Hit NameLength (aa)HSP LengthHSP ScoreHSP Significance
YIL046W (MET30)64062932890.0
Scas_704.4060858623180.0
CAGL0L00781g67361822090.0
Kwal_23.576962756520830.0
ADL082C56954719480.0
KLLA0F27511g62363418900.0
CAGL0L02629g7954813085e-29
YCR072C5153692903e-27
Kwal_23.50357445122891e-26
YFL009W (CDC4)7793402863e-26
KLLA0D07546g6476162791e-25
Scas_707.227303392764e-25
Scas_720.955153382691e-24
CAGL0H03729g3032952583e-24
Kwal_23.63245143382645e-24
Sklu_2173.25153692611e-23
AER263C5132942611e-23
Kwal_26.87764332762581e-23
KLLA0F11231g4342902581e-23
CAGL0J03476g5173532565e-23
AEL246C8152912587e-23
AGL024W7563502561e-22
KLLA0C08547g5153652494e-22
Sklu_2420.24412912475e-22
YNL006W (LST8)3032882381e-21
Scas_721.115*3181892381e-21
Scas_592.4*3181892372e-21
KLLA0E23529g8262932462e-21
ACR137W4252692412e-21
YPL151C (PRP46)4512812404e-21
Scas_721.328223152444e-21
AFR199C3341722346e-21
Scas_695.153273062321e-20
CAGL0M05335g8062982391e-20
KLLA0D04840g3032992282e-20
YMR116C (ASC1)3191832266e-20
Sklu_2431.127492912337e-20
Sklu_2442.23032922239e-20
Kwal_27.120537553002329e-20
YBR198C (TAF5)7982962311e-19
CAGL0G04345g7112622292e-19
Kwal_0.2123032922193e-19
YJL112W (MDV1)7142912212e-18
YGL137W (SEC27)8892872194e-18
AAL009C3032942105e-18
CAGL0H08932g9022872168e-18
Kwal_27.126677212702151e-17
Kwal_26.75702181272021e-17
AEL314W7152692141e-17
AFL118W8322792151e-17
CAGL0M02277g4271582102e-17
KLLA0E12287g3261792062e-17
Kwal_56.2452612103912132e-17
Scas_711.116952892104e-17
Scas_630.66212522094e-17
ADR077C12043792106e-17
CAGL0I03718g12013382106e-17
CAGL0C02937g4672132051e-16
Scas_624.1112053972071e-16
CAGL0D02090g2771781953e-16
KLLA0F10263g6821962007e-16
KLLA0B01958g8902792008e-16
YDL145C (COP1)12013561991e-15
KLLA0F04884g12123791991e-15
YKR036C (CAF4)6592401953e-15
Scas_629.126712011934e-15
Scas_603.55892301934e-15
KLLA0F21406g7052521935e-15
AGL234W6293141882e-14
KLLA0C07425g4443351852e-14
AGL196C9351821864e-14
CAGL0E00561g8361961854e-14
Kwal_23.64297501971854e-14
Kwal_33.155917142531821e-13
Scas_558.37251651821e-13
YLR129W (DIP2)9431821821e-13
AER448W7141981811e-13
Kwal_26.89754453041782e-13
CAGL0L03201g5792891792e-13
CAGL0L10890g4573211772e-13
Kwal_23.53514742401773e-13
CAGL0M04279g9401851783e-13
YOR269W (PAC1)4942281763e-13
CAGL0C03608g6433251773e-13
Scas_713.509831821784e-13
Kwal_27.115858233471765e-13
YLR222C (UTP13)8171151765e-13
YKL213C (DOA1)7151691757e-13
CAGL0C00737g8161931758e-13
YCR084C (TUP1)7132881741e-12
CAGL0K00275g7151561731e-12
AER337W4453361711e-12
Scas_631.174742691711e-12
Scas_679.288151691668e-12
AGR180W8063301651e-11
YOR272W (YTM1)4603361641e-11
Sklu_1880.34711791631e-11
CAGL0A02772g4411781631e-11
YCR057C (PWP2)9231611642e-11
Sklu_2318.17112261613e-11
Scas_692.294563331603e-11
AAR057W9221821604e-11
ADR176W4611961585e-11
Sklu_2160.37601601595e-11
AEL269C4552411576e-11
Scas_720.83d9151601597e-11
Kwal_56.239209371731597e-11
KLLA0D16390g9361821597e-11
KLLA0E21263g4291881569e-11
Scas_721.73251321531e-10
KLLA0E24508g3271611512e-10
Scas_658.14421721523e-10
YBR175W (SWD3)3151281493e-10
KLLA0E07942g3901371504e-10
Sklu_2172.62631411474e-10
Kwal_26.89534583061496e-10
YKL021C (MAK11)4681361496e-10
CAGL0K09284g9111391508e-10
KLLA0F13244g8141711498e-10
CAGL0G09845g5002761489e-10
Kwal_23.62409133121491e-09
YDR364C (CDC40)4551791462e-09
Scas_692.254881971462e-09
CAGL0M06193g3161281432e-09
Kwal_55.220674511721443e-09
ADL184W4491641443e-09
AGR207C3201631413e-09
CAGL0F06853g3881311424e-09
CAGL0M04081g4551651424e-09
Scas_685.113841381415e-09
AER255C4671741416e-09
Sklu_1963.23141431396e-09
Scas_700.27*4332931407e-09
KLLA0C08976g9113401418e-09
KLLA0C07513g4392051409e-09
Kwal_55.215593511741371e-08
AER114W6331851372e-08
Kwal_27.122393161291343e-08
YPR178W (PRP4)4652541363e-08
ACR166W3881371343e-08
CAGL0M08646g3371581325e-08
KLLA0E21879g3331601325e-08
YDR267C3301551316e-08
Kwal_14.8843951601327e-08
ACR091W3283261317e-08
KLLA0E18986g9901321321e-07
Scas_717.68908821302e-07
KLLA0D02530g7071431302e-07
YGL004C (RPN14)417901273e-07
YNL317W (PFS2)4651621255e-07
Kwal_26.86284222591255e-07
Scas_585.84601621256e-07
YLR429W (CRN1)6512081256e-07
KLLA0F16038g8621121256e-07
Kwal_56.241637291231248e-07
Scas_719.526281941231e-06
Sklu_2430.9966761231e-06
Kwal_33.151364733191221e-06
KLLA0A08866g423731211e-06
Scas_720.457551241222e-06
ABL024W7341941212e-06
KLLA0E07073g4521161193e-06
Kwal_55.214505031811193e-06
AFL056C9761431185e-06
CAGL0G03399g3691051156e-06
Scas_659.94753001167e-06
Kwal_26.7655743801167e-06
KLLA0F22000g7931351168e-06
Kwal_34.158183492661141e-05
CAGL0L06952g347671131e-05
ADL322C5011451141e-05
KLLA0F15598g4783151131e-05
CAGL0J06512g545891131e-05
Sklu_2416.54592041122e-05
CAGL0J04818g6541901132e-05
YMR146C (TIF34)347661112e-05
KLLA0E04741g459641122e-05
Scas_660.7*6031261122e-05
Scas_721.128851871122e-05
Kwal_14.12356072081113e-05
Kwal_27.11126996551123e-05
Sklu_2423.1944611113e-05
KLLA0B12804g852761113e-05
CAGL0K03377g978781113e-05
Kwal_33.154757833061113e-05
AAL157C4792981104e-05
YLL011W (SOF1)4893201104e-05
AGL301C361961094e-05
CAGL0A00561g412721094e-05
CAGL0K12188g5351021094e-05
Scas_605.184242591094e-05
YMR102C834751105e-05
CAGL0M09845g9361551095e-05
CAGL0J10340g3381441075e-05
CAGL0D05588g477851086e-05
ADR264C346901076e-05
Kwal_27.10785367981077e-05
KLLA0B14410g7063281088e-05
Sklu_2291.4997981088e-05
CAGL0C01441g10052091079e-05
CAGL0L02761g4192621061e-04
YOR212W (STE4)4232561061e-04
ACR097W467701061e-04
Scas_615.113491701051e-04
Scas_680.11347671051e-04
YLR409C (UTP21)9391551061e-04
YER066W1851201011e-04
Kwal_26.77365072411051e-04
Scas_512.3534601051e-04
Scas_571.46011341051e-04
KLLA0B02827g942571052e-04
AER081C1023611052e-04
YBR103W (SIF2)5351411042e-04
YPR137W (RRP9)5732271042e-04
Kwal_23.41189391591042e-04
Sklu_675.1308961023e-04
Sklu_2364.45551501033e-04
Kwal_27.10385536711033e-04
Sklu_1659.2613901033e-04
Scas_465.41002961033e-04
Scas_719.30940571033e-04
Kwal_47.175554171891023e-04
AFL009C413751014e-04
AGR168W8251281015e-04
YMR092C (AIP1)615721015e-04
Scas_718.6*546991005e-04
Scas_642.19341461006e-04
Sklu_2332.736796997e-04
CAGL0A00605g640149997e-04
Scas_660.8510231989e-04
Sklu_2406.11426305980.001
CAGL0K00957g793170970.001
KLLA0E20779g371253960.001
Scas_510.536296960.002
YER107C (GLE2)365103950.002
Kwal_27.12586509126960.002
YGL003C (CDH1)566125960.002
Kwal_47.17567590145960.002
YCL039W (GID7)74572960.002
Scas_652.1634579940.002
KLLA0D06787g436270950.002
YGL100W (SEH1)34979940.002
Scas_397.241090940.003
Sklu_1926.550998940.003
Kwal_56.24399369213930.004
Scas_721.2941469930.004
YGR200C (ELP2)788143940.004
Sklu_1870.2569211930.004
Kwal_14.906328137920.004
ABL044C518235920.006
BLASTP 2.2.26 [Sep-21-2011]

Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, 
Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), 
"Gapped BLAST and PSI-BLAST: a new generation of protein database search
programs",  Nucleic Acids Res. 25:3389-3402.

Reference for compositional score matrix adjustment: Altschul, Stephen F., 
John C. Wootton, E. Michael Gertz, Richa Agarwala, Aleksandr Morgulis,
Alejandro A. Schaffer, and Yi-Kuo Yu (2005) "Protein database searches
using compositionally adjusted substitution matrices", FEBS J. 272:5101-5109.

Query= YIL046W
         (629 letters)

Database: blastdb 
           34,618 sequences; 16,596,109 total letters

Searching..................................................done

                                                                 Score    E
Sequences producing significant alignments:                      (bits) Value

YIL046W (MET30) [2621] chr9 (268650..270572) F-box protein that ...  1271   0.0  
Scas_704.40                                                           897   0.0  
CAGL0L00781g 95506..97527 similar to sp|P39014 Saccharomyces cer...   855   0.0  
Kwal_23.5769                                                          806   0.0  
ADL082C [1659] [Homologous to ScYIL046W (MET30) - SH] (538948..5...   754   0.0  
KLLA0F27511g 2546533..2548404 similar to sp|P39014 Saccharomyces...   732   0.0  
CAGL0L02629g complement(307323..309710) similar to sp|P07834 Sac...   123   5e-29
YCR072C (YCR072C) [597] chr3 complement(240800..242347) Protein ...   116   3e-27
Kwal_23.5035                                                          115   1e-26
YFL009W (CDC4) [1673] chr6 (116139..118478) F-box protein and co...   114   3e-26
KLLA0D07546g complement(647984..649927) some similarities with s...   112   1e-25
Scas_707.22                                                           110   4e-25
Scas_720.95                                                           108   1e-24
CAGL0H03729g 342948..343859 highly similar to sp|P41318 Saccharo...   103   3e-24
Kwal_23.6324                                                          106   5e-24
Sklu_2173.2 YCR072C, Contig c2173 2732-4279                           105   1e-23
AER263C [2765] [Homologous to ScYCR072C - SH] (1118228..1119769)...   105   1e-23
Kwal_26.8776                                                          103   1e-23
KLLA0F11231g complement(1034708..1036012) similar to sp|Q12417 S...   103   1e-23
CAGL0J03476g 331933..333486 highly similar to sp|P25382 Saccharo...   103   5e-23
AEL246C [2260] [Homologous to ScYBR198C (TAF90) - SH] (172849..1...   103   7e-23
AGL024W [4287] [Homologous to ScYFL009W (CDC4) - SH; ScYER066W -...   103   1e-22
KLLA0C08547g 749737..751284 highly similar to sp|P25382 Saccharo...   100   4e-22
Sklu_2420.2 YPL151C, Contig c2420 3924-5249                           100   5e-22
YNL006W (LST8) [4579] chr14 (620066..620977) Protein required fo...    96   1e-21
Scas_721.115*                                                          96   1e-21
Scas_592.4*                                                            96   2e-21
KLLA0E23529g 2088516..2090996 similar to sp|P38129 Saccharomyces...    99   2e-21
ACR137W [1184] [Homologous to ScYPL151C (PRP46) - SH] complement...    97   2e-21
YPL151C (PRP46) [5296] chr16 complement(266179..267534) Putative...    97   4e-21
Scas_721.32                                                            99   4e-21
AFR199C [3391] [Homologous to ScYMR116C (ASC1) - SH] (799876..80...    95   6e-21
Scas_695.15                                                            94   1e-20
CAGL0M05335g complement(569132..571552) similar to sp|P38129 Sac...    97   1e-20
KLLA0D04840g 413362..414273 highly similar to sp|P41318 Saccharo...    92   2e-20
YMR116C (ASC1) [4073] chr13 complement(499455..499877,500151..50...    92   6e-20
Sklu_2431.12 YBR198C, Contig c2431 17817-20066 reverse complement      94   7e-20
Sklu_2442.2 YNL006W, Contig c2442 3831-4742                            91   9e-20
Kwal_27.12053                                                          94   9e-20
YBR198C (TAF5) [381] chr2 complement(616084..618480) Component o...    94   1e-19
CAGL0G04345g 408842..410977 similar to sp|P47025 Saccharomyces c...    93   2e-19
Kwal_0.212                                                             89   3e-19
YJL112W (MDV1) [2803] chr10 (205222..207366) Protein involved in...    90   2e-18
YGL137W (SEC27) [1850] chr7 (249872..249889,250090..252741) Coat...    89   4e-18
AAL009C [178] [Homologous to ScYNL006W (LST8) - SH] (325785..326...    86   5e-18
CAGL0H08932g join(871668..871685,872089..874779) highly similar ...    88   8e-18
Kwal_27.12667                                                          87   1e-17
Kwal_26.7570                                                           82   1e-17
AEL314W [2191] [Homologous to ScYJL112W (MDV1) - SH; ScYKR036C (...    87   1e-17
AFL118W [3077] [Homologous to ScYGL137W (SEC27) - SH] complement...    87   1e-17
CAGL0M02277g complement(271836..273119) highly similar to sp|Q12...    86   2e-17
KLLA0E12287g join(1086778..1087329,1087730..1088158) similar to ...    84   2e-17
Kwal_56.24526                                                          87   2e-17
Scas_711.11                                                            86   4e-17
Scas_630.6                                                             85   4e-17
ADR077C [1818] [Homologous to ScYDL145C (COP1) - SH] (843171..84...    86   6e-17
CAGL0I03718g complement(317565..321170) highly similar to sp|P53...    86   6e-17
CAGL0C02937g 290289..291692 similar to sp|P39946 Saccharomyces c...    84   1e-16
Scas_624.11                                                            84   1e-16
CAGL0D02090g join(214357..214893,215564..215860) highly similar ...    80   3e-16
KLLA0F10263g 949926..951974 gi|2494900|sp|P56094|TUP1_KLULA Kluy...    82   7e-16
KLLA0B01958g join(170646..170663,170896..173550) similar to sp|P...    82   8e-16
YDL145C (COP1) [723] chr4 complement(194572..198177) Coatomer (C...    81   1e-15
KLLA0F04884g complement(478044..481682) similar to sp|P53622 Sac...    81   1e-15
YKR036C (CAF4) [3289] chr11 complement(508344..510323) Protein t...    80   3e-15
Scas_629.12                                                            79   4e-15
Scas_603.5                                                             79   4e-15
KLLA0F21406g complement(1996260..1998377) similar to sp|P47025 S...    79   5e-15
AGL234W [4078] [Homologous to ScYCR084C (TUP1) - SH] complement(...    77   2e-14
KLLA0C07425g complement(647673..649007) highly similar to sp|Q12...    76   2e-14
AGL196C [4116] [Homologous to ScYLR129W (DIP2) - SH] (328838..33...    76   4e-14
CAGL0E00561g 49750..52260 some similarities with sp|P16649 Sacch...    76   4e-14
Kwal_23.6429                                                           76   4e-14
Kwal_33.15591                                                          75   1e-13
Scas_558.3                                                             75   1e-13
YLR129W (DIP2) [3539] chr12 (399658..402489) Component of U3 sno...    75   1e-13
AER448W [2948] [Homologous to ScYKL213C (DOA1) - SH] complement(...    74   1e-13
Kwal_26.8975                                                           73   2e-13
CAGL0L03201g complement(366795..368534) some similarities with s...    74   2e-13
CAGL0L10890g 1163084..1164457 highly similar to sp|Q12024 Saccha...    73   2e-13
Kwal_23.5351                                                           73   3e-13
CAGL0M04279g 469040..471862 highly similar to sp|Q12220 Saccharo...    73   3e-13
YOR269W (PAC1) [5055] chr15 (826382..827866) Protein required in...    72   3e-13
CAGL0C03608g 360681..362612 similar to sp|P16649 Saccharomyces c...    73   3e-13
Scas_713.50                                                            73   4e-13
Kwal_27.11585                                                          72   5e-13
YLR222C (UTP13) [3622] chr12 complement(579320..581773) Componen...    72   5e-13
YKL213C (DOA1) [3062] chr11 complement(31961..34108) Protein req...    72   7e-13
CAGL0C00737g complement(75028..77478) similar to tr|Q05946 Sacch...    72   8e-13
YCR084C (TUP1) [608] chr3 complement(260307..262448) General rep...    72   1e-12
CAGL0K00275g complement(25300..27447) similar to sp|P36037 Sacch...    71   1e-12
AER337W [2838] [Homologous to ScYOR272W (YTM1) - SH] complement(...    70   1e-12
Scas_631.17                                                            70   1e-12
