          A K   S   Y QK   +LK+N +LPS P +G +         S    
Sbjct: 177 VITLNGQQNVANANKNFASHFLYFQKLKTILKNNNVLPSLPAKGITSYFHQNGRGSQGEG 236

Query: 236 ETFAFGASFLETMTTTQARNLLSNAIIEYYLYLQLVKSFRDINVTGFRKMVKKFDKTCHT 295
              A     L  +T  +A+ LL+ AI+E+YL+LQLVK++RD+N+TGFRK+ KKFDKTC T
Sbjct: 237 NINASENDMLSEITVEKAQKLLTEAILEFYLFLQLVKTYRDLNLTGFRKIAKKFDKTCET 296

Query: 296 RELTTFMSYARTHYTLFKHADANVQLVAQKMQQITSSQPTPTSELSSAQRDKEPITWLET 355
           +E   FM+YA+ +YT+F H D N+ L+  +M++ ++ QP    +++      +P+ W E+
Sbjct: 297 KECLKFMNYAKENYTIFSHIDPNIALMTDRMKKTSTYQPLVFEDITPENESDDPLLWWES 356

Query: 356 QITEWFTTALTNSPKDRKHNTHKLKKLTIQYSISEQMVHRNNRSIVQMLVVGLGIGVSMT 415
           ++  W+   LTNS  + K N  KL+K  IQYS++E+++HR N SI+QM + G  IG + +
Sbjct: 357 KVRGWYIKDLTNSLTEMKRNNDKLRKFGIQYSLNERIIHRINISILQMTISGFFIGAAFS 416

Query: 416 LITYTLYLGISSEETSFTHKILFPLWGGWYMVLLIAFLFLVNCFIWHRTGINYRFIMLGE 475
           LI YTLYL  +S++ ++ H+ILFPLWGGWYMVLLI+FLF+ NCFIWHR+GINYRFIM GE
Sbjct: 417 LIIYTLYLIFTSDDKAYIHRILFPLWGGWYMVLLISFLFIGNCFIWHRSGINYRFIMFGE 476

Query: 476 IQSKNGTQFFNNDFATSKIPLKLYFLTFFIVPCAVCSMLSFALEKLTPLGFLYIGIVSFL 535
           IQ+++GTQFFNNDFAT+KI LK YF++ FI+ C++ +++SF LEKLTPLGF++ GIV  L
Sbjct: 477 IQARSGTQFFNNDFATTKISLKYYFISLFILACSILAIISFQLEKLTPLGFIFPGIVITL 536

Query: 536 FLCPSGLIPYWDKVVHTRKWLVVTLIRLMMSGFFPVEFGDFFLGDIICSLTYSIADIAMF 595
           FL PS +IP+WDK+V TRKWL  + IRL+ SGF+PVEFGDFFLGDI+CSLTYSI+D+AMF
Sbjct: 537 FLAPSWMIPFWDKLVETRKWLFCSGIRLIFSGFYPVEFGDFFLGDIVCSLTYSISDLAMF 596

Query: 596 FCVYSHTPNNLCGSSHSRAMGVLSCLPSYWRFMQCLRRFADSGDWFPHLLNAAKYTLGIA 655
           FCVY  + N  C SSH R+MGVL CLPS+WRFMQCLRRFADSGDWFPHLLNAAKYTLG+A
Sbjct: 597 FCVYVRSDNATCSSSHLRSMGVLGCLPSFWRFMQCLRRFADSGDWFPHLLNAAKYTLGVA 656

Query: 656 YNATLCAYRLSDRSEQRRTPFIVCATLNSILTSAWDLVMDWSFAHNTTSYNWLLRDDLYL 715
           YNATLC YR+S +S   R  FIV ATLN+  TS WDLVMDWS    + + N  LRDDLYL
Sbjct: 657 YNATLCVYRISPKSFHSRQIFIVFATLNATYTSIWDLVMDWSLLQPSQN-NTFLRDDLYL 715

Query: 716 AGKKNWENGSYSFSRKLVYYFAMIWDILIRFEWIVYAIAPQTIQQSAVTSFILALLEVLR 775
           AGKKNW+ G YS  RK +YYFAMIW++++RFEWIVYAIAPQTIQQSA TSFILA  EVLR
Sbjct: 716 AGKKNWKTGKYSNKRKSIYYFAMIWNVIVRFEWIVYAIAPQTIQQSADTSFILATAEVLR 775

Query: 776 RFVWIIFRVENEHVANVHLFRVTGDAPLPYPIAQVXXX-------XXXXXXXXXKAFSSL 828
           RFVWIIFRVENEHVANV+LFRV+G APLPYPI                      ++ S  
Sbjct: 776 RFVWIIFRVENEHVANVNLFRVSGTAPLPYPINITSITPLGSSDSDEATNIIVLESNSGN 835

Query: 829 NDIPIT--PSHDNN-----------PH-------SFAEPMPAYRGTFRRRSSVFENISRS 868
           +++ +T  P   +N           P+          EPMPAY     RR++ F +IS+S
Sbjct: 836 DNLSVTNEPQQTSNRINRFDTVGAVPNVDITRETRIEEPMPAYHPPLERRTTTFGSISKS 895

Query: 869 IPWAHATDFQRPTV 882
           IPWAH +DFQRP++
Sbjct: 896 IPWAHTSDFQRPSI 909

>CAGL0L00737g complement(90349..93084) similar to sp|P40528
           Saccharomyces cerevisiae YIL047c SYG1, start by
           similarity
          Length = 911

 Score =  867 bits (2240), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 461/929 (49%), Positives = 598/929 (64%), Gaps = 91/929 (9%)

Query: 1   MKFADHLTESAIPEWRDKYIDYKVGKKKLRRYKEKLDAEEEQSSSYRSWMPSVSVYQTAF 60
           MKFADHL ES I EW+ KYIDYK GKKK          ++ ++++ +  +P+V       
Sbjct: 1   MKFADHLRESTISEWKGKYIDYKYGKKK---------LKKYKANTAKLNIPAVG------ 45

Query: 61  QQREPGKSRSDGDYRSGPAF-KKDYSALQREFVADFIEDWLISFQLSKCNEFYLWLLKEC 119
                        Y SG    KK Y+  Q E + DFIEDWLI  QL KCNEFYLWLL +C
Sbjct: 46  -------------YVSGRGTPKKKYNDFQVECINDFIEDWLIPNQLYKCNEFYLWLLSQC 92

Query: 120 DKKFEVLQSQLHYYSLQKNYERDNLNRSSSNVDMSTSLYAAGLAGRSDSRVNSIDSDSRS 179
            +K+ +L  QL  Y   K   R+  +R +     ++ L A G    +             
Sbjct: 93  QEKYLILSQQLDCYREHKKEFREISSRVTYQTSSTSVLQAYGSISNAPE--------EDI 144

Query: 180 VMYGSMPCTKEAKKPRLSLLAYCQKVLKDNRLLPSWPKRGFSLLQDLRQDAS--SRGRET 237
                +   K     +++L    +  L ++ L+PSWPK     + +  +  S  ++ +ET
Sbjct: 145 EEDPELSFKKHDNMFQMTL----KHFLNEHDLMPSWPKMFIETIPEALKPKSINTKLKET 200

Query: 238 FAF-----------------GASFLET--MTTTQARNLLSNAIIEYYLYLQLVKSFRDIN 278
           FA+                 G   L+        AR LLS+A++E+YL+LQLVKS+RD+N
Sbjct: 201 FAYSNKLNLNLNLMRNKDEHGNKILKNPHKELKHARALLSDALLEFYLFLQLVKSYRDVN 260

Query: 279 VTGFRKMVKKFDKTCHTRELTTFMSYARTHYTLFKHADANVQ--LVAQKMQQITS----- 331
           V GFRK+VKKFDKTC T+EL  FM + R +YT+FKH   + +  + A K + +T      
Sbjct: 261 VVGFRKIVKKFDKTCKTQELAGFMRFVRANYTIFKHDAVSTEATIKASKAKTLTDDDIGE 320

Query: 332 -SQPTPTSELSSAQRDKEPITWLETQITEWFTTALTNSPKDRKHNTHKLKKLTIQYSISE 390
            S     + +S      +P+   E ++T+W+T  + NS  ++K +  KLKK++IQYS++E
Sbjct: 321 DSSTITDTNVSLTSTTIDPLRAWEAKLTKWYTVDVVNSLSEKKRHLEKLKKVSIQYSLNE 380

Query: 391 QMVHRNNRSIVQMLVVGLGIGVSMTLITYTLYLGISSEETSFTHKILFPLWGGWYMVLLI 450
           QM+HRNNR+I+QM V G+  G+++TLI YTLYL   S   +  HKILFP+WGGWYM+LLI
Sbjct: 381 QMIHRNNRAILQMTVFGVFTGIAVTLIAYTLYLAFLSPLNTKRHKILFPIWGGWYMILLI 440

Query: 451 AFLFLVNCFIWHRTGINYRFIMLGEIQSKNGTQFFNNDFATSKIPLKLYFLTFFIVPCAV 510
           +  FL++CFIWHRTGINYRFIM GE+Q+K+GTQFFNNDFAT+ IPL+LYFL FFI+ CA+
Sbjct: 441 SLFFLIDCFIWHRTGINYRFIMFGEVQAKSGTQFFNNDFATTGIPLRLYFLAFFIISCAI 500

Query: 511 CSMLSFALEKLTPLGFLYIGIVSFLFLCPSGLIPYWDKVVHTRKWLVVTLIRLMMSGFFP 570
            S LSF  + LTP G++Y  +V  LF+ P  LIPYWDK+V TRK+LV T IRL++SG +P
Sbjct: 501 ISALSFHFDHLTPYGYIYFIVVGLLFITPYDLIPYWDKLVETRKFLVTTTIRLVLSGLYP 560

Query: 571 VEFGDFFLGDIICSLTYSIADIAMFFCVYS----HTPNNLCGSSHSRAMGVLSCLPSYWR 626
           VEF DFFLGDIICSLTY+++D+A+F C Y+      P  +CGSSHS+AMGVLSCLPS+WR
Sbjct: 561 VEFKDFFLGDIICSLTYTLSDLAIFACYYAPKTRKDPLGMCGSSHSKAMGVLSCLPSFWR 620

Query: 627 FMQCLRRFADSGDWFPHLLNAAKYTLGIAYNATLCAYRLSDRSEQRRTPFIVCATLNSIL 686
           FMQC+RRF DS DWFPHL NAAKY LG+AYNATLCAYRLS+ S  +R PFI+ ATLNSI 
Sbjct: 621 FMQCVRRFFDSNDWFPHLPNAAKYLLGVAYNATLCAYRLSNHSPAKRNPFIIFATLNSIS 680

Query: 687 TSAWDLVMDWSFAHNTT-SYNWLLRDDLYLAGKKNWENGSYSFSRKLVYYFAMIWDILIR 745
           TS WDLVMDWS   ++  + N  LR DLYLAGK+NWE G Y +SRK VYY AM+ D++IR
Sbjct: 681 TSIWDLVMDWSVLQSSIGNENLFLRKDLYLAGKRNWETGKYDWSRKAVYYIAMVLDVVIR 740

Query: 746 FEWIVYAIAPQTIQQSAVTSFILALLEVLRRFVWIIFRVENEHVANVHLFRVTGDAPLPY 805
           F+WIVYA+APQTIQQSAVTSF LA+ EV RRF+W+IFRVENEHVANVHLFRVTG+A LPY
Sbjct: 741 FQWIVYAVAPQTIQQSAVTSFALAVTEVCRRFIWVIFRVENEHVANVHLFRVTGEALLPY 800