Scas_679.28                                                            69   8e-12
AGR180W [4491] [Homologous to ScYLR222C - SH] complement(1090647...    68   1e-11
YOR272W (YTM1) [5058] chr15 (832810..834192) Microtubule-associa...    68   1e-11
Sklu_1880.3 YDR364C, Contig c1880 4293-5708                            67   1e-11
CAGL0A02772g complement(289274..290599) similar to sp|P40968 Sac...    67   1e-11
YCR057C (PWP2) [586] chr3 complement(220452..223223) Essential p...    68   2e-11
Sklu_2318.1 YKL213C, Contig c2318 605-2740 reverse complement          67   3e-11
Scas_692.29                                                            66   3e-11
AAR057W [243] [Homologous to ScYCR057C (PWP2) - SH] complement(4...    66   4e-11
ADR176W [1917] [Homologous to ScYOR269W (PAC1) - SH] complement(...    65   5e-11
Sklu_2160.3 YGL137W, Contig c2160 2536-4818 reverse complement         66   5e-11
AEL269C [2236] [Homologous to ScYPR178W (PRP4) - SH] (134760..13...    65   6e-11
Scas_720.83d                                                           66   7e-11
Kwal_56.23920                                                          66   7e-11
KLLA0D16390g 1378884..1381694 similar to sp|Q12220 Saccharomyces...    66   7e-11
KLLA0E21263g 1892524..1893813 similar to sp|P40968 Saccharomyces...    65   9e-11
Scas_721.7                                                             64   1e-10
KLLA0E24508g complement(2175775..2176758) similar to sp|P38123 S...    63   2e-10
Scas_658.1                                                             63   3e-10
YBR175W (SWD3) [360] chr2 (582365..583312) Component of SET1 and...    62   3e-10
KLLA0E07942g 717476..718648 similar to sp|P20484 Saccharomyces c...    62   4e-10
Sklu_2172.6 YLR129W, Contig c2172 11261-12048 reverse complement       61   4e-10
Kwal_26.8953                                                           62   6e-10
YKL021C (MAK11) [3234] chr11 complement(396987..398393) Protein ...    62   6e-10
CAGL0K09284g 914937..917672 highly similar to sp|P25635 Saccharo...    62   8e-10
KLLA0F13244g 1224178..1226622 similar to sgd|S0004212 Saccharomy...    62   8e-10
CAGL0G09845g 940598..942100 similar to sp|P20053 Saccharomyces c...    62   9e-10
Kwal_23.6240                                                           62   1e-09
YDR364C (CDC40) [1190] chr4 complement(1202831..1204198) Protein...    61   2e-09
Scas_692.25                                                            61   2e-09
CAGL0M06193g 643917..644867 similar to sp|P38123 Saccharomyces c...    60   2e-09
Kwal_55.22067                                                          60   3e-09
ADL184W [1557] [Homologous to ScYNL317W (PFS2) - SH] complement(...    60   3e-09
AGR207C [4518] [Homologous to ScYBR175W (SWD3) - SH] (1146710..1...    59   3e-09
CAGL0F06853g 671942..673108 highly similar to sp|P20484 Saccharo...    59   4e-09
CAGL0M04081g complement(450572..451939) highly similar to sp|P42...    59   4e-09
Scas_685.11                                                            59   5e-09
AER255C [2757] [Homologous to ScYDR364C (CDC40) - SH] (1107932.....    59   6e-09
Sklu_1963.2 YBR175W, Contig c1963 4075-5019 reverse complement         58   6e-09
Scas_700.27*                                                           59   7e-09
KLLA0C08976g 784536..787271 highly similar to sgd|S0000653 Sacch...    59   8e-09
KLLA0C07513g complement(656060..657379) similar to sp|P39946 Sac...    59   9e-09
Kwal_55.21559                                                          57   1e-08
AER114W [2619] [Homologous to ScYLR429W (CRN1) - SH] complement(...    57   2e-08
Kwal_27.12239                                                          56   3e-08
YPR178W (PRP4) [5592] chr16 (892326..893723) U4/U6 snRNA-associa...    57   3e-08
ACR166W [1213] [Homologous to ScYKL021C (MAK11) - SH] complement...    56   3e-08
CAGL0M08646g 861488..862501 similar to tr|Q05583 Saccharomyces c...    55   5e-08
KLLA0E21879g complement(1944865..1945866) similar to sgd|S000267...    55   5e-08
YDR267C (YDR267C) [1100] chr4 complement(1002502..1003494) Prote...    55   6e-08
Kwal_14.884                                                            55   7e-08
ACR091W [1138] [Homologous to ScYDR267C - SH] complement(520609....    55   7e-08
KLLA0E18986g 1680775..1683747 similar to sgd|S0006104 Saccharomy...    55   1e-07
Scas_717.68                                                            55   2e-07
KLLA0D02530g complement(212703..214826) gi|5679595|emb|CAB51777....    55   2e-07
YGL004C (RPN14) [1968] chr7 complement(490705..491958) Protein c...    54   3e-07
YNL317W (PFS2) [4296] chr14 (40618..42015) Polyadenylation facto...    53   5e-07
Kwal_26.8628                                                           53   5e-07
Scas_585.8                                                             53   6e-07
YLR429W (CRN1) [3804] chr12 (990773..992728) Coronin, actin-bind...    53   6e-07
KLLA0F16038g complement(1487475..1490063) weakly similar to ca|C...    53   6e-07
Kwal_56.24163                                                          52   8e-07
Scas_719.52                                                            52   1e-06
Sklu_2430.9 YMR102C, Contig c2430 15497-18397                          52   1e-06
Kwal_33.15136                                                          52   1e-06
KLLA0A08866g 776960..778231 weakly similar to sp|P53196 Saccharo...    51   1e-06
Scas_720.45                                                            52   2e-06
ABL024W [568] [Homologous to ScYMR102C - SH; ScYKL121W - SH] com...    51   2e-06
KLLA0E07073g 645766..647124 similar to sp|P42841 Saccharomyces c...    50   3e-06
Kwal_55.21450                                                          50   3e-06
AFL056C [3137] [Homologous to ScYPL183C - SH] (329216..332146) [...    50   5e-06
CAGL0G03399g complement(325879..326988) highly similar to sp|P40...    49   6e-06
Scas_659.9                                                             49   7e-06
Kwal_26.7655                                                           49   7e-06
KLLA0F22000g complement(2044973..2047354) similar to sp|P42935 S...    49   8e-06
Kwal_34.15818                                                          49   1e-05
CAGL0L06952g complement(780793..781836) highly similar to sp|P40...    48   1e-05
ADL322C [1419] [Homologous to ScYBR103W (SIF2) - SH] (128830..13...    49   1e-05
KLLA0F15598g 1439610..1441046 highly similar to sp|P33750 Saccha...    48   1e-05
CAGL0J06512g complement(620516..622153) similar to sp|Q04199 Sac...    48   1e-05
Sklu_2416.5 YNL317W, Contig c2416 8692-10071                           48   2e-05
CAGL0J04818g 455846..457810 highly similar to sp|Q06440 Saccharo...    48   2e-05
YMR146C (TIF34) [4102] chr13 complement(557480..558523) Translat...    47   2e-05
KLLA0E04741g 428278..429657 similar to sp|P20053 Saccharomyces c...    48   2e-05
Scas_660.7*                                                            48   2e-05
Scas_721.128                                                           48   2e-05
Kwal_14.1235                                                           47   3e-05
Kwal_27.11126                                                          48   3e-05
Sklu_2423.1 YLR409C, Contig c2423 869-3703                             47   3e-05
KLLA0B12804g 1117475..1120033 weakly similar to sp|Q03177 Saccha...    47   3e-05
CAGL0K03377g complement(306529..309465) similar to sp|Q03177 Sac...    47   3e-05
Kwal_33.15475                                                          47   3e-05
AAL157C [30] [Homologous to ScYLL011W (SOF1) - SH] (70077..71516...    47   4e-05
YLL011W (SOF1) [3408] chr12 (127522..128991) Protein component o...    47   4e-05
AGL301C [4011] [Homologous to ScYER107C (GLE2) - SH] (137221..13...    47   4e-05
CAGL0A00561g complement(63710..64948) similar to sp|P53196 Sacch...    47   4e-05
CAGL0K12188g 1191188..1192795 similar to sp|P38262 Saccharomyces...    47   4e-05
Scas_605.18                                                            47   4e-05
YMR102C (YMR102C) [4060] chr13 complement(469847..472351) Protei...    47   5e-05
CAGL0M09845g 975007..977817 highly similar to sp|Q06078 Saccharo...    47   5e-05
CAGL0J10340g complement(1008637..1009653) highly similar to sp|P...    46   5e-05
CAGL0D05588g 533235..534668 highly similar to sp|P33750 Saccharo...    46   6e-05
ADR264C [2005] [Homologous to ScYMR146C (TIF34) - SH] (1158218.....    46   6e-05
Kwal_27.10785                                                          46   7e-05
KLLA0B14410g 1264616..1266736 similar to sp|P36037 Saccharomyces...    46   8e-05
Sklu_2291.4 YPL183C, Contig c2291 6003-8996 reverse complement         46   8e-05
CAGL0C01441g complement(156930..159947) similar to tr|Q08924 Sac...    46   9e-05
CAGL0L02761g complement(320826..322085) similar to sp|P18851 Sac...    45   1e-04
YOR212W (STE4) [5005] chr15 (742910..744181) Beta subunit of the...    45   1e-04
ACR097W [1144] [Homologous to ScYOR212W (STE4) - SH] complement(...    45   1e-04
Scas_615.11                                                            45   1e-04
Scas_680.11                                                            45   1e-04
YLR409C (UTP21) [3786] chr12 complement(934411..937230) Member o...    45   1e-04
YER066W (YER066W) [1497] chr5 (290240..290797) Protein containin...    44   1e-04
Kwal_26.7736                                                           45   1e-04
Scas_512.3                                                             45   1e-04
Scas_571.4                                                             45   1e-04
KLLA0B02827g 254447..257275 similar to sp|Q06078 Saccharomyces c...    45   2e-04
AER081C [2586] [Homologous to ScYLR409C - SH] (785301..788372) [...    45   2e-04
YBR103W (SIF2) [292] chr2 (447666..449273) Protein involved in t...    45   2e-04
YPR137W (RRP9) [5555] chr16 (802353..804074) Protein component o...    45   2e-04
Kwal_23.4118                                                           45   2e-04
Sklu_675.1 YMR146C, Contig c675 761-1687                               44   3e-04
Sklu_2364.4 YGL003C, Contig c2364 7265-8932 reverse complement         44   3e-04
Kwal_27.10385                                                          44   3e-04
Sklu_1659.2 YMR092C, Contig c1659 410-2251                             44   3e-04
Scas_465.4                                                             44   3e-04
Scas_719.30                                                            44   3e-04
Kwal_47.17555                                                          44   3e-04
AFL009C [3184] [Homologous to ScYGL004C - SH] (420007..421248) [...    44   4e-04
AGR168W [4479] [Homologous to ScYBL008W (HIR1) - SH] complement(...    44   5e-04
YMR092C (AIP1) [4050] chr13 complement(451631..453478) Actin int...    44   5e-04
Scas_718.6*                                                            43   5e-04
Scas_642.1                                                             43   6e-04
Sklu_2332.7 YER107C, Contig c2332 14211-15314 reverse complement       43   7e-04
CAGL0A00605g complement(67281..69203) similar to sp|P53197 Sacch...    43   7e-04
Scas_660.8                                                             42   9e-04
Sklu_2406.11 YOR212W, Contig c2406 16632-17912 reverse complement      42   0.001
CAGL0K00957g 94828..97209 similar to sp|P42935 Saccharomyces cer...    42   0.001
KLLA0E20779g complement(1841092..1842207) similar to sp|P40066 S...    42   0.001
Scas_510.5                                                             42   0.002
YER107C (GLE2) [1539] chr5 complement(373444..374541) Nuclear po...    41   0.002
Kwal_27.12586                                                          42   0.002
YGL003C (CDH1) [1969] chr7 complement(492476..494176) Protein of...    42   0.002
Kwal_47.17567                                                          42   0.002
YCL039W (GID7) [504] chr3 (52645..54882) Protein of unknown func...    42   0.002
Scas_652.16                                                            41   0.002
KLLA0D06787g 586289..587599 gi|4809177|gb|AAD30127.1|AF136180_1 ...    41   0.002
YGL100W (SEH1) [1883] chr7 (313235..314284) Protein found in com...    41   0.002
Scas_397.2                                                             41   0.003
Sklu_1926.5 YBR103W, Contig c1926 4197-5726 reverse complement         41   0.003
Kwal_56.24399                                                          40   0.004
Scas_721.29                                                            40   0.004
YGR200C (ELP2) [2150] chr7 complement(899907..902273) 90 kDa sub...    41   0.004
Sklu_1870.2 YLR055C, Contig c1870 1126-2835 reverse complement         40   0.004
Kwal_14.906                                                            40   0.004
ABL044C [548] [Homologous to ScYMR093W - SH] (312378..313934) [1...    40   0.006
KLLA0F13772g 1276532..1278094 highly similar to sp|Q04305 Saccha...    40   0.007
ACL116W [933] [Homologous to ScYGR200C (ELP2) - SH] complement(1...    40   0.007
Scas_469.3                                                             40   0.007
YMR093W (UTP15) [4051] chr13 (454014..455555) Protein component ...    40   0.007
Scas_702.16                                                            40   0.007
YPL183C (YPL183C) [5265] chr16 complement(199494..202535) Protei...    40   0.007
CAGL0J01265g complement(118375..119928) highly similar to sp|Q04...    40   0.007
AFL014C [3179] [Homologous to ScYGL116W (CDC20) - SH] (409496..4...    39   0.008
KLLA0E11297g complement(994770..996308) similar to sp|P38262 Sac...    39   0.009
AFR153W [3345] [Homologous to ScYLR055C (SPT8) - SH] complement(...    39   0.009
Kwal_33.13515                                                          39   0.009
KLLA0F06754g complement(650475..651509) similar to sp|P53011 Sac...    39   0.009
CAGL0K05599g 544932..547064 similar to tr|Q08496 Saccharomyces c...    39   0.009
YDL195W (SEC31) [678] chr4 (107209..111030) Component (p150) of ...    39   0.009
YGL116W (CDC20) [1869] chr7 (289810..291642) Activator of anapha...    39   0.010
Sklu_2364.2 YGL004C, Contig c2364 1650-2885 reverse complement         39   0.010
AFL007C [3186] [Homologous to ScYGL003C (CDH1) - SH] (424004..42...    39   0.011
CAGL0L09757g complement(1046898..1047878) highly similar to sp|P...    39   0.011
CAGL0D04884g 475678..477369 highly similar to tr|Q06506 Saccharo...    39   0.013
Scas_670.21                                                            39   0.013
KLLA0A08822g 772565..774313 similar to sp|P53197 Saccharomyces c...    39   0.016
Kwal_55.21144                                                          39   0.016
KLLA0F08811g complement(819834..821744) some similarities with s...    39   0.016
Sklu_2435.13 YPR137W, Contig c2435 18346-20073                         39   0.017
Kwal_47.17465                                                          39   0.018
Scas_693.22                                                            39   0.019
Scas_705.2                                                             38   0.022
CAGL0M05291g complement(566250..567509) similar to sp|P13712 Sac...    38   0.025
Scas_656.15                                                            38   0.025
Kwal_56.24596                                                          37   0.026
AER280C [2782] [Homologous to ScYML102W (CAC2) - SH] (1148956..1...    38   0.027
Scas_674.20                                                            37   0.031
ACR017W [1065] [Homologous to ScYEL056W (HAT2) - SH] complement(...    37   0.031
Kwal_33.13148                                                          37   0.037
Scas_542.5                                                             37   0.038
Sklu_2384.3 YKL018W, Contig c2384 6547-7533                            37   0.041
Kwal_56.24478                                                          37   0.049
CAGL0L09647g 1032740..1034029 highly similar to sp|P35184 Saccha...    37   0.050
Scas_442.2*                                                            37   0.052
Sklu_1710.1 YDR267C, Contig c1710 17-739                               36   0.052
Sklu_2233.2 YMR049C, Contig c2233 5630-8059 reverse complement         37   0.059
KLLA0A04928g 439349..441934 similar to sp|P32479 Saccharomyces c...    37   0.060
YPL247C (YPL247C) [5203] chr16 complement(82625..84196) Protein ...    37   0.064
KLLA0E19613g complement(1733708..1735426) similar to sp|P21304 S...    37   0.071
ABR101C [693] [Homologous to ScYMR049C (ERB1) - SH] (567357..569...    37   0.075
Scas_646.14                                                            36   0.084
AGR067W [4377] [Homologous to ScYDR128W - SH] complement(842182....    36   0.088
Kwal_0.40                                                              36   0.10 
KLLA0D12760g complement(1090428..1091909) weakly similar to sgd|...    36   0.12 
Kwal_56.24332                                                          35   0.12 
Kwal_55.22076                                                          36   0.12 