Query: 806 PIAQVXXXXXXXXX--------------XXXKAFSSLNDIPITPSHDNNPHSFAEPMPAY 851
           P   V                             S L+D+ ++ S  NN   F EP   Y
Sbjct: 801 PNQDVVDFSGKATTDLYDDQHFQQGRDSIESSRPSHLHDLDLSLSDINN--KFEEPTATY 858

Query: 852 RGTFRRRSSVFENISRSIPWAHATDFQRP 880
               RRR+++F+NISRSIPWAHA DFQRP
Sbjct: 859 HSIVRRRTAIFDNISRSIPWAHAKDFQRP 887

>Scas_704.39
          Length = 916

 Score =  856 bits (2211), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 451/926 (48%), Positives = 598/926 (64%), Gaps = 85/926 (9%)

Query: 1   MKFADHLTESAIPEWRDKYIDYKVGKKKLRRYKEKLDAEE-------EQSSSYRSWMPSV 53
           MKF DHL ES IPEW+DKYIDYK  KK+++ ++ K + +        ++ S+Y +     
Sbjct: 1   MKFGDHLRESIIPEWKDKYIDYKSSKKRIKHFRAKWENQSIYNDPVFQKKSTYSTTRDLR 60

Query: 54  SVYQTAFQQREPGKSRSDGDYRSGPAFK-------KDYSALQREFVADFIEDWLISFQLS 106
           S   +        ++ +    RS  +         + YS L  E + +F+E+W+IS QL+
Sbjct: 61  SNNNSQSNLNLNRQASNGNIIRSTNSSSSSLASSLRVYSPLLIEIIHEFMENWIISIQLT 120

Query: 107 KCNEFYLWLLKECDKKFEVLQSQLHYYSLQKNYERDNLNRSSSNVDMSTSLYAAGLAGRS 166
           KCNEFY WLL +  KKF++LQ+Q+H +++QK    D  N  SS+                
Sbjct: 121 KCNEFYNWLLNDSRKKFKILQNQVHLFNIQKRLFNDAANSISSS---------------- 164

Query: 167 DSRVNSIDSDSRSVMYGSMPCTKEAKKPRLSLLAYCQKVLKDNRLLPSWPKRGFS--LLQ 224
                          YGS+  +  +     SL+   +  L  +RLLPS+P+      +  
Sbjct: 165 ---------------YGSLMTSATSDSVTTSLIQSIKDTLHAHRLLPSYPQYSLKQLIFN 209

Query: 225 DLRQDASSR---GRETF--AFGASFLETMTTTQARN-------LLSNAIIEYYLYLQLVK 272
           +   D  S+    RETF             T+ A++       LLS+AI+E+YL+LQL+K
Sbjct: 210 NTTSDTESQPLMERETFNPEDQLLNNLNNNTSSAKSSLDKSAKLLSDAILEFYLFLQLIK 269

Query: 273 SFRDINVTGFRKMVKKFDKTCHTRELTTFMSYARTHYTLFKHADANVQLVAQKMQQITSS 332
           S+RD+NVTGFRK+VKKFDKT  T EL  FM++A+ ++T+FKH D N++L+  KM+QI+S 
Sbjct: 270 SYRDLNVTGFRKIVKKFDKTFQTNELNKFMAFAKQNFTIFKHIDPNIKLMTNKMKQISSY 329

Query: 333 QPTPTSELSSAQRDKEPITWLETQITEWFTTALTNSPKDRKHNTHKLKKLTIQYSISEQM 392
           QP    EL  +    +PI W E+++ +W+   LTNSPK  K N  KLKKL IQYS++EQM
Sbjct: 330 QPIIFDELIPSNEIDDPILWWESKVKDWYVNQLTNSPKSMKKNNKKLKKLIIQYSLNEQM 389

Query: 393 VHRNNRSIVQMLVVGLGIGVSMTLITYTLYLGISSEETSFTHKILFPLWGGWYMVLLIAF 452
           VHRNNR+I+QM +    +G+S T I  T+YL   S  TS+THKILFP+WGGWYMVLLI+ 
Sbjct: 390 VHRNNRAIIQMTIAAWILGISSTSIANTIYLSFMSGYTSYTHKILFPIWGGWYMVLLISL 449

Query: 453 LFLVNCFIWHRTGINYRFIMLGEIQSKNGTQFFNNDFATSKIPLKLYFLTFFIVPCAVCS 512
           L + NCFIWH++ INYRFIM GEI++++GTQF+NNDFAT++I L LYFL+FFI+P ++C+
Sbjct: 450 LIISNCFIWHKSEINYRFIMFGEIKARSGTQFYNNDFATTRISLNLYFLSFFILPLSICA 509

Query: 513 MLSFALEKLTPLGFLYIGIVSFLFLCPSG----LIPYWDKVVHTRKWLVVTLIRLMMSGF 568
           +LSF  E L P   +Y  I + LF+ P      ++PYW+K+   R W++ T IRL +SG 
Sbjct: 510 LLSFHNENLFPYAIIYPLIATSLFIAPKAISKYILPYWNKLKEIRVWILTTFIRLSLSGL 569

Query: 569 FPVEFGDFFLGDIICSLTYSIADIAMFFCVY-SHTPNNLCGSSHSRAMGVLSCLPSYWRF 627
           +PVEFGDFFLGDIICSLTYS++DIAMFFC+Y S  P+  CGSSHS  MG+LSCLP+YWR 
Sbjct: 570 YPVEFGDFFLGDIICSLTYSMSDIAMFFCIYFSDKPSTTCGSSHSITMGILSCLPNYWRM 629

Query: 628 MQCLRRFADSGDWFPHLLNAAKYTLGIAYNATLCAYRLSDRSE-QRRTPFIVCATLNSIL 686
           MQC RR+ADS DWFPHLLNA KY LG+AYN TLCAYRLS+      R  FI+ A LN+++
Sbjct: 630 MQCFRRWADSADWFPHLLNAIKYGLGVAYNGTLCAYRLSNHERGTTRNTFIIVAALNALI 689

Query: 687 TSAWDLVMDWSFAHNTTSYNWLLRDDLYLAGKKNWENGSYSFSRKLVYYFAMIWDILIRF 746
           TS WDL +DWS      S NWLLR+DLYLAGKK+WE G YS +RK  YY AM+WD+LIRF
Sbjct: 690 TSVWDLTVDWSLLQ-PDSNNWLLRNDLYLAGKKDWETGQYSRARKSFYYIAMVWDVLIRF 748

Query: 747 EWIVYAIAPQTIQQSAVTSFILALLEVLRRFVWIIFRVENEHVANVHLFRVTGDAPLPYP 806
           +WIVYAIAPQTIQQ+A+TSFILA  E++RR +W+I RVENEHVANVHLFRVTG+APLPYP
Sbjct: 749 QWIVYAIAPQTIQQNAITSFILATTEIIRRCIWVIIRVENEHVANVHLFRVTGNAPLPYP 808

Query: 807 IA-----------QVXXXXXXXXXXXXKAFSSLNDIPITPSHDNNPHSFAEPMPAYRGTF 855
           +            Q+            +A   L ++    S+D N        P YR   
Sbjct: 809 VNVQTIALTKPTFQIGEEERMAENLDQQA---LGNLSFNVSYDENAM-----WPPYRTLA 860

Query: 856 RRRSSVFENISRSIPWAHATDFQRPT 881
           RRR++ F  IS+SIPW HATDFQRPT
Sbjct: 861 RRRTTTFAEISKSIPWVHATDFQRPT 886

>Kwal_23.5785
          Length = 856

 Score =  836 bits (2160), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 429/892 (48%), Positives = 573/892 (64%), Gaps = 69/892 (7%)

Query: 1   MKFADHLTESAIPEWRDKYIDYKVGKKKLRRYKEKLDAEEEQSSSYRSWMPSVSVYQTAF 60
           MKFA+HL ESA+PEW DKYIDYK GKKKL+  +  + A E         + +VS + +  
Sbjct: 1   MKFAEHLRESAVPEWIDKYIDYKAGKKKLKSCRNTIAASE-------VLINNVSSFASVP 53

Query: 61  QQREPGKSRSDGDYRSGPAFKKDYSALQREFVADFIEDWLISFQLSKCNEFYLWLLKECD 120
             RE   SR     RS       Y+ +Q+ FV  F+E W+I  +L KCN+FYLW LK C 
Sbjct: 54  PSRESSMSRYLSQNRS-------YTPVQQRFVQSFVEKWVIDQELEKCNDFYLWELKRCG 106

Query: 121 KKFEVLQSQLHYYSLQKNYERDNLNRSSSNVDMSTSLYAAGLAGRSDSRVNSIDSDSRSV 180
           ++F VLQ Q+      + +E D   +S ++ D  +  Y A            +D D    
Sbjct: 107 RRFAVLQEQI------EKFEADQAQQSIADTD--SKYYGA------------VDRDETI- 145

Query: 181 MYGSMPCTKEAKKPRLSLLAYCQKVLKDNRLLPSWPKRGFSLLQDLRQDASSRGRETFAF 240
                P T        +L +   +V++D  L+PS+P+   +  + L   +      + + 
Sbjct: 146 ----QPITAGKDS---TLRSRFFRVVQDLELVPSFPR--MAPFKRLLDQSPEDNNLSVSH 196

Query: 241 GASFL-ETMTTTQARNLLSNAIIEYYLYLQLVKSFRDINVTGFRKMVKKFDKTCHTRELT 299
           G +F   T++T Q ++ LS+A+IE+YL LQL+K +R++NVTGFRK+VKKFDKTC TREL 
Sbjct: 197 GETFAPTTLSTNQIQHRLSDALIEFYLLLQLMKGYREVNVTGFRKIVKKFDKTCGTRELV 256

Query: 300 TFMSYARTHYTLFKHADANVQLVAQKMQQITSSQPTPTSELSSAQRDKEPITWLETQITE 359
            F+ YA++ Y +F+HA+AN ++VA +M    S+     S  ++    ++P+   E Q T+
Sbjct: 257 PFIEYAKSTYPIFQHAEANARVVAHQMHD--SALLGERSSFATELNVEDPLLSWEQQTTK 314

Query: 360 WFTTALTNSPKDRKHNTHKLKKLTIQYSISEQMVHRNNRSIVQMLVVGLGIGVSMTLITY 419
           W+T  L++S KDRK  T +LK L+++YS++EQ VHR NRSI+QM V G+ +G S+ L+ Y
Sbjct: 315 WYTDVLSSSSKDRKRKTARLKNLSLEYSLNEQKVHRFNRSILQMFVSGVLLGGSLALVGY 374

Query: 420 TLYLGISSEETSFTHKILFPLWGGWYMVLLIAFLFLVNCFIWHRTGINYRFIMLGEIQSK 479
           TLY G  +  +S  H +L PLWGGWYMV LI FLFL+NCFIWHR+ INYRFIM GE+ S+
Sbjct: 375 TLYRGFVASNSSEIHSLLLPLWGGWYMVFLITFLFLLNCFIWHRSNINYRFIMFGEMHSR 434

Query: 480 NGTQFFNNDFATSKIPLKLYFLTFFIVPCAVCSMLSFALEKLTPLGFLYIGIVSFLFLCP 539
            G   FNNDF+T+KIP+  YF +    P A+ S +SF    L P   ++I +V  LF  P
Sbjct: 435 RGAVLFNNDFSTTKIPILFYFASVLAFPMALLSSISFNEVNLNPWAIIWIALVVVLFFSP 494

Query: 540 S------GLIPYWDKVVHTRKWLVVTLIRLMMSGFFPVEFGDFFLGDIICSLTYSIADIA 593
                    IPYW+K+  + +W++V+ +RL+ SGF+PV+FGDFFLGDI CSLTYS+ADIA
Sbjct: 495 VLGELPLLSIPYWNKLTKSVRWILVSFVRLIFSGFYPVQFGDFFLGDIFCSLTYSLADIA 554