YKL018W (SWD2) [3238] chr11 (403745..404734) Component of SET1 a...    35   0.13 
YLR208W (SEC13) [3609] chr12 (559553..560446) Component of the C...    35   0.14 
ACR085C [1132] [Homologous to NOHBY] (508364..511228) [2865 bp, ...    35   0.15 
Kwal_14.1710                                                           35   0.16 
KLLA0E18964g complement(1676876..1680310) similar to sp|P53010 S...    35   0.17 
Sklu_2226.6 YNL035C, Contig c2226 6858-8054 reverse complement         35   0.17 
AAR102C [288] [Homologous to ScYPR137W (RRP9) - SH] (526057..527...    35   0.18 
Sklu_2113.2 YCL039W, Contig c2113 2538-4865                            35   0.18 
AFL038C [3155] [Homologous to ScYGL100W (SEH1) - SH] (367581..36...    35   0.19 
KLLA0C16643g complement(1457590..1458498) highly similar to sp|Q...    35   0.19 
CAGL0H00781g complement(77292..78833) similar to tr|Q12523 Sacch...    35   0.20 
YBR195C (MSI1) [378] chr2 complement(610571..611839) Chromatin a...    35   0.23 
YMR049C (ERB1) [4011] chr13 complement(368093..370516) Protein w...    35   0.24 
Kwal_56.22345                                                          35   0.24 
YDR128W (YDR128W) [975] chr4 (709543..712989) Protein containing...    35   0.24 
Kwal_56.23685                                                          35   0.25 
KLLA0E18139g 1608371..1609351 highly similar to sp|P36104 Saccha...    34   0.26 
KLLA0F26653g 2461876..2464251 similar to sp|Q04660 Saccharomyces...    35   0.27 
Sklu_2371.4 YDR030C, Contig c2371 8070-9506 reverse complement         34   0.39 
CAGL0E02805g complement(265137..267659) similar to sp|P32479 Sac...    34   0.40 
Kwal_26.7738                                                           34   0.44 
KLLA0F21076g 1966373..1969036 highly similar to sp|Q9P4C0 Kluyve...    34   0.45 
AFR715C [3908] [Homologous to ScYCL039W - SH] (1752847..1754997)...    34   0.47 
CAGL0K11638g complement(1123343..1125121) weakly similar to sp|Q...    34   0.48 
CAGL0M01430g 164428..166683 highly similar to tr|Q06679 Saccharo...    34   0.48 
KLLA0F07403g 697593..698636 similar to sp|P40217 Saccharomyces c...    33   0.49 
YDR324C (UTP4) [1154] chr4 complement(1114426..1116756) Protein ...    34   0.49 
CAGL0L04950g complement(562491..564908) highly similar to sp|Q04...    34   0.51 
Kwal_33.14971                                                          34   0.52 
CAGL0B00748g 65727..68165 similar to sp|P25569 Saccharomyces cer...    34   0.53 
Scas_699.5                                                             33   0.53 
Sklu_2317.3 YDR142C, Contig c2317 5804-6910                            33   0.58 
YBL008W (HIR1) [186] chr2 (209618..212140) Histone transcription...    33   0.60 
YLR196W (PWP1) [3599] chr12 (543970..545700) Protein containing ...    33   0.62 
ADR230W [1971] [Homologous to ScYOR080W (DIA2) - SH] complement(...    33   0.67 
CAGL0J01287g 120215..122047 similar to sp|P46680 Saccharomyces c...    33   0.67 
YLR055C (SPT8) [3472] chr12 complement(251273..253081) Component...    33   0.68 
CAGL0J08778g 866175..867071 highly similar to sp|Q04491 Saccharo...    33   0.74 
YBR097W (VPS15) [288] chr2 (436908..441272) Serine/threonine pro...    33   0.87 
KLLA0F10791g complement(991642..993279) similar to sp|P26309 Sac...    33   0.90 
ABL043W [549] [Homologous to ScYMR092C (AIP1) - SH] complement(3...    33   0.92 
YDL156W (YDL156W) [714] chr4 (174919..176487) Protein containing...    33   0.97 
AFR438W [3630] [Homologous to ScYML088W (UFO1) - SH] complement(...    33   1.1  
AGR177C [4488] [Homologous to ScYDR219C - SH] (1082418..1083875)...    33   1.1  
Sklu_1645.2 YGL116W, Contig c1645 887-2650 reverse complement          33   1.1  
YDR030C (RAD28) [881] chr4 complement(501749..503269) Protein in...    32   1.1  
ADL054W [1687] [Homologous to ScYER124C (DSE1) - SH] complement(...    33   1.1  
ACR199C [1246] [Homologous to ScYLR208W (SEC13) - SH] (698881..6...    32   1.2  
Sklu_2382.2 YDL195W, Contig c2382 2146-5931 reverse complement         33   1.2  
ACR116W [1163] [Homologous to ScYPL139C (UME1) - SH] complement(...    32   1.2  
CAGL0F07337g complement(714870..716735) similar to sp|P26309 Sac...    32   1.2  
Kwal_33.14248                                                          32   1.3  
CAGL0B03575g complement(357525..358784) similar to sp|P39984 Sac...    32   1.3  
CAGL0B02013g 184252..187614 highly similar to tr|Q03897 Saccharo...    32   1.3  
KLLA0C16533g complement(1448866..1450404) similar to sgd|S000231...    32   1.4  
KLLA0B11924g complement(1043344..1047582) similar to sp|P22219 S...    32   1.4  
AAR078W [264] [Homologous to ScYLR196W (PWP1) - SH] complement(4...    32   1.5  
Scas_649.10                                                            32   1.6  
AFR634W [3826] [Homologous to ScYNL253W - SH] complement(1593772...    32   1.6  
CAGL0J07854g complement(765463..766761) similar to sp|P53851 Sac...    32   1.6  
KLLA0B11077g complement(970761..972464) similar to sgd|S0006341 ...    32   1.6  
YKL121W (YKL121W) [3144] chr11 (213788..216346) Protein containi...    32   1.7  
ACL099W [950] [Homologous to ScYKL018W (SWD2) - SH] complement(1...    32   1.7  
Kwal_56.24661                                                          32   1.7  
KLLA0F17237g 1577197..1578768 similar to sp|Q04225 Saccharomyces...    32   1.9  
YML102W (CAC2) [3869] chr13 (68294..69700) Chromatin assembly co...    32   1.9  
KLLA0F13750g complement(1274110..1275972) similar to sp|P46680 S...    32   2.2  
YDR488C (PAC11) [1304] chr4 complement(1429176..1430777) Dynein ...    32   2.2  
KLLA0F19734g 1826828..1830229 similar to sgd|S0002535 Saccharomy...    32   2.4  
Scas_617.6                                                             31   2.5  
CAGL0J08998g 882655..886500 highly similar to sp|P38968 Saccharo...    32   2.5  
AEL250C [2256] [Homologous to ScYBR195C (MSI1) - SH] (168010..16...    31   2.5  
YBR281C (YBR281C) [459] chr2 complement(764928..767564) Member o...    32   2.5  
CAGL0J09240g 911669..912982 highly similar to sp|Q12122 Saccharo...    31   2.5  
Sklu_2416.2 YOL138C, Contig c2416 613-4674 reverse complement          32   2.6  
Scas_706.24                                                            31   2.6  
Scas_715.35                                                            32   2.7  
ADL186C [1555] [Homologous to ScYOL138C - SH] (369322..373407) [...    32   2.7  
KLLA0C01177g 89978..92131 weakly similar to sp|P25569 Saccharomy...    31   3.0  
KLLA0E21043g 1872227..1876192 similar to sgd|S0005498 Saccharomy...    31   3.0  
Scas_715.22                                                            31   3.1  
CAGL0H04103g 388457..390460 similar to sp|Q04511 Saccharomyces c...    31   3.1  
Kwal_47.17310                                                          31   3.3  
Kwal_55.20634                                                          31   3.5  
Sklu_2114.2 YDR128W, Contig c2114 598-4020 reverse complement          31   3.5  
Scas_640.18                                                            31   3.6  
Sklu_1701.1 YOR229W, Contig c1701 334-1536 reverse complement          31   3.7  
YEL056W (HAT2) [1372] chr5 (47168..48373) Histone acetyltransfer...    31   4.0  
KLLA0E04026g complement(373677..375335) similar to sp|P43609 Sac...    30   4.4  
Scas_640.17                                                            30   4.5  
AGR242C [4553] [Homologous to ScYIR012W (SQT1) - SH] (1203152..1...    30   4.7  
Scas_675.18                                                            31   4.7  
AGL190W [4122] [Homologous to ScYDR142C (PEX7) - SH] complement(...    30   4.8  
AER378W [2879] [Homologous to ScYIL129C (TAO3) - SH] complement(...    31   4.9  
Sklu_2359.2 YER124C, Contig c2359 3062-4807                            30   5.4  
KLLA0E11143g 983669..985150 similar to sp|Q04199 Saccharomyces c...    30   5.5  
Scas_661.19                                                            30   5.6  
Scas_720.39                                                            30   6.4  
CAGL0A04037g complement(399371..401122) highly similar to sp|P21...    30   6.5  
CAGL0M13409g complement(1316268..1320851) similar to sp|P38873 S...    30   8.1  
Scas_589.13                                                            30   8.4  
CAGL0J03960g complement(373177..374484) similar to sp|Q12206 Sac...    30   9.4  
CAGL0E01485g complement(138830..142840) similar to tr|Q08281 Sac...    30   9.6  
KLLA0A09471g complement(827264..831784) similar to sp|P38873 Sac...    30   9.9  

>YIL046W (MET30) [2621] chr9 (268650..270572) F-box protein that
           targets proteins for ubiquitination by interacting with
           the SCF complex (Skp1p-Cdc53p-Cdc34p), regulates sulfur
           assimilation genes in response to S-adenosylmethionine
           levels, contains five WD (WD-40) repeats [1923 bp, 640
           aa]
          Length = 640

 Score = 1271 bits (3289), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 613/629 (97%), Positives = 613/629 (97%)

Query: 1   MRRERQRMMSFEXXXXXXXXXXXXXXXXEMTDTAMMPPLKRLLITGSSDDLAQGSSGKKK 60
           MRRERQRMMSFE                EMTDTAMMPPLKRLLITGSSDDLAQGSSGKKK
Sbjct: 1   MRRERQRMMSFEDKDKDDLDNSNSNNSSEMTDTAMMPPLKRLLITGSSDDLAQGSSGKKK 60

Query: 61  MTMATRSPSSSPDLATNDSGTRVQPLPEYNFTKFCYRHNPDIQFSPTHTACYKQDLKRTQ 120
           MTMATRSPSSSPDLATNDSGTRVQPLPEYNFTKFCYRHNPDIQFSPTHTACYKQDLKRTQ
Sbjct: 61  MTMATRSPSSSPDLATNDSGTRVQPLPEYNFTKFCYRHNPDIQFSPTHTACYKQDLKRTQ 120

Query: 121 EINANIAKLPLQEQSDIHHIISKYSNSNDKIRKLILDGILSTSCFPQLSYISSLVTHMIK 180
           EINANIAKLPLQEQSDIHHIISKYSNSNDKIRKLILDGILSTSCFPQLSYISSLVTHMIK
Sbjct: 121 EINANIAKLPLQEQSDIHHIISKYSNSNDKIRKLILDGILSTSCFPQLSYISSLVTHMIK 180

Query: 181 IDFISILPQELSLKILSYLDCQSLCNATRVCRKWQKLADDDRVWYHMCEQHIDRKCPNCG 240
           IDFISILPQELSLKILSYLDCQSLCNATRVCRKWQKLADDDRVWYHMCEQHIDRKCPNCG
Sbjct: 181 IDFISILPQELSLKILSYLDCQSLCNATRVCRKWQKLADDDRVWYHMCEQHIDRKCPNCG 240

Query: 241 WGLPLLHMKRARIQQNSTGSSSNADIQTQTTRPWKVIYRERFKVESNWRKGHCRIQEFKG 300
           WGLPLLHMKRARIQQNSTGSSSNADIQTQTTRPWKVIYRERFKVESNWRKGHCRIQEFKG
Sbjct: 241 WGLPLLHMKRARIQQNSTGSSSNADIQTQTTRPWKVIYRERFKVESNWRKGHCRIQEFKG 300

Query: 301 HMDGVLTLQFNYRLLFTGSYDSTIGIWDLFTGKLIRRLSGHSDGVKTLYFDDRKLITGSL 360
           HMDGVLTLQFNYRLLFTGSYDSTIGIWDLFTGKLIRRLSGHSDGVKTLYFDDRKLITGSL
Sbjct: 301 HMDGVLTLQFNYRLLFTGSYDSTIGIWDLFTGKLIRRLSGHSDGVKTLYFDDRKLITGSL 360

Query: 361 DKTIRVWNYITGECISTYRGHSDSVLSVDSYQKVIVSGSADKTVKVWHVESRTCYTLRGH 420
           DKTIRVWNYITGECISTYRGHSDSVLSVDSYQKVIVSGSADKTVKVWHVESRTCYTLRGH
Sbjct: 361 DKTIRVWNYITGECISTYRGHSDSVLSVDSYQKVIVSGSADKTVKVWHVESRTCYTLRGH 420

Query: 421 TEWVNCVKLHPKSFSCFSCSDDTTIRMWDIRTNSCLKVFRGHVGQVQKIIPLTIKDVENL 480
           TEWVNCVKLHPKSFSCFSCSDDTTIRMWDIRTNSCLKVFRGHVGQVQKIIPLTIKDVENL
Sbjct: 421 TEWVNCVKLHPKSFSCFSCSDDTTIRMWDIRTNSCLKVFRGHVGQVQKIIPLTIKDVENL 480

Query: 481 ATDNTSDGSSPQDDPTMTDGADESDTPSNEQETVLDENIPYPTHLLSCGLDNTIKLWDVK 540
           ATDNTSDGSSPQDDPTMTDGADESDTPSNEQETVLDENIPYPTHLLSCGLDNTIKLWDVK
Sbjct: 481 ATDNTSDGSSPQDDPTMTDGADESDTPSNEQETVLDENIPYPTHLLSCGLDNTIKLWDVK 540