Query: 594 MFFCVYSHTPNNLCGSSHSRAMGVLSCLPSYWRFMQCLRRFADSGDWFPHLLNAAKYTLG 653
           MFFC+YS TPN  CGSSHS+AMG ++CLP++WRFMQCLRRF+DSGDWFPHLLN  KY+L 
Sbjct: 555 MFFCIYSPTPNGRCGSSHSKAMGAMTCLPNFWRFMQCLRRFSDSGDWFPHLLNGLKYSLS 614

Query: 654 IAYNATLCAYRLSDRSEQRRTPFIVCATLNSILTSAWDLVMDWSFAHNTTSYNWLLRDDL 713
           + Y A+LCAYR+S  +  RR  FI+ ATLN + TS WD++MDWS    + S NWLLRDDL
Sbjct: 615 VVYYASLCAYRIS-HTRSRRNVFIIFATLNGVCTSIWDIIMDWSLLQ-SGSRNWLLRDDL 672

Query: 714 YLAGKKNWENGSYSFSRKLVYYFAMIWDILIRFEWIVYAIAPQTIQQSAVTSFILALLEV 773
           YLAG+KNW+ G+YS  RK VYY AMIWD+ +RF+W+VYAIAP TIQQSA+TSFILA LEV
Sbjct: 673 YLAGRKNWKTGAYSKRRKSVYYLAMIWDVAMRFQWVVYAIAPATIQQSAITSFILAALEV 732

Query: 774 LRRFVWIIFRVENEHVANVHLFRVTGDAPLPYPIAQVXXXXXXXXXXXXKAFSSLNDIPI 833
            RRFVWIIFRVENEHVANVHLF+V+G+  LPYP                    S    P 
Sbjct: 733 TRRFVWIIFRVENEHVANVHLFKVSGEISLPYPTTVNEESETEASVSSNHYAMSEMSFP- 791

Query: 834 TPSHDNNPHSFAEPMPAYRGTFRRRSS----VFENISRSIPWAHATDFQRPT 881
                    + A P P YRG   ++S+    +   +S SIPWAHA DFQRPT
Sbjct: 792 ---------TMAAPTPMYRGESTQKSTGSNGLLRTLSSSIPWAHAQDFQRPT 834

>ADL080W [1661] [Homologous to ScYIL047C (SYG1) - SH]
           complement(542124..544715) [2592 bp, 863 aa]
          Length = 863

 Score =  747 bits (1929), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 404/893 (45%), Positives = 558/893 (62%), Gaps = 80/893 (8%)

Query: 1   MKFADHLTESAIPEWRDKYIDYKVGKKKLRRYKEKLDAEEEQSSSYRSWMPSVSVYQTAF 60
           MKFA+ L ES+IPEWRDKY+DYK+GKKKL+ YKEKL A                    A 
Sbjct: 1   MKFAERLRESSIPEWRDKYLDYKLGKKKLKSYKEKLKASR------------------AL 42

Query: 61  QQREPGKSRSDGDYRSGPAFKKDYSALQREFVADFIEDWLISFQLSKCNEFYLWLLKECD 120
             R   +SR+    R  P     Y+  Q + V +F+  W+I  +L+KC+EFY W L +C+
Sbjct: 43  SVRPTQRSRA----RDEP-----YTMQQEDAVYEFVMGWVIGTELAKCDEFYQWQLDQCE 93

Query: 121 KKFEVLQSQLHYYSLQKNYERDNLNRSSSNVDMSTSLYAAGL-AGRSDS--RVNSIDSDS 177
           +K+++L+ Q+  Y LQK+     L+  ++      +  AA L AGRS S  R   +D   
Sbjct: 94  RKYQLLKQQIEMYCLQKDENGAGLSYGATYEGQEETGLAAQLSAGRSPSPSRAGRLDRAQ 153

Query: 178 RSVMYGSMPCTKEAKKPRLSLLAYCQKVLKDNRLLPSWPKRGFSLLQDLRQDASSRGRET 237
             V                      ++ L++  L+PS P R        R+   +R ++ 
Sbjct: 154 EGV----------------------KRWLQERDLMPSLPARWS------REQGPARVKKY 185

Query: 238 FAFGASFLETMTTT-QARNLLSNAIIEYYLYLQLVKSFRDINVTGFRKMVKKFDKTCHTR 296
            A   +F+    +  QA+  L +A++EYYL LQL+K++RD+NVTGFRK+VKKFDKTC T 
Sbjct: 186 SANTETFMHICPSKRQAQLQLGHALLEYYLTLQLLKNYRDLNVTGFRKIVKKFDKTCDTE 245

Query: 297 ELTTFMSYARTHYTLFKHADANVQLVAQKMQQITSSQPTPTSELSSAQRDKEPITWLETQ 356
           EL+ FMSYA  H  LF+H   N++L A   +  ++S   P + ++S+  +K+P+T+ E Q
Sbjct: 246 ELSKFMSYANEHSPLFEHMGQNLRLYANSFKA-SNSLCQPAARMNSSP-EKDPVTYWEDQ 303

Query: 357 ITEWFTTALTNSPKDRKHNTHKLKKLTIQYSISEQMVHRNNRSIVQMLVVGLGIGVSMTL 416
           + +W+T ALT S + RKH+  KL+ L++QYS++EQ+VHRNN  +VQM   G  +GV++ L
Sbjct: 304 VFQWYTEALTESTQARKHHVQKLRSLSLQYSMNEQIVHRNNTCVVQMFTAGSLLGVAVVL 363

Query: 417 ITYTLYLGISSEETSFTHKILFPLWGGWYMVLLIAFLFLVNCFIWHRTGINYRFIMLGEI 476
           +   L LGI ++ +S+ H ILFP+WGGWY+VLL++ LF ++C+IW R  +NY+FIM GEI
Sbjct: 364 VIIALMLGIRADISSYRHLILFPVWGGWYLVLLMSLLFCLDCYIWFRGKVNYQFIMFGEI 423

Query: 477 QSKNGTQFFNNDFATSKIPLKLYFLTFFIVPCAVCSMLSFALEKLTPLGFLYIGIVSFLF 536
            S+ G   FNNDF+T+KI   LY ++   +     S+ S     L P  +L   + +  F
Sbjct: 424 HSRKGNTVFNNDFSTTKISGHLYMVSLAFITVGAVSLCSMVRATLAPWLWLCALLFALGF 483

Query: 537 LCPSGLIPYWDKVVHTRKWLVVTLIRLMMSGFFPVEFGDFFLGDIICSLTYSIADIAMFF 596
              S ++PYW ++  TR+WL+VT IRL+ SG +PV+FGDFFLGDI+CSLTYS+AD+A  F
Sbjct: 484 SMSSFILPYWRELRKTRQWLIVTAIRLVFSGAYPVQFGDFFLGDIVCSLTYSMADVASVF 543

Query: 597 CVYSHTPNNLCGSSHSRAMGVLSCLPSYWRFMQCLRRFADSGDWFPHLLNAAKYTLGIAY 656
           CV+S    N+CGSS+  +MGVLSC+PSYWR MQCLRR+ DS D FPHLLN AKY + I Y
Sbjct: 544 CVFSGQKYNMCGSSNLISMGVLSCIPSYWRLMQCLRRYLDSNDRFPHLLNGAKYAVAILY 603

Query: 657 NATLCAYRLSDRSEQRRTPFIVCATLNSILTSAWDLVMDWSFAHNTTSYNWLLRDDLYLA 716
           NA LCAYR++      R+ FI    +NS+ +S WDLVMDWS      S N+LLRDDLYLA
Sbjct: 604 NACLCAYRINKLHHSYRSWFIAAGIINSVFSSIWDLVMDWSL-FQFQSTNFLLRDDLYLA 662

Query: 717 GKKNWENGSYSFSRKLVYYFAMIWDILIRFEWIVYAIAPQTIQQSAVTSFILALLEVLRR 776
           GK+NW+ G YS  RK +YY +MI D+ IRF+WIVYAIAP+ IQQSAVTSFIL +LEV+RR
Sbjct: 663 GKRNWQTGQYSKRRKAMYYVSMISDVAIRFQWIVYAIAPRVIQQSAVTSFILGILEVVRR 722

Query: 777 FVWIIFRVENEHVANVHLFRVTGDAPLPYPIAQVXXXXXXXXXXXXKAFSSLNDIPITPS 836
           F+WIIFRVENEHVANVHLF++TG+ PLPYPI+                 S+++D    PS
Sbjct: 723 FIWIIFRVENEHVANVHLFKITGETPLPYPISPSRALST----------STVHDKHALPS 772

Query: 837 HDNNPHSF----AEPMPAYRGTFRRRSSVFENISRSIPWAHATDFQRPTVNTV 885
             N+        +   P       R  S+  N    IPWAHA DFQRP+ +++
Sbjct: 773 TKNSHEDLVLYASVRHPEVLHMRHRAPSILSN----IPWAHAKDFQRPSTSSL 821

>KLLA0F27467g complement(2541110..2543644) similar to sp|P40528
           Saccharomyces cerevisiae YIL047c SYG1 member of the
           major facilitator superfamily singleton, start by
           similarity
          Length = 844

 Score =  608 bits (1567), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 350/905 (38%), Positives = 513/905 (56%), Gaps = 108/905 (11%)

Query: 1   MKFADHLTESAIPEWRDKYIDYKVGKKKLRRYKEKLDAEEEQSSSYRSWMPSVSVYQTAF 60
           MKFA+HL ES +PEW DKY++YK+GKKK++++++    +                     
Sbjct: 1   MKFAEHLRESVVPEWSDKYVNYKLGKKKIKQFQKLKKVQ--------------------- 39

Query: 61  QQREPGKSRSDGDYRSGPAFKKDYSALQREFVADFIEDWLISFQLSKCNEFYLWLLKECD 120
                                 D  ++ R  V +FI+DWL+  QL  C+EFY W L +  
Sbjct: 40  ----------------------DVGSMDRTIVREFIDDWLVRDQLKNCDEFYEWQLSKYR 77

Query: 121 KKFEVLQSQLHYYSLQKNYERDNLNRSSSNVDMSTSLYAAGLAGRSDSRVNSIDSDSRSV 180
            K+  LQ Q+H Y L+ +          S +D       A L+   DS            
Sbjct: 78  AKYHKLQRQIHLYVLEAD--------KRSRLDSLDEYRIASLSRAPDS------------ 117

Query: 181 MYGSM------PCTKEAKKPRLSLLAYCQKVLKDNRLLPSWP---KRGFSLLQDLRQDAS 231
            YGS+         K+  K ++      ++ L  + L PS P   K    LL    +  +
Sbjct: 118 -YGSIFPNFSPIALKDTVKKKI--WYDLKRWLVTHNLCPSMPVSWKNRDPLLAKKDRKRA 174

Query: 232 SRGRETFAFGASFLETMTTTQARNLLSNAIIEYYLYLQLVKSFRDINVTGFRKMVKKFDK 291
           SRG+ETF    S    ++ +Q R  LS+AI+++YLYLQL+K++RD+NV GFRK+VKKFDK
Sbjct: 175 SRGQETFQTETS---PLSLSQIRQQLSDAILDFYLYLQLLKNYRDLNVNGFRKIVKKFDK 231

Query: 292 TCHTRELTTFMSYARTHYTLFKHADANVQLVAQKMQ--QITSSQPTPTSELSSAQRDKEP 349
             H  +L TFM YA+ +  +F   D  ++L+   ++  ++ +      S+    +  K+P
Sbjct: 232 VLHQDQLKTFMPYAKKYSIMFSQYDEYLKLIKDNVEHAEVINVNLFLGSDNDVDRLKKDP 291

Query: 350 ITWLETQITEWFTTALTNSPKDRKHNTHKLKKLTIQYSISEQMVHRNNRSIVQMLVVGLG 409
           +T+ E    +W+T  LT+S KD+KHN  ++K L++QYS++EQ +HRNN S+ QM +    
Sbjct: 292 LTFWEQTAIKWYTMTLTSSSKDKKHNLERIKNLSLQYSVNEQTIHRNNASMFQMFLGSAQ 351

Query: 410 IGVSMTL-ITYTLYLGISSEETSFTHKILFPLWGGWYMVLLIAFLFLVNCFIWHRTGINY 468
           +G+S+TL I  T+ L  +S +       L P+W  ++ +  +  LF+++CFIW++  INY
Sbjct: 352 LGISVTLVILMTIILAKNSSDE--VRSALLPIWSSFHYLTFMGLLFIIDCFIWYKVKINY 409

Query: 469 RFIMLGEIQSKNGTQFFNNDFATSKIPLKLYFLTFFIVPCAVCSMLSFALEKLTPLGFLY 528
           RFIM GEI S+NG   FNNDF  + IPL+ +  T F+  C++ +  S  LEKL P    +
Sbjct: 410 RFIMFGEIHSRNGPVLFNNDFGMTHIPLQFFHATTFLCICSILAFCSLMLEKLEPWMITW 469

Query: 529 IGIVSFLFLCPSGLI---PYWDKVVHTRKWLVVTLIRLMMSGFFPVEFGDFFLGDIICSL 585
           + I   LF     +I   PYW +   +RK++  + IRL+ SGFFPV+FGDFFLGDI+CSL
Sbjct: 470 LCIAVALFFWKFQVIQPWPYWYETFQSRKYIFTSFIRLVFSGFFPVQFGDFFLGDIVCSL 529

Query: 586 TYSIADIAMFFCV-YSHTPNNLCGSSHSRAMGVLSCLPSYWRFMQCLRRFADSGDWFPHL 644
           TYS++  A   C+ ++ +  + C       +G+LSCLPSYWRF+QC+RR+ DS DWFPHL
Sbjct: 530 TYSMSQFATLGCLTFNDSKEDKCRYEKLMWIGILSCLPSYWRFVQCVRRYFDSYDWFPHL 589

Query: 645 LNAAKYTLGIAYNATLCAYRLSDRSEQRRTPFIVCATLNSILTSAWDLVMDWSFAHNTTS 704
           LNA KY LGI++NA+L  Y+   + ++ +   IV   LNS LTS WDL+MDWS    T S
Sbjct: 590 LNAFKYLLGISFNASLYWYKSWPQMQKFKVLLIVFGCLNSTLTSIWDLIMDWSLLQ-TKS 648

Query: 705 YNWLLRDDLYLAGKKNWENGSYSFSRKLVYYFAMIWDILIRFEWIVYAIAPQT-IQQSAV 763
            N+LLRDDLYL GKKNW++G YS  +K +YYF M++D+++R+EW+ Y +   T   +  +
Sbjct: 649 KNFLLRDDLYLCGKKNWKSGKYSSKKKCIYYFIMVFDVVVRYEWVFYMVKNNTDYVRHPL 708

Query: 764 TSFILALLEVLRRFVWIIFRVENEHVANVHLFRVTGDA-PLPYPIAQVXXXXXXXXXXXX 822
            +  +A LE+LRRFVW+I RVENEHVANVHLF+VT D   LP+P   +            
Sbjct: 709 IALAMATLEILRRFVWVILRVENEHVANVHLFKVTDDNWQLPFPT--IEDSELHMEEDYS 766

Query: 823 KAFSSLNDIPIT-------PSHDNNPHSFAEPMPAYRGTFRRRSSVFENISRSIPWAHAT 875
            A  ++++I +         S    P S    +P       R++SVFE     IPWAHAT
Sbjct: 767 AAAENMDNIAMLSVMKSDLESQQQRPRS-TSAVPK----LNRKASVFE----IIPWAHAT 817

Query: 876 DFQRP 880
           DFQRP
Sbjct: 818 DFQRP 822

>Sklu_2440.13 YDR414C, Contig c2440 19959-21104 reverse complement
          Length = 381

 Score = 66.2 bits (160), Expect = 4e-11,   Method: Compositional matrix adjust.
 Identities = 58/234 (24%), Positives = 98/234 (41%), Gaps = 26/234 (11%)

Query: 570 PVEFGDFFLGDIICSLTYSIADIAMFFCVYSHTPNNLCGSSHSRAMGV-------LSCLP 622
           P+      + D + S    + D  ++ C     P           +G+       +   P
Sbjct: 150 PLRTNYILISDTLTSYGKPMIDYGLYLCQLLTNPVGTDCIIRKDPLGISLNLDLMIGITP 209

Query: 623 SYWRFMQCLR---RFADSGDWFPHLLNAAKYTLGIAYNATLCAYRLSDRSEQRRTP---F 676
           +  R +QCLR   R   S D    L NA KY+        +  Y +  R+    TP    
Sbjct: 210 ATIRLIQCLREYKRSTSSADARAALFNALKYSCQFP----ILVYTVVTRAYPGETPSANI 265

Query: 677 IVCATLNSILTSAWDLVMDWSFAHNTTSYNWLLRDDLYLAGKKNWENGSYSFSRKLVYYF 736
                LNS+ T  WDL MDW F     + + +  +++  A +         FS K  Y  
Sbjct: 266 YWLLLLNSMYTFWWDLTMDWKFGFFNFTNSGMKLNEVSRAQRH--------FSIKTCYC- 316

Query: 737 AMIWDILIRFEWIVYAIAPQTIQQSAVTSFILALLEVLRRFVWIIFRVENEHVA 790
           A+  D ++RF W+   ++  ++ +  +  F L  LE++RR++WI F+VE E ++
Sbjct: 317 AIFVDFILRFAWLWELVSGVSVFKGEMNVFWLQFLEIVRRWIWIFFKVEAEFLS 370

>Kwal_47.18721
          Length = 383

 Score = 61.2 bits (147), Expect = 1e-09,   Method: Compositional matrix adjust.
 Identities = 56/232 (24%), Positives = 100/232 (43%), Gaps = 22/232 (9%)

Query: 570 PVEFGDFFLGDIICSLTYSIADIAMFFCVYSHTPNNLCGSSHSRAMG-------VLSCLP 622
           P+      + D + S +  + D   + C     P +        AMG       ++   P
Sbjct: 154 PLRNNYILISDSLTSYSKPLIDFGFYLCHLVVDPISENCIISRTAMGSAINLDLMIGTAP 213

Query: 623 SYWRFMQCLRRFADS---GDWFPHLLNAAKYTLGIAYNATLCAYRLSDRSEQRRTPFIVC 679
              R +QCLR +  S   GD    + NA KY+L +     +CA       + +   ++  
Sbjct: 214 VIIRLLQCLREWRRSRTLGDARSSIFNALKYSLHLP--IVMCAVYSRSFPDVKPGNYVYW 271

Query: 680 -ATLNSILTSAWDLVMDWSFAHNTTSYNWLLRDDLYLAGKKNWENGSYSFSRKLVYYFAM 738
              LNS  +  WDL MDW+        + + R+++  A +      SY      +Y+ AM
Sbjct: 272 FMLLNSFYSFWWDLTMDWNLGVFNFGRSGMGRNEVLRARR---HFPSY------MYFLAM 322

Query: 739 IWDILIRFEWIVYAIAPQTIQQSAVTSFILALLEVLRRFVWIIFRVENEHVA 790
             D  +RF W+   +A ++  +     F L +LE+LRR++WI  +++ E ++
Sbjct: 323 SADFTLRFMWLWELLAGRSAFEGEANIFFLQILEILRRWIWIFVKLDAEAIS 374

>AAR127C [314] [Homologous to ScYDR414C (ERD1) - SH]
           (568957..570102) [1146 bp, 381 aa]
          Length = 381

 Score = 58.5 bits (140), Expect = 1e-08,   Method: Compositional matrix adjust.
 Identities = 61/243 (25%), Positives = 106/243 (43%), Gaps = 28/243 (11%)

Query: 562 RLMMSGFF---PVEFGDFFLGDIICSLTYSIADIAMFFCVYSHTP-------NNLCGSSH 611
           R+++ G     P+      L D + S    + D   +  +   TP        +L  ++ 
Sbjct: 144 RMLLGGGIEGKPLRTNYILLADTLTSYGKPLMDFTAYLVLLFRTPLADPLAVRDLPSNAA 203

Query: 612 SRAMGVLSCLPSYWRFMQCLRRFADSGD-WFPH---LLNAAKYT--LGIAYNATLCAYRL 665
                V+  +PS  R +QCLR +    D W      L NA KY+  L I  +A L +   
Sbjct: 204 LHIDLVVGAIPSVIRLVQCLREYRRKEDAWAARRASLFNALKYSSQLPILVHA-LLSRSG 262

Query: 666 SDRSEQRRTPFIVCATLNSILTSAWDLVMDWSFAHNTTSYNWLLRDDLYLAGKKNWENGS 725
           +    QR   + +   LNS+ +  WD+ MDW       S   + RD++    +       
Sbjct: 263 AAHGGQRWVRWAML--LNSVYSFWWDVTMDWKLGLFNFSSAGMERDEVLRHRRL------ 314

Query: 726 YSFSRKLVYYFAMIWDILIRFEWIVYAIAPQTIQQSAVTSFILALLEVLRRFVWIIFRVE 785
           YS      YY A+++D +++F W+      + + +  +    L LLEV+RR++W  F++E
Sbjct: 315 YSVK---YYYGAVLYDFVMKFMWLWELHVGRALFRRDLNPVWLHLLEVIRRWIWTFFKIE 371

Query: 786 NEH 788
            E+
Sbjct: 372 AEY 374

>KLLA0A02057g 186220..187374 gi|1169545|sp|P41771|ERD1_KLULA
           Kluyveromyces lactis ERD1 PROTEIN, start by similarity
          Length = 384

 Score = 58.5 bits (140), Expect = 1e-08,   Method: Compositional matrix adjust.
 Identities = 65/240 (27%), Positives = 99/240 (41%), Gaps = 45/240 (18%)

Query: 578 LGDIICSLTYSIADIAMFFCVYSHTPNNL-CG-----SSHSRAMGVL-SCLPSYWRFMQC 630
           + D + S +  + D+A++     H P N+ C      ++ S  + VL   LPS  R +Q 
Sbjct: 154 ISDTLTSYSKPLVDLAIYATFLFHDPTNVKCQVERYENAISLNIDVLVGVLPSLVRMIQS 213

Query: 631 LRRFA------DSGDWFPHLLNAAKYTLGIAYNATLCAYRLSDRSEQRRTPFIVCATLNS 684
           LR F         G     L NA KY   I         R  +        + +    NS
Sbjct: 214 LREFTRGRSQKKDGS---QLFNAFKYAGNIPIMLVTVYTRYYNLGPLGMMYWFMF--WNS 268

Query: 685 ILTSAWDLVMDW-----SFAHNTTSY---------NWLLRDDLYLAGKKNWENGSYSFSR 730
             +  WD+ MDW      F +  TS          + LLR  L L  K  W         
Sbjct: 269 AYSFWWDVTMDWKLELFDFVNGDTSVNNNNSSNKADGLLRSIL-LYRKNAW--------- 318

Query: 731 KLVYYFAMIWDILIRFEWIVYAIAPQTIQQSAVTSFILALLEVLRRFVWIIFRVENEHVA 790
              YY AM  D ++RF W    I+  ++    +  F L +LE++RR++W+ F+VE E++A
Sbjct: 319 ---YYSAMALDFILRFVWFWEYISGHSVFYGELNIFWLQILEIIRRWIWLFFKVEVEYIA 375

>KLLA0F06160g 598549..601128 similar to sp|P27514 Saccharomyces
           cerevisiae YNR013c, start by similarity
          Length = 859