Query: 541 TGKCIRTQFGHVEGVWDIAADNFRIISGSHDGSIKVWDLQSGKCMHTFNGRRLQRETQHT 600
           TGKCIRTQFGHVEGVWDIAADNFRIISGSHDGSIKVWDLQSGKCMHTFNGRRLQRETQHT
Sbjct: 541 TGKCIRTQFGHVEGVWDIAADNFRIISGSHDGSIKVWDLQSGKCMHTFNGRRLQRETQHT 600

Query: 601 QTQSLGDKVAPIACVCIGDSECFSGDEFG 629
           QTQSLGDKVAPIACVCIGDSECFSGDEFG
Sbjct: 601 QTQSLGDKVAPIACVCIGDSECFSGDEFG 629

>Scas_704.40
          Length = 608

 Score =  897 bits (2318), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 429/586 (73%), Positives = 490/586 (83%), Gaps = 29/586 (4%)

Query: 73  DLATNDSGTRVQP-----LPEYNFTKFCYRHNPDIQFSPTHTACYKQDLKRTQEINANIA 127
           +L  ++   R+ P     LP++NFTKFCYRHNP+I  SPTHTACY QDLKR +++N NI 
Sbjct: 15  ELIRSNKEQRITPTFSSALPQFNFTKFCYRHNPEILSSPTHTACYNQDLKRFKDLNDNIT 74

Query: 128 KLPLQEQSDIHHIISKYSNSNDKIRKLILDGILSTSCFPQLSYISSLVTHMIKIDFISIL 187
           KLP QEQ++IHHIISK++ SNDK+RKLILDGIL++SCFPQLSYISS V++MI+IDFISIL
Sbjct: 75  KLPAQEQAEIHHIISKFNKSNDKLRKLILDGILASSCFPQLSYISSQVSNMIRIDFISIL 134

Query: 188 PQELSLKILSYLDCQSLCNATRVCRKWQKLADDDRVWYHMCEQHIDRKCPNCGWGLPLLH 247
           PQELSLKILSYLDCQSLCNAT+VCRKWQ LADDDRVWYHMCEQHIDRKCPNCGWGLPLLH
Sbjct: 135 PQELSLKILSYLDCQSLCNATKVCRKWQILADDDRVWYHMCEQHIDRKCPNCGWGLPLLH 194

Query: 248 MKRARIQQNSTGSSSN----ADIQTQTTRPWKVIYRERFKVESNWRKGHCRIQEFKGHMD 303
           MKRAR  +N++  ++N     D   +  RPWKVIYRERFKVESNWRKG+C++QEFKGHMD
Sbjct: 195 MKRARFVKNASICATNNTCTKDSNGKLMRPWKVIYRERFKVESNWRKGNCQVQEFKGHMD 254

Query: 304 GVLTLQFNYRLLFTGSYDSTIGIWDLFTGKLIRRLSGHSDGVKTLYFDDRKLITGSLDKT 363
           GVLTLQFNYRLLFTGSYDST+ IWDL + KLIRRLSGH+DGVKTLYFD+ KL+TGSLDKT
Sbjct: 255 GVLTLQFNYRLLFTGSYDSTVAIWDLCSNKLIRRLSGHTDGVKTLYFDEAKLVTGSLDKT 314

Query: 364 IRVWNYITGECISTYRGHSDSVLSVDSYQKVIVSGSADKTVKVWHVESRTCYTLRGHTEW 423
           IRVWNY TGECISTYRGH+DSV+SVD+++K+IVSGSADKTVK+WHVESRTCYTLRGHTEW
Sbjct: 315 IRVWNYKTGECISTYRGHTDSVMSVDAFKKIIVSGSADKTVKIWHVESRTCYTLRGHTEW 374

Query: 424 VNCVKLHPKSFSCFSCSDDTTIRMWDIRTNSCLKVFRGHVGQVQKIIPLTIKDVENLATD 483
           VNCVKLHPKSF+CFS SDDTTIRMWDIRTNSCLKVFRGHVGQVQK+IPLTI D ENL  D
Sbjct: 375 VNCVKLHPKSFTCFSGSDDTTIRMWDIRTNSCLKVFRGHVGQVQKVIPLTIIDAENLVVD 434

Query: 484 NTSDGSSPQDDP----TMTDGADESDTPSNEQETVLDENIPYPTHLLSCGLDNTIKLWDV 539
           N S  +   D+P    T T         ++E+   LD++IPYPTHLLSC LDNTIKLWDV
Sbjct: 435 NISGSNEGDDEPASTTTPTAAIAAEAATNDEENQTLDKSIPYPTHLLSCSLDNTIKLWDV 494

Query: 540 KTGKCIRTQFGHVEGVWDIAADNFRIISGSHDGSIKVWDLQSGKCMHTFNGRRLQRETQH 599
           +TG+CIRTQFGHVEGVWDIAADNFRIISGSHDGSIK+WDLQSGKCMHTF+G+RLQ + + 
Sbjct: 495 QTGQCIRTQFGHVEGVWDIAADNFRIISGSHDGSIKIWDLQSGKCMHTFHGKRLQPQDEE 554

Query: 600 TQTQ----------------SLGDKVAPIACVCIGDSECFSGDEFG 629
             T                  + +KV+PIACV IGDSE FSGDE G
Sbjct: 555 GSTHLASTSNATGTSTSTANPVQNKVSPIACVSIGDSEFFSGDELG 600

>CAGL0L00781g 95506..97527 similar to sp|P39014 Saccharomyces
           cerevisiae YIL046w MET30, hypothetical start
          Length = 673

 Score =  855 bits (2209), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 422/618 (68%), Positives = 482/618 (77%), Gaps = 66/618 (10%)

Query: 74  LATN-DSGTRVQPLPEYNFTKFCYRHNPDIQFSPTHTACYKQDLKRTQEINANIAKLPL- 131
           LAT+ +S + V  LP  NF ++CYRHNP+IQ S TH  CYKQD++R + IN  I++L   
Sbjct: 49  LATSTESQSGVSVLPRDNFQRYCYRHNPEIQTSNTHELCYKQDMQRIKMINNKISQLACP 108

Query: 132 QEQSDIHHIISKYSNSNDKIRKLILDGILSTSCFPQLSYISSLVTHMIKIDFISILPQEL 191
           +EQ+DIHHIISKY+NSNDK+RKLILDGIL++SCFPQLSYI+  +  MIKIDFIS+LPQEL
Sbjct: 109 KEQADIHHIISKYTNSNDKVRKLILDGILTSSCFPQLSYIAQHINTMIKIDFISVLPQEL 168

Query: 192 SLKILSYLDCQSLCNATRVCRKWQKLADDDRVWYHMCEQHIDRKCPNCGWGLPLLHMKRA 251
           SLKIL YLDCQSLCNA+ VC+ W  LADDDRVWYHMCEQHIDRKCPNCGWGLPLLHMKRA
Sbjct: 169 SLKILGYLDCQSLCNASMVCKNWHLLADDDRVWYHMCEQHIDRKCPNCGWGLPLLHMKRA 228

Query: 252 R------------------IQQNS---------------------------------TGS 260
           R                  IQ N                                  +GS
Sbjct: 229 RVCYIKAKNPNTTVNDRKMIQDNDNRISPLTDRTQGNESPGATFSTNVCTTASNNTVSGS 288

Query: 261 SSNADIQTQTTR----PWKVIYRERFKVESNWRKGHCRIQEFKGHMDGVLTLQFNYRLLF 316
            S+   Q +  R     WK++YRERFKVESNWRKG C IQEFKGHMDGVLTLQFNYRLLF
Sbjct: 289 KSSGQGQQENGRCRQKSWKMVYRERFKVESNWRKGLCTIQEFKGHMDGVLTLQFNYRLLF 348

Query: 317 TGSYDSTIGIWDLFTGKLIRRLSGHSDGVKTLYFDDRKLITGSLDKTIRVWNYITGECIS 376
           TGSYD+T+ IWDLFTGKLIRRL+GHSDGVKTLYFDD+KLITGSLDKTIRVWNYITGECIS
Sbjct: 349 TGSYDTTVAIWDLFTGKLIRRLTGHSDGVKTLYFDDQKLITGSLDKTIRVWNYITGECIS 408

Query: 377 TYRGHSDSVLSVDSYQKVIVSGSADKTVKVWHVESRTCYTLRGHTEWVNCVKLHPKSFSC 436
           TYRGH+DSV+SVDS++K+IVSGSADKTVKVWHVESRTCYTL+GHTEWVNCVKLHPKSFSC
Sbjct: 409 TYRGHTDSVMSVDSHKKIIVSGSADKTVKVWHVESRTCYTLKGHTEWVNCVKLHPKSFSC 468