 Score = 52.8 bits (125), Expect = 1e-06,   Method: Compositional matrix adjust.
 Identities = 72/321 (22%), Positives = 127/321 (39%), Gaps = 49/321 (15%)

Query: 1   MKFADHLTESAIPEWRDKYIDYKVGKKKLRRY-KEKLDAEEEQSSSYRSWMPSVSVYQTA 59
           MKF+  L  +A+PEW  KYI Y   KK +    KEKL     +SS   S   + +V + +
Sbjct: 1   MKFSHSLQFNAVPEWTTKYIGYSQLKKLIYTLQKEKLYRSTSESSDLESTPLTTAVTRDS 60

Query: 60  FQQREPGKSRSDGDYRSGPAFKKDYSALQREFVADFIEDWLISFQLSKCNEFYLWLLKEC 119
           ++QR                      AL +E              L K + FY       
Sbjct: 61  YEQRF-------------------IDALDKE--------------LDKIDSFYTM----- 82

Query: 120 DKKFEVLQSQLHYYSLQKNYERDNLNRSSSNVDMSTSLYAAGLAGRSDSRVNSIDSDSRS 179
            ++  +L +    Y     ++ + +NRS  N        + G   R  +R +S  S+  S
Sbjct: 83  -QETSILANYSEVYEDVTTFQNELMNRSIHNT-------STGDLNRQGTRRSSSISEYNS 134

Query: 180 VMYGSMPCTKEAKKPRLSLLAYCQKVLKDNRLLPSWPKRGFSLLQDLRQDASSRGRETFA 239
                +   ++  +   S +   ++    N+ + +   R  S+   L    +S    T +
Sbjct: 135 QPEMDLYSEEDDDEDGFS-IGNQEQSDGQNKQIQARRARTGSVGSRLMHSITSEILPTLS 193

Query: 240 FGASFLETMTTTQARNLLSNAIIEYYLYLQLVKSFRDINVTGFRKMVKKFDKTCHTRELT 299
               F  T    + +  L   I+  +  L  +KSF ++N TGF K+ KKFDK+  +   T
Sbjct: 194 RVTDFTTTDPIMEQQITLKKRIVACFTQLSELKSFIELNQTGFAKICKKFDKSLDSNIKT 253

Query: 300 TFM-SYARTHYTLFKHADANV 319
            ++ S ++  +   +H   N+
Sbjct: 254 DYLKSLSKKSHVFNEHTIENL 274

>YNR013C (PHO91) [4596] chr14 complement(649027..651711) Member of
           the phosphate permease family of membrane transporters,
           has similarity to Pho87p and Pho90p [2685 bp, 894 aa]
          Length = 894

 Score = 48.9 bits (115), Expect = 2e-05,   Method: Compositional matrix adjust.
 Identities = 68/319 (21%), Positives = 126/319 (39%), Gaps = 49/319 (15%)

Query: 1   MKFADHLTESAIPEWRDKYIDYKVGKKKLRRY-KEKLDAEEEQSSSYRSWMPSVSVYQTA 59
           MKF+  L  +++PEW  KY+ Y   KK +    K+KL +  +                  
Sbjct: 1   MKFSHSLQFNSVPEWSTKYLAYSQLKKLIYSLQKDKLYSNNKH----------------- 43

Query: 60  FQQREPGKSRSDGDYRSGPAFKKDYSALQREFVADFIEDWLISFQLSKCNEFYLWLLKEC 119
               EP     D +  + P    D S   + +++ F+    ++ +L K ++FY+      
Sbjct: 44  -HVVEP----HDANDENLPLLA-DASPDDQFYISKFVAA--LNQELKKIDKFYISQETGL 95

Query: 120 DKKFEVLQSQLHYYSLQKNYERDNLNRSSSNVDMSTSLYAAGLAGRSDSRVNSIDSDSRS 179
              +  L+  +         E +N N+++   +         +A    S+     S  R 
Sbjct: 96  IANYNELKDDV--------MELENTNKATQLFNQQQQHQLQSVARNRKSK-----SQQRQ 142

Query: 180 VMYGSMPCTKEAKKPRLSLLAYCQKVLKDNRLLPSWPKRGFSLLQDLRQDASSRGRETFA 239
             + S+  T     P L+ ++     +   ++  S      + +Q+L   + S       
Sbjct: 143 RRFSSVSSTDS--NPSLTDMSIDSAPVIHTQV--SNTTNNGNSMQNLASASVSLSNSNPV 198

Query: 240 FGASFLETMTTTQARNLLSNAIIEYYLYLQLVKSFRDINVTGFRKMVKKFDKTCHTRELT 299
           + + F      TQ R  L   +I  Y  L  +K F ++N TGF K+ KKFDK+ +T    
Sbjct: 199 YLSPF------TQHRLSLKKRLISIYTQLSELKDFIELNQTGFSKICKKFDKSLNTNLKQ 252

Query: 300 TFMSYARTHYTLFKHADAN 318
            +++Y + H  +F  A  N
Sbjct: 253 NYLNYIKFHSHVFNPATIN 271

>CAGL0F02871g complement(278122..279228) similar to sp|P16151
           Saccharomyces cerevisiae YDR414c ERD1 required for
           retention of luminal ER proteins, hypothetical start
          Length = 368

 Score = 45.1 bits (105), Expect = 2e-04,   Method: Compositional matrix adjust.
 Identities = 46/218 (21%), Positives = 89/218 (40%), Gaps = 27/218 (12%)

Query: 576 FFLGDIICSLTYSIADIAMFFCVYSHTPNNLCGSSHSRAMGVLSCLPSYWRFMQCLRRFA 635
               D + S    I D A++          L G   +     L+ +P   R  QCL+ + 
Sbjct: 158 ILFSDTVTSFNKPIIDFALYL-------TYLLGIQITHFDLFLAVIPPLIRLCQCLKEYK 210

Query: 636 DSGDWFPHLLNAAKYTLGIAYNATLCAYRLSDRSEQRRTPFIVCATLNSILTSAWDLVMD 695
            + + F  L NA KY+  +     LC +      +            +S+    ++++  
Sbjct: 211 TTKE-FTLLANALKYSCHLP--VVLCLWYSRVYGD------------DSLTIRDYNILKV 255

Query: 696 WSFAHNTTSYNWLLRDDLYLAGKKNWE-NGSYSFSRKLVYYFAMIWDILIRFEWI-VYAI 753
             F  +T SY W +R D  +    +     S     K  Y+ A++ D ++R+ W+ +  +
Sbjct: 256 MMFIQSTYSYIWDVRKDWTITSISSIRYQKSRVLFPKFYYHIAIVMDGIMRYWWLWIIIL 315

Query: 754 APQTIQQSAVTSFI---LALLEVLRRFVWIIFRVENEH 788
           AP  +       F       +E++RR  W++F++E+E+
Sbjct: 316 APYDVSGKPTALFFEKEAQFIELIRRAGWVVFKLESEY 353

>Scas_625.16
          Length = 932

 Score = 44.7 bits (104), Expect = 3e-04,   Method: Compositional matrix adjust.
 Identities = 69/315 (21%), Positives = 128/315 (40%), Gaps = 65/315 (20%)

Query: 1   MKFADHLTESAIPEWRDKYIDYKVGKKKLRRYKEKLDAEEEQSSSYRSWMPSVSVYQTAF 60
           MKF+  L  +A+PEW  KYI Y      L++    L  E+  SSS        S +    
Sbjct: 82  MKFSHSLQFNAVPEWSSKYIAYS----HLKKLIYSLQKEKLYSSS--------SSHLQLD 129

Query: 61  QQREPGKSRSDGDYRSGPAFKKDYSALQREFVADFIEDWLISFQLSKCNEFYLWLLKECD 120
           ++  P  + +DG+      +  D       +V+ F+E   +  +L K ++FY+       
Sbjct: 130 EECRPLVASTDGNL-----YTNDI------YVSRFVEA--LDHELKKIDKFYISQETGLV 176

Query: 121 KKFEVLQSQLHYYSLQKNYERDNLNRSSSNVDMSTSLYAAGLAGRSDSRVNSIDSDSRSV 180
             +  L+  +      K +E D LN    ++  S +L    +  R  S ++S DS++   
Sbjct: 177 ANYNELKDDV------KEFETDLLNNRLPSI--SDALPRQAMRRRRFSSISSADSNASDA 228

Query: 181 MYG--SMPCTKEAKKPRLSLLAYCQKVLKDNRLLPSWPKRGFSLLQDLRQDASSRGRETF 238
            +   S P  ++     +        +  +N +  S                 SR     
Sbjct: 229 QFSIESAPAMEDTLNSGV--------LDSENEIYAS----------------QSRTTGVS 264

Query: 239 AFGASFLETMTTTQARNLLSNAIIEYYLYLQLVKSFRDINVTGFRKMVKKFDKTCHTREL 298
            + +  L+   T + R      ++  Y  L  +K F ++N TGF K+ KKFDK+ +T   
Sbjct: 265 QYISPLLQHKVTLKKR------LVAIYTQLSELKEFIELNQTGFSKICKKFDKSLNTSIK 318

Query: 299 TTFMSYARTHYTLFK 313
           ++++   +   ++FK
Sbjct: 319 SSYLETIKKKSSVFK 333

>YDR414C (ERD1) [1239] chr4 complement(1295586..1296674) Protein
           required for retention of luminal ER proteins [1089 bp,
           362 aa]
          Length = 362

 Score = 43.9 bits (102), Expect = 5e-04,   Method: Compositional matrix adjust.
 Identities = 46/184 (25%), Positives = 83/184 (45%), Gaps = 34/184 (18%)

Query: 618 LSCLPSYWRFMQCLRRFADSGDWFPHLLNAAKYTLGIAYNATLCAYRL--------SDRS 669
           ++ LP   R +QCLR +    +    L NA KY+  +      C +R          +R 
Sbjct: 193 VALLPVLVRLLQCLREYRLLHE-ATLLFNALKYSCNLP--ILFCTWRSRVYEGSINEERL 249

Query: 670 EQRRTPFIVCATLNSILTSAWDLVMDWSFAHNTTSYNWLLRDDLYLAGKKNWENGSYSFS 729
              +  F++   +NS  T  WD+ MDWS    T+     LR            + S    
Sbjct: 250 HHVQRWFML---INSSYTLFWDVRMDWSLDSLTS-----LRS----------RSKSAVTL 291

Query: 730 RKLVYYFAMIWDILIRFEWIVYAIAPQTIQQSAVTSFI-----LALLEVLRRFVWIIFRV 784
           +K +Y+ A++ D L+RF W+   ++      +A + +I     +   EV+RR +W++F++
Sbjct: 292 KKKMYHSAILVDFLLRFWWLWVYLSQNLKLVAADSDYIFFQGEMQYFEVIRRGIWVVFKL 351

Query: 785 ENEH 788
           + E+
Sbjct: 352 DAEY 355

>Scas_570.8
          Length = 353

 Score = 42.4 bits (98), Expect = 0.001,   Method: Compositional matrix adjust.
 Identities = 47/178 (26%), Positives = 76/178 (42%), Gaps = 28/178 (15%)

Query: 618 LSCLPSYWRFMQCLRRFADSGDWFPHLLNAAKYTLGIAYNATLCAYRL-SDRSEQRRTPF 676
           ++ LP   R  QCL+ +   GD    L N  KY   +   A +   R+    SE  +T  
Sbjct: 192 VASLPVLIRIFQCLKEYRAVGD-KSMLGNTVKYCSNLPILACVWYSRVHGGSSEWNQTLT 250

Query: 677 IVCATLNSILTSAWDLVMDWSFAHNTTSYNWLLRDDLYLAGKKNWENGSYSFSRKLVYYF 736
           +     +S  +  WD+ MDW    ++     L    L L                 +YY 
Sbjct: 251 MWLRLFHSSYSLFWDVKMDWFIDISSRR---LRSTKLALPTT--------------IYYV 293

Query: 737 AMIWDILIRFEWIVYAIAPQTIQQSAVTSFI-----LALLEVLRRFVWIIFRVENEHV 789
            ++ D +IR+ W+      Q    S+  +FI     L  LEV RR +W++F++E+E+V
Sbjct: 294 GILIDFIIRYWWV----WVQWYGASSYFNFIFFDSELQYLEVFRRAIWVVFKLESEYV 347

>AFR628C [3820] [Homologous to ScYJL198W (PHO90) - SH; ScYCR037C
           (PHO87) - SH] (1576713..1579322) [2610 bp, 869 aa]
          Length = 869

 Score = 42.0 bits (97), Expect = 0.002,   Method: Compositional matrix adjust.
 Identities = 21/48 (43%), Positives = 31/48 (64%), Gaps = 2/48 (4%)

Query: 251 TQARNLLSNAIIEYYLYLQLVKSFRDINVTGFRKMVKKFDKT--CHTR 296
           +Q R++L   II+ Y+ L  +KS+ ++N  GF K+ KKFDKT  C  R
Sbjct: 227 SQKRSILKKKIIDLYVELSQLKSYIELNRIGFFKITKKFDKTLSCTVR 274

 Score = 35.8 bits (81), Expect = 0.20,   Method: Compositional matrix adjust.
 Identities = 20/42 (47%), Positives = 26/42 (61%), Gaps = 4/42 (9%)

Query: 1  MKFADHLTESAIPEWRDKYIDYKVGKKKLRRYKEKLDAEEEQ 42
          MKF+  L  +A+PEW+D Y++Y  G KKL      L AEE Q
Sbjct: 1  MKFSHSLKYNAVPEWQDHYLNYS-GLKKLIY---ALQAEELQ 38

>Kwal_33.13618
          Length = 891

 Score = 40.4 bits (93), Expect = 0.006,   Method: Compositional matrix adjust.
 Identities = 31/104 (29%), Positives = 52/104 (50%), Gaps = 8/104 (7%)

Query: 251 TQARNLLSNAIIEYYLYLQLVKSFRDINVTGFRKMVKKFDKT--CHT-RELTTFMSYART 307
           +Q + ++   +++ Y+ L  +KSF ++N  GF K+ KKFDKT  C+  R+L     +  T
Sbjct: 249 SQKKAIVKKNLVDLYVDLAQLKSFIELNRIGFLKITKKFDKTLDCNIRRDLIESGEFFNT 308

Query: 308 HYTLFKHA----DANVQLVAQKMQQITSSQ-PTPTSELSSAQRD 346
            Y    H     DA +  + +    +T++   T   EL S  RD
Sbjct: 309 TYVFQPHTFVALDAKIAKIIEFYAGMTNADLVTCKEELRSYLRD 352

 Score = 37.4 bits (85), Expect = 0.067,   Method: Compositional matrix adjust.
 Identities = 25/87 (28%), Positives = 39/87 (44%), Gaps = 11/87 (12%)

Query: 1  MKFADHLTESAIPEWRDKYIDYKVGKK--------KLRRYKEKLDAEEEQSSSYRSWMPS 52
          MKF+  L  +A+PEW++ Y++Y   KK        +L    E    + E+ SS      +
Sbjct: 1  MKFSHSLKYNAVPEWQEHYLNYSQLKKLIYSLQAQELHVLDEGGRVDTERLSSLEGSSKA 60

Query: 53 VSVYQTAFQQREPGKSRSDGDYRSGPA 79
          +   +  FQ    GK   D D  +GP 
Sbjct: 61 LRKLKNKFQLSRSGK---DKDKVAGPG 84

>YJL198W (PHO90) [2728] chr10 (60843..63488) Phosphate transporter,
           low affinity, has strong similarity to Pho87p and
           Ynr013p, member of the phosphate permease family of
           membrane transporters [2646 bp, 881 aa]
          Length = 881

 Score = 40.4 bits (93), Expect = 0.007,   Method: Compositional matrix adjust.
 Identities = 50/227 (22%), Positives = 92/227 (40%), Gaps = 31/227 (13%)

Query: 261 IIEYYLYLQLVKSFRDINVTGFRKMVKKFDKTCHTRELTTFMSYARTHYTLFKHADANVQ 320
           I+  Y+ L  +KSF ++N  GF K+ KK DK  H    T  +   +     +      ++
Sbjct: 246 IVNLYIDLCQLKSFIELNRIGFAKITKKSDKVLHLNTRTELIESEQFFKDTYAFQAETIE 305

Query: 321 LVAQKMQQIT------SSQPTPTS----ELSSAQRDKEPITWLETQ----ITEWFTTALT 366
           L+  K+ Q+       + +P   S    EL S   D   I W  +     +    + A  
Sbjct: 306 LLNSKISQLVTFYARITDRPHNISHSKQELKSYLHDH--IVWERSNTWKDMLGLLSQADE 363

Query: 367 NSPKDRKHNTHKL-KKLTIQY-------SISEQMVHRNNRSIVQMLVVGLGIGVSMTLIT 418
            +PK+ ++N +KL  KL ++Y        I+ +    NN ++ ++        +   ++ 
Sbjct: 364 LTPKETEYNANKLVGKLDLEYYRWPLPRPINLKFTSINNVALPKLFFTKKAYKIYFIILV 423

Query: 419 YTLYLGISSEETSFTHKILFPLWGGWYMVLLIAFLFLVNCFIWHRTG 465
             L LGI +   +  H+ +        +V  +AFL+       H T 
Sbjct: 424 TGLLLGIKTFNDAAQHRCM-------ALVECVAFLWASEAIPLHITA 463

>YCR037C (PHO87) [571] chr3 complement(194409..197180) Member of the
           phosphate permease family of membrane transporters,
           appears to play a supporting role in phosphate uptake
           under high phosphate growth conditions [2772 bp, 923 aa]
          Length = 923

 Score = 40.0 bits (92), Expect = 0.010,   Method: Compositional matrix adjust.
 Identities = 24/67 (35%), Positives = 37/67 (55%), Gaps = 4/67 (5%)

Query: 251 TQARNLLSNAIIEYYLYLQLVKSFRDINVTGFRKMVKKFDKTCHT---RELTTFMSYART 307
           +Q ++LL   II  Y+ L  +KSF ++N  GF K+ KK DK  H    +EL     + + 
Sbjct: 282 SQKKSLLKQTIINLYIDLCQLKSFIELNRMGFSKITKKSDKVLHMNTRQELIESEEFFKD 341

Query: 308 HYTLFKH 314
            Y +F+H
Sbjct: 342 TY-IFQH 347

 Score = 30.4 bits (67), Expect = 7.9,   Method: Compositional matrix adjust.
 Identities = 10/22 (45%), Positives = 17/22 (77%)

Query: 1  MKFADHLTESAIPEWRDKYIDY 22
          M+F+  L  +A+PEW++ Y+DY
Sbjct: 1  MRFSHFLKYNAVPEWQNHYLDY 22

>Scas_689.1
          Length = 691

 Score = 39.7 bits (91), Expect = 0.011,   Method: Compositional matrix adjust.
 Identities = 31/94 (32%), Positives = 48/94 (51%), Gaps = 12/94 (12%)

Query: 251 TQARNLLSNAIIEYYLYLQLVKSFRDINVTGFRKMVKKFDKT--CHTR-ELTTFMSYART 307
           +Q ++LL  +I+  ++ L  +KSF ++N  GF K+ KK DK    HTR EL    S+   
Sbjct: 39  SQKKSLLKQSIVNLFIDLSQLKSFIELNKMGFSKITKKGDKVLHLHTRTELIESNSFYED 98

Query: 308 HYTLFKHADANV------QLVAQKMQQITSSQPT 335
            Y +FK    ++      QL+  K   I   QP+
Sbjct: 99  TY-IFKQETLDILNSKISQLI--KFYAIIKGQPS 129

>KLLA0C03454g 311611..314313 similar to sp|P25360 Saccharomyces
           cerevisiae YCR037c PHO87 member of the phosphate
           permease family, start by similarity
          Length = 900

 Score = 39.7 bits (91), Expect = 0.014,   Method: Compositional matrix adjust.
 Identities = 18/42 (42%), Positives = 28/42 (66%)

Query: 251 TQARNLLSNAIIEYYLYLQLVKSFRDINVTGFRKMVKKFDKT 292
           +Q R++L   +I+ Y+ L  +KSF ++N  GF K+ KKFDK 
Sbjct: 257 SQKRSILKKNVIDLYVDLAQLKSFIELNRIGFSKISKKFDKV 298

 Score = 35.0 bits (79), Expect = 0.28,   Method: Compositional matrix adjust.
 Identities = 15/35 (42%), Positives = 23/35 (65%)

Query: 1  MKFADHLTESAIPEWRDKYIDYKVGKKKLRRYKEK 35
          MKF+  L  +A+PEW+D YIDY   KK +   +++
Sbjct: 1  MKFSHSLKYNAVPEWQDYYIDYSHLKKLIYSLQQQ 35

>Kwal_27.12751
          Length = 1093

 Score = 38.5 bits (88), Expect = 0.028,   Method: Compositional matrix adjust.
 Identities = 36/136 (26%), Positives = 61/136 (44%), Gaps = 23/136 (16%)

Query: 220 FSLLQDLRQDASSRGRETFAFGASFLETMTTTQARNLLSNAIIEYYLYLQLVKSFRDINV 279
           F +LQ   QD+  RG+         L +  T   R L  + I ++   L  ++ F ++N 
Sbjct: 93  FDILQSRFQDSVKRGK---------LSSKNTVAYRPL-RDGIKKFERDLAHLEQFVELNR 142

Query: 280 TGFRKMVKKFDKTCHTRELTTFMSYARTHYTLFKHADA-----NVQLVAQKMQQI----- 329
           TGF K++KK+DK  H+     +++       +F   +A      V ++  ++ +I     
Sbjct: 143 TGFSKVLKKWDKRSHSHTKDFYLATVVAVQPVFTRNEAASLNDAVSVILMQLNEIGSAED 202

Query: 330 ---TSSQPTPTSELSS 342
              TS QP P S  SS
Sbjct: 203 LFATSFQPQPKSAPSS 218

>CAGL0I05632g 531308..533968 similar to sp|P27514 Saccharomyces
           cerevisiae YNR013c, start by similarity
          Length = 886

 Score = 38.1 bits (87), Expect = 0.038,   Method: Compositional matrix adjust.
 Identities = 66/304 (21%), Positives = 112/304 (36%), Gaps = 66/304 (21%)

Query: 1   MKFADHLTESAIPEWRDKYIDYKVGKKKLRRYKEKLDAEEEQSSSYRSWMPSVSVYQTAF 60
           MKF+  L  +++PEW  KYI Y     +L++    L  E+  SS+     P +S   +  
Sbjct: 1   MKFSHSLQFNSVPEWSSKYIAYS----QLKKLIYSLQKEKLYSST-----PDLSTAASES 51

Query: 61  QQREPGKSRSDGDYRSGPAFKKDYSALQREFVADFIEDWLISFQLSKCNEFYLWLLKECD 120
            + +P     + +  S              +V  F++   +  ++ K  +FYL       
Sbjct: 52  SELQPLLDVPEDENSS--------------YVRRFVQA--LDHEVKKIEKFYLSQETGLI 95

Query: 121 KKFEVLQSQLHYYSLQKNYERDNLNRSSSNVDMSTSLYAAGLAGRSDSRVNSIDSDSRSV 180
             +  L+  +H       YE++              L +A     S S            
Sbjct: 96  ANYNELKDDVH------EYEQE--------------LTSANFLYPSQS------------ 123

Query: 181 MYGSMPCTKEAKKPRLSLLAYCQKVLKDNRLLP---------SWPKRGFSLLQDLRQDAS 231
           + G++P    AKK R   L+    +  +N  LP           P        + ++  S
Sbjct: 124 LTGAVPTGGNAKKLRRRRLSSTSSMESNNSGLPLSVDSAPGAIVPPEHHRPSIEAQKSRS 183

Query: 232 SRGRETFAFGASFLETMTTTQARNLLSNAIIEYYLYLQLVKSFRDINVTGFRKMVKKFDK 291
           S         ++F       Q +  L   ++  Y  L  +K F D+N TGF K+ KKFDK
Sbjct: 184 STVNNNSLNLSNFEPLNPQLQHKVTLKKRLVMVYTQLSELKDFIDLNKTGFTKICKKFDK 243

Query: 292 TCHT 295
           +  T
Sbjct: 244 SLDT 247

>Sklu_2438.14 YOR348C, Contig c2438 29357-31033
          Length = 558

 Score = 37.0 bits (84), Expect = 0.077,   Method: Compositional matrix adjust.
 Identities = 20/62 (32%), Positives = 32/62 (51%), Gaps = 5/62 (8%)

Query: 540 SGLIPYWDKVVHTRKWLVVTLIRLMMSGFFPVEF---GDFFLGD--IICSLTYSIADIAM 594
           +G++ YW   VH   W+ + L+ ++   F PV+F    +F+     IIC L   I  I +
Sbjct: 151 AGVVQYWTDKVHVAVWITIFLVIVVGLNFAPVKFYGESEFWFASLKIICILGLLIVSIVI 210

Query: 595 FF 596
           FF
Sbjct: 211 FF 212

>CAGL0F02387g complement(229207..232065) similar to sp|P25360
           Saccharomyces cerevisiae YCR037c PHO87 or sp|P39535
           Saccharomyces cerevisiae YJL198w, start by similarity
          Length = 952

 Score = 36.6 bits (83), Expect = 0.10,   Method: Compositional matrix adjust.
 Identities = 20/49 (40%), Positives = 31/49 (63%), Gaps = 2/49 (4%)

Query: 251 TQARNLLSNAIIEYYLYLQLVKSFRDINVTGFRKMVKKFDKT--CHTRE 297
           +Q +++L  +II  Y+ L  +KSF ++N  GF K+ KK DK    +TRE
Sbjct: 304 SQRKSILKQSIINLYVDLCQLKSFIELNRMGFSKITKKSDKVLLLNTRE 352

>Scas_634.15
          Length = 916

 Score = 36.2 bits (82), Expect = 0.13,   Method: Compositional matrix adjust.
 Identities = 18/44 (40%), Positives = 26/44 (59%)

Query: 251 TQARNLLSNAIIEYYLYLQLVKSFRDINVTGFRKMVKKFDKTCH 294
           +Q  +LL  +I   Y+ L  +KSF ++N  GF K+ KK DK  H
Sbjct: 271 SQKTSLLKQSITNLYIDLCQLKSFIELNRLGFNKITKKCDKVLH 314

 Score = 31.2 bits (69), Expect = 5.4,   Method: Compositional matrix adjust.
 Identities = 10/22 (45%), Positives = 17/22 (77%)

Query: 1  MKFADHLTESAIPEWRDKYIDY 22
          M+F+  L  +A+PEW++ Y+DY
Sbjct: 1  MRFSHFLKYNAVPEWQNHYVDY 22

>Kwal_23.6129
          Length = 816

 Score = 35.8 bits (81), Expect = 0.19,   Method: Compositional matrix adjust.
 Identities = 18/56 (32%), Positives = 30/56 (53%)

Query: 257 LSNAIIEYYLYLQLVKSFRDINVTGFRKMVKKFDKTCHTRELTTFMSYARTHYTLF 312
           L   ++  Y  L  +KSF ++N TGF K+ KKFDK+      + +M+   +   +F
Sbjct: 174 LKKRLVVAYTQLSELKSFIELNQTGFSKICKKFDKSLDANIKSEYMAKLSSRVRVF 229

>ADR289C [2030] [Homologous to ScYNR013C (PHO91) - SH]
           (1193040..1195463) [2424 bp, 807 aa]
          Length = 807

 Score = 35.8 bits (81), Expect = 0.20,   Method: Compositional matrix adjust.
 Identities = 19/51 (37%), Positives = 28/51 (54%)

Query: 252 QARNLLSNAIIEYYLYLQLVKSFRDINVTGFRKMVKKFDKTCHTRELTTFM 302
           Q   LL   ++  Y  L  +KS+ ++N TGF K+ KKFDK+  T     +M
Sbjct: 167 QQGILLKKRLVMAYTRLAELKSYFELNHTGFSKICKKFDKSLETNIRGNYM 217

 Score = 31.6 bits (70), Expect = 3.5,   Method: Compositional matrix adjust.
 Identities = 14/27 (51%), Positives = 17/27 (62%)

Query: 1  MKFADHLTESAIPEWRDKYIDYKVGKK 27
          MKF+  L  +A+PEW  KYI Y   KK
Sbjct: 1  MKFSHSLQFNAVPEWSSKYIAYSQLKK 27

>AGR223W [4534] [Homologous to ScYPL110C - SH]
           complement(1167870..1171835) [3966 bp, 1321 aa]
          Length = 1321

 Score = 35.4 bits (80), Expect = 0.23,   Method: Compositional matrix adjust.
 Identities = 31/131 (23%), Positives = 53/131 (40%), Gaps = 26/131 (19%)

Query: 1   MKFADHLTESAIPEWRDKYIDYKVGKKKLRRYKEKLDAEEEQSSSYRSWMPSVSVYQTAF 60
           MKF        +PEW  KY++YK  KK+++                      +++ Q A 
Sbjct: 1   MKFGKTFPNHQVPEWAHKYVNYKGLKKQIKE---------------------ITLVQDAL 39

Query: 61  QQREPGKSRSDGDY-RSGPAFKKDYSALQ--REFVADFIEDWLISFQLSKCNEFYLWLLK 117
            ++E G +  DG   R G   K+ Y      ++ +A F   + +   + K + FY     
Sbjct: 40  FRQEQGAASQDGPARRRGRESKEQYLGHPEVKKLLAAFF--FALDRDIEKVDGFYNMQFM 97

Query: 118 ECDKKFEVLQS 128
           E D++   L S
Sbjct: 98  EYDRRLRKLLS 108

>KLLA0E15774g 1402940..1406386 similar to sp|P17442 Saccharomyces
           cerevisiae YGR233c PHO81 cyclin-dependent kinase
           inhibitor singleton, start by similarity
          Length = 1148

 Score = 33.9 bits (76), Expect = 0.64,   Method: Compositional matrix adjust.
 Identities = 34/137 (24%), Positives = 57/137 (41%), Gaps = 35/137 (25%)

Query: 1   MKFADHLT--ESAIPEWRDKYIDYKVGKKKLRRYKEKLDAEEEQSSSYRSWMPSVSVYQT 58
           MKF  HL   +  +PE+   +I+YK  KK +++                  +P+VS Y  
Sbjct: 1   MKFGKHLEGRQLELPEYNGHFINYKALKKLIKQLS----------------VPAVSSYTN 44

Query: 59  AFQQREPGKSRSDGDYRSGPAFKKD--YSALQREFVADFIEDWLISFQLSKCNEFYLWLL 116
           +             DY +     +   Y +LQ    + F +   +  +L K NEFYL   
Sbjct: 45  S------------NDYMTLDETDESIRYQSLQENKASFFFK---LERELEKVNEFYLEKE 89

Query: 117 KECDKKFEVLQSQLHYY 133
            +   KF++L S+ + Y
Sbjct: 90  ADLRMKFDLLNSRYYEY 106

>Scas_595.9
          Length = 1148

 Score = 33.5 bits (75), Expect = 0.84,   Method: Compositional matrix adjust.
 Identities = 26/119 (21%), Positives = 53/119 (44%), Gaps = 10/119 (8%)

Query: 231 SSRGRETFAFGASFLETMTTTQARNLLSNAIIEYYLYLQLVKSFRDINVTGFRKMVKKFD 290
           +S+ ++    G   +    +   RN+  +A ++    L  ++ + ++N TGF K +KK+D
Sbjct: 104 NSKFQDYCQVGQQIVSKKNSNSFRNIY-DAFLKLQTDLNELEQYIELNRTGFSKALKKWD 162

Query: 291 KTCHTRELTTFMSYARTHYTLFKHADANVQLVAQKMQQITSSQPTPTSELSSAQRDKEP 349
           K  H+ E   +++   T   +F            K+ Q+  +  T   EL+  Q +  P
Sbjct: 163 KRSHSHEKEFYLATVVTVQPIFTR---------NKVAQLNDATLTILMELNDMQNNSPP 212

>CAGL0J07040g 675389..679126 similar to tr|Q02979 Saccharomyces
          cerevisiae YPL110c, start by similarity
          Length = 1245

 Score = 33.1 bits (74), Expect = 1.1,   Method: Compositional matrix adjust.
 Identities = 18/45 (40%), Positives = 25/45 (55%)

Query: 1  MKFADHLTESAIPEWRDKYIDYKVGKKKLRRYKEKLDAEEEQSSS 45
          MKF   L +  IPEW   Y++YKV KK L+   +  D   +Q +S
Sbjct: 1  MKFGKTLLKLRIPEWSHLYVNYKVLKKILKEITKVQDDLYQQENS 45

>Scas_636.12
          Length = 837

 Score = 32.7 bits (73), Expect = 1.6,   Method: Compositional matrix adjust.
 Identities = 13/40 (32%), Positives = 25/40 (62%), Gaps = 2/40 (5%)

Query: 1  MKFADHLTESAIPEWRDKYIDYKVGKKKLRRYK--EKLDA 38
          M F+ H+ + ++P+W+ + ++Y   KK + R+   E LDA
Sbjct: 1  MNFSSHVLDKSVPQWKHQNLEYDKLKKAIMRHTRLETLDA 40

>YPL110C (YPL110C) [5334] chr16 complement(341067..344738) Member of
           the glycerophosphoryl diester phosphodiesterase family,
           contains six ankyrin (Ank) repeats and a SYG1, Pho81 and
           XPR1 (SPX) N-terminal domain, has weak similarity to S.
           cerevisiae Pho81p, which is a cyclin-dependent kinase
           (CDK) inhibitor [3672 bp, 1223 aa]
          Length = 1223

 Score = 32.7 bits (73), Expect = 1.7,   Method: Compositional matrix adjust.
 Identities = 33/139 (23%), Positives = 53/139 (38%), Gaps = 23/139 (16%)

Query: 1   MKFADHLTESAIPEWRDKYIDYKVGKKKLR---RYKEKLDAEEEQSSSYRSWMPSVSVYQ 57
           MKF        IPEW  +Y+ YK  KK ++   R +E +       +SY    P   +  
Sbjct: 1   MKFGKTFANHRIPEWSSQYVGYKSLKKMIKEITRLQEDI-YRAHNKNSYDEGRPPTKMRD 59

Query: 58  TAFQQREPGKSRSDGDYRSGPAFKKDYSALQREFVADFIEDWLISFQLSKCNEFYLWLLK 117
           +         S S  +Y   P  +K         +A F   + +   + K + FY     
Sbjct: 60  S---------SNSAQNYLDSPKIQK--------LLASFF--FAVDRDIEKVDTFYNSQYA 100

Query: 118 ECDKKFEVLQSQLHYYSLQ 136
           E  K+FE L S   +  ++
Sbjct: 101 EYKKRFERLLSSNQFNEIK 119

>Kwal_56.23410
          Length = 825

 Score = 32.7 bits (73), Expect = 1.7,   Method: Compositional matrix adjust.
 Identities = 13/30 (43%), Positives = 19/30 (63%)

Query: 1  MKFADHLTESAIPEWRDKYIDYKVGKKKLR 30
          MKF   + E ++PEWR   IDYK  K+ ++
Sbjct: 1  MKFGSQIYEKSVPEWRLNNIDYKHLKEAVK 30

>Kwal_56.24436
          Length = 200

 Score = 31.6 bits (70), Expect = 1.9,   Method: Composition-based stats.
 Identities = 22/62 (35%), Positives = 29/62 (46%), Gaps = 4/62 (6%)

Query: 9  ESAIPEWRDKYID-YKVGKKKLRRYKEKLDAEEEQSSSYRSWMPSVSVYQTAFQQREPGK 67
          E+   E+RD+  D YKV  KK     +KLDAE+E   S   W  S+ +         PG 
Sbjct: 4  ENEFKEFRDEDPDQYKVSAKKTLAEYQKLDAEDE---SLAKWKESLGLSSDVLPLEFPGD 60

Query: 68 SR 69
           R
Sbjct: 61 KR 62

>KLLA0F14509g complement(1345334..1347889) weakly similar to
          sp|P38966 Saccharomyces cerevisiae YDR089w singleton,
          start by similarity
          Length = 851

 Score = 32.3 bits (72), Expect = 2.1,   Method: Compositional matrix adjust.
 Identities = 15/42 (35%), Positives = 23/42 (54%), Gaps = 3/42 (7%)

Query: 1  MKFADHLTESAIPEWRDKYIDY---KVGKKKLRRYKEKLDAE 39
          MKF   + + ++PEW+   IDY   KVG ++    +E  D E
Sbjct: 1  MKFGTQILDKSVPEWKLHNIDYQQLKVGIRRCTTVREGQDPE 42

>YNL268W (LYP1) [4340] chr14 (138549..140384) High affinity lysine
           permease, also transports methionine [1836 bp, 611 aa]
          Length = 611

 Score = 32.3 bits (72), Expect = 2.1,   Method: Compositional matrix adjust.
 Identities = 27/110 (24%), Positives = 48/110 (43%), Gaps = 24/110 (21%)

Query: 542 LIPYWDKVVHTRKWLVVTLIRLMMSGFFPVE-FGDFFLGDIICSLTYSIADIA-MFFCVY 599
           +I YW   V    W+ +  + + +  FFPV+ +G+F           S+  +A M + +Y
Sbjct: 213 VIEYWTDKVPLAAWIAIFWVIITLMNFFPVKVYGEFEF------WVASVKVLAIMGYLIY 266

Query: 600 SHTPNNLCGSSHSRAMGVLSCLPSYWRFMQCLRRFADSGDWFPHLLNAAK 649
           +     +CG SH   +G       YWR         + G W P ++++ K
Sbjct: 267 ALII--VCGGSHQGPIGF-----RYWR---------NPGAWGPGIISSDK 300

>Scas_633.15
          Length = 311

 Score = 31.6 bits (70), Expect = 2.5,   Method: Compositional matrix adjust.
 Identities = 20/78 (25%), Positives = 34/78 (43%), Gaps = 8/78 (10%)

Query: 566 SGFFPVEFGDFFLGDIICSLTYSIADIAMFFCVYSHTPNNLC---GSSHSRAMGVLSCLP 622
           SG FP E    FLGD +    YS+    +  C+    P+ +    G+  SR +  +    
Sbjct: 68  SGGFPDEINYIFLGDYVDRGYYSLETFTLLMCLKVKYPSKITLVRGNHESRQITQV---- 123

Query: 623 SYWRFMQCLRRFADSGDW 640
            Y  + +CL ++  +  W
Sbjct: 124 -YGFYEECLNKYGSTTVW 140

>AGL020W [4291] [Homologous to ScYFL004W (VTC2) - SH; ScYPL019C
           (VTC3) - SH] complement(682963..685497) [2535 bp, 844
           aa]
          Length = 844

 Score = 32.0 bits (71), Expect = 2.6,   Method: Compositional matrix adjust.
 Identities = 19/51 (37%), Positives = 26/51 (50%), Gaps = 4/51 (7%)

Query: 241 GASFLETMTTTQARNLLSNAIIEYYLYLQLVKSFRDINVTGFRKMVKKFDK 291
           GA  L+++     R  L  A+ E     Q +  F  +N TGF K+VKK DK
Sbjct: 99  GADALQSLDLGHIREELEQALTE----AQELDRFSRLNFTGFIKIVKKHDK 145

>CAGL0M00748g complement(84109..85422) similar to tr|Q06200
           Saccharomyces cerevisiae YLR443w ECM7, start by
           similarity
          Length = 437

 Score = 31.6 bits (70), Expect = 2.9,   Method: Compositional matrix adjust.
 Identities = 20/71 (28%), Positives = 36/71 (50%), Gaps = 3/71 (4%)

Query: 392 MVHRNNRSIVQMLVVGLGIGVSMTLITYTLYLGISSEETSFTHKILFPLWGGWYMVL-LI 450
           +VH  +   + + + GL   +S+  + YT+   I SE  SF     + L   W+  L ++
Sbjct: 240 LVHTLSIFSLTVFICGLTSVISLAWLNYTVQARIKSELQSFGFS--YHLGASWFTCLWML 297

Query: 451 AFLFLVNCFIW 461
           AF   ++CF+W
Sbjct: 298 AFFVSLSCFVW 308

>Sklu_2202.8 YPL110C, Contig c2202 8829-12932
          Length = 1367

 Score = 32.0 bits (71), Expect = 3.1,   Method: Compositional matrix adjust.
 Identities = 16/48 (33%), Positives = 25/48 (52%), Gaps = 3/48 (6%)

Query: 1  MKFADHLTESAIPEWRDKYIDYKVGK---KKLRRYKEKLDAEEEQSSS 45
          MKF        +PEW  +Y++YK  K   K++ + +EKL  E+   S 
Sbjct: 1  MKFGKTFPNHQVPEWSHQYVNYKGLKKLIKQITQTQEKLHREQHDHSG 48

>CAGL0L10780g complement(1149588..1156289) highly similar to sp|Q00955
            Saccharomyces cerevisiae YNR016c ACC1 or sp|P32874
            Saccharomyces cerevisiae YMR207c HFA1, start by
            similarity
          Length = 2233

 Score = 31.6 bits (70), Expect = 3.7,   Method: Compositional matrix adjust.
 Identities = 13/31 (41%), Positives = 18/31 (58%)

Query: 831  IPITPSHDNNPHSFAEPMPAYRGTFRRRSSV 861
            + I P H NNPHS + P+P   G+    S+V
Sbjct: 1191 LEIVPQHGNNPHSSSGPVPDRSGSSASLSNV 1221

>ADR098C [1839] [Homologous to ScYDL135C (RDI1) - SH]
          (885299..885904) [606 bp, 201 aa]
          Length = 201

 Score = 30.4 bits (67), Expect = 4.8,   Method: Composition-based stats.
 Identities = 21/54 (38%), Positives = 27/54 (50%), Gaps = 5/54 (9%)

Query: 17 DKYIDYKV-GKKKLRRYKEKLDAEEEQSSSYRSWMPSVSVYQTAFQQREPGKSR 69
          D  I+YKV  KK L  YK+ LDAE+E   S   W  S+ +         PG +R
Sbjct: 14 DPRINYKVRAKKTLEEYKQ-LDAEDE---SLAKWKESLGLSSDVLPLEFPGDTR 63

>Kwal_26.6940
          Length = 570

 Score = 30.4 bits (67), Expect = 7.1,   Method: Compositional matrix adjust.
 Identities = 14/48 (29%), Positives = 25/48 (52%)

Query: 526 FLYIGIVSFLFLCPSGLIPYWDKVVHTRKWLVVTLIRLMMSGFFPVEF 573
           + Y+ +++      SG++ YW  VV    W+ + L  + M  F PV+F
Sbjct: 145 YCYVILIAAECTAASGVVTYWTTVVPKAAWITIFLGVVTMLNFGPVKF 192

>Kwal_56.22887
          Length = 309

 Score = 30.0 bits (66), Expect = 8.3,   Method: Compositional matrix adjust.
 Identities = 19/78 (24%), Positives = 34/78 (43%), Gaps = 8/78 (10%)

Query: 566 SGFFPVEFGDFFLGDIICSLTYSIADIAMFFCVYSHTPNNLC---GSSHSRAMGVLSCLP 622
           +G FP +    FLGD +    YS+    +  C+    P+ L    G+  SR +  +    
Sbjct: 68  AGGFPDQINYIFLGDYVDRGYYSLETFTLLMCLKVRYPSRLTLVRGNHESRQITQV---- 123

Query: 623 SYWRFMQCLRRFADSGDW 640
            Y  + +CL ++  +  W
Sbjct: 124 -YGFYEECLNKYGSTTVW 140

>Kwal_23.6208
          Length = 560

 Score = 30.4 bits (67), Expect = 8.6,   Method: Compositional matrix adjust.
 Identities = 16/57 (28%), Positives = 29/57 (50%), Gaps = 1/57 (1%)

Query: 451 AFLFLVNCFIWHRTGINYRFIMLGEIQSKNGTQFFNND-FATSKIPLKLYFLTFFIV 506
              +++  FI  R G++Y  I  G++      +F   D FA + I L +Y  T+F++
Sbjct: 141 VLFWMIVAFIVLRVGVDYYVIHNGDLSQSEILRFMTTDIFAVAFIDLVMYLCTYFVL 197

>KLLA0E13585g complement(1195444..1197186) some similarities with
           sp|P40077 Saccharomyces cerevisiae YER124c singleton,
           hypothetical start
          Length = 580

 Score = 30.0 bits (66), Expect = 9.0,   Method: Compositional matrix adjust.
 Identities = 35/143 (24%), Positives = 54/143 (37%), Gaps = 3/143 (2%)

Query: 187 CTKEAKKPRLSLLAYCQKVLKDNRLLPSWPKRGFSLLQDLRQDAS-SRGRETFAFGASFL 245
           C  EA K   SLL      L D  +        + L +D R   S S  R+T     S  
Sbjct: 65  CKIEASKLNSSLLRKVSGDLNDVIVTKKLKTDCWKLSEDTRDVTSMSLDRDTILLSTS-- 122

Query: 246 ETMTTTQARNLLSNAIIEYYLYLQLVKSFRDINVTGFRKMVKKFDKTCHTRELTTFMSYA 305
           +T    Q   L +N I E     +L+ S + I V G   +     ++ +   + +F    
Sbjct: 123 QTSDNLQLFQLRNNEINEQARGGKLLHSLQTITVPGKSILATDIMQSQNNDTVVSFDDKV 182

Query: 306 RTHYTLFKHADANVQLVAQKMQQ 328
                L  H+D  V L+A  ++ 
Sbjct: 183 HDRILLSGHSDGYVNLIATSIEN 205

  Database: blastdb
    Posted date:  Apr 3, 2006  3:33 PM
  Number of letters in database: 16,596,109
  Number of sequences in database:  34,618
  
Lambda     K      H
   0.324    0.136    0.423 

Gapped
Lambda     K      H
   0.267   0.0410    0.140 

Matrix: BLOSUM62
Gap Penalties: Existence: 11, Extension: 1
Number of Sequences: 34618
Number of Hits to DB: 28,096,016
Number of extensions: 1183886
Number of successful extensions: 4757
Number of sequences better than 10.0: 76
Number of HSP's gapped: 4858
Number of HSP's successfully gapped: 88
Length of query: 887
Length of database: 16,596,109
Length adjustment: 111
Effective length of query: 776
Effective length of database: 12,753,511
Effective search space: 9896724536
Effective search space used: 9896724536
Neighboring words threshold: 11
Window for multiple hits: 40
X1: 15 ( 7.0 bits)
X2: 38 (14.6 bits)
X3: 64 (24.7 bits)
S1: 40 (21.6 bits)
S2: 66 (30.0 bits)