Query: 437 FSCSDDTTIRMWDIRTNSCLKVFRGHVGQVQKIIPLTIKDVENLATDNTSDGSSPQDDPT 496
           +SCSDDTTIRMWDIRTN+CL+VFRGHVGQVQK+IPLTI D +NL T     G   ++D  
Sbjct: 469 YSCSDDTTIRMWDIRTNTCLRVFRGHVGQVQKVIPLTIIDAQNLVTHERKPG---EEDDI 525

Query: 497 MTDGADESDTPSN--EQETVLDENIPYPTHLLSCGLDNTIKLWDVKTGKCIRTQFGHVEG 554
            ++G  E D P N    +  LD+ +PYPTHLLSC LDNTIKLW+V++G+CIRTQFGHVEG
Sbjct: 526 ASNGTGEDD-PENGVNGQRELDKKMPYPTHLLSCALDNTIKLWEVRSGRCIRTQFGHVEG 584

Query: 555 VWDIAADNFRIISGSHDGSIKVWDLQSGKCMHTFNGRRLQRETQHTQTQSLGD---KVAP 611
           VWDIAADNFRIISGSHDGSIK+WDLQSGKCMHTF+GR+L+    +T +    D   K AP
Sbjct: 585 VWDIAADNFRIISGSHDGSIKIWDLQSGKCMHTFHGRKLKGSDVNTSSNPDHDERTKSAP 644

Query: 612 IACVCIGDSECFSGDEFG 629
           +ACVCIGDSECFSGDEFG
Sbjct: 645 VACVCIGDSECFSGDEFG 662

>Kwal_23.5769
          Length = 627

 Score =  806 bits (2083), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 372/565 (65%), Positives = 450/565 (79%), Gaps = 35/565 (6%)

Query: 75  ATNDSGTRVQPLPEYNFTKFCYRHNPDIQFSPTHTACYKQDLKRTQEINANIAKLPLQEQ 134
           A + +  RV+ LP+YNF +FCYRHNPD Q S THTACY QD +R Q++N  I +L  +EQ
Sbjct: 80  ANSRTNKRVRGLPQYNFLRFCYRHNPDFQHSQTHTACYMQDQQRHQKLNKKIEQLEPEEQ 139

Query: 135 SDIHHIISKYSNSNDKIRKLILDGILSTSCFPQLSYISSLVTHMIKIDFISILPQELSLK 194
             + ++++ ++  ND+IRKL+L+G+L+  CFPQLS+++S V  MIKIDFIS LP+E++LK
Sbjct: 140 RQVQNVLTTFAGCNDRIRKLLLEGLLANCCFPQLSFVASEVQKMIKIDFISTLPEEVALK 199

Query: 195 ILSYLDCQSLCNATRVCRKWQKLADDDRVWYHMCEQHIDRKCPNCGWGLPLLHMKRARI- 253
           IL YLDC+SLCNA RVCR+WQ++ADDD+VWYHMC+QHIDRKCPNCGWGLPLLHMKRAR  
Sbjct: 200 ILGYLDCESLCNAARVCRRWQQMADDDKVWYHMCQQHIDRKCPNCGWGLPLLHMKRARFI 259

Query: 254 ---------QQNSTGSSSNADIQTQTTRPWKVIYRERFKVESNWRKGHCRIQEFKGHMDG 304
                    Q+ +      ++  T+ TRPWKVIYRERFKVESNWRKG   IQEFKGHMDG
Sbjct: 260 EPPAESKPGQKGAGNPPVASETTTRKTRPWKVIYRERFKVESNWRKGTAHIQEFKGHMDG 319

Query: 305 VLTLQFNYRLLFTGSYDSTIGIWDLFTGKLIRRLSGHSDGVKTLYFDDRKLITGSLDKTI 364
           VL+LQFNYRLLFTGSYDST+ IWDL TGKL+RRL+GH DGVK +YFD +KLITGSLD+ I
Sbjct: 320 VLSLQFNYRLLFTGSYDSTVAIWDLATGKLVRRLTGHRDGVKAIYFDGQKLITGSLDRMI 379

Query: 365 RVWNYITGECISTYRGHSDSVLSVDSYQKVIVSGSADKTVKVWHVESRTCYTLRGHTEWV 424
           RVWNY+TG C++ Y GHSDSVLSVDSY+K+IVSGSADKTVKVWHVESRTCYTLRGHTEWV
Sbjct: 380 RVWNYVTGACVAAYPGHSDSVLSVDSYKKIIVSGSADKTVKVWHVESRTCYTLRGHTEWV 439

Query: 425 NCVKLHPKSFSCFSCSDDTTIRMWDIRTNSCLKVFRGHVGQVQKIIPLTIKDVENLATDN 484
             VKLHPKSF+CFS SDDTTIRMWDIR+N+C+KVFRGHVGQVQK++PLTI D ENL TD 
Sbjct: 440 GTVKLHPKSFTCFSGSDDTTIRMWDIRSNTCVKVFRGHVGQVQKVLPLTILDTENLVTDR 499

Query: 485 TSDGSSPQDDPTMTDGADESDTPSNEQETVLDENIPYPTHLLSCGLDNTIKLWDVKTGKC 544
           TSD   P+++ T       +  P + Q + LD+++PYP+HLLSC LDNTIKLW+V+TGKC
Sbjct: 500 TSD--PPRNEATT------AQDPPDGQLSALDDSLPYPSHLLSCSLDNTIKLWEVRTGKC 551

Query: 545 IRTQFGHVEGVWDIAADNFRIISGSHDGSIKVWDLQSGKCMHTFNGRRLQRETQHTQTQS 604
           +RT FGHVEG+WDIAADNFRI+SG+HD ++KVWDLQSGKC+HTF+  +            
Sbjct: 552 VRTHFGHVEGIWDIAADNFRIVSGAHDKTVKVWDLQSGKCIHTFDSHQ------------ 599

Query: 605 LGDKVAPIACVCIGDSECFSGDEFG 629
                API CV IGDSE  SGDE G
Sbjct: 600 -----APITCVGIGDSEFVSGDELG 619

 Score = 66.2 bits (160), Expect = 4e-11,   Method: Compositional matrix adjust.
 Identities = 32/92 (34%), Positives = 54/92 (58%)

Query: 315 LFTGSYDSTIGIWDLFTGKLIRRLSGHSDGVKTLYFDDRKLITGSLDKTIRVWNYITGEC 374
           L + S D+TI +W++ TGK +R   GH +G+  +  D+ ++++G+ DKT++VW+  +G+C
Sbjct: 532 LLSCSLDNTIKLWEVRTGKCVRTHFGHVEGIWDIAADNFRIVSGAHDKTVKVWDLQSGKC 591

Query: 375 ISTYRGHSDSVLSVDSYQKVIVSGSADKTVKV 406
           I T+  H   +  V       VSG     VKV
Sbjct: 592 IHTFDSHQAPITCVGIGDSEFVSGDELGCVKV 623

>ADL082C [1659] [Homologous to ScYIL046W (MET30) - SH]
           (538948..540657) [1710 bp, 569 aa]
          Length = 569

 Score =  754 bits (1948), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 364/547 (66%), Positives = 422/547 (77%), Gaps = 31/547 (5%)

Query: 87  PEYNFTKFCYRHNPDIQFSPTHTACYKQDLKRTQEINANIAKLPLQ-EQSDIHHIISKYS 145
           P+YNF ++CYRHNPDIQ +PT   C +Q+ +R +E  A + +L  + E+  +   +  + 
Sbjct: 40  PQYNFVRYCYRHNPDIQAAPTQVRCVRQEQQRREEWQARVGELSSEGERQVVQEAVRLFD 99

Query: 146 NSNDKIRKLILDGILSTSCFPQLSYISSLVTHMIKIDFISILPQELSLKILSYLDCQSLC 205
           +SNDK+RKL+L+G+L  SCFPQLS+IS+ +  +IKIDFIS LP+E++LKIL YLDCQSLC
Sbjct: 100 SSNDKLRKLMLEGMLLKSCFPQLSFISTQLQKLIKIDFISALPEEVALKILGYLDCQSLC 159

Query: 206 NATRVCRKWQKLADDDRVWYHMCEQHIDRKCPNCGWGLPLLHMKRARIQQNSTGSSSNA- 264
           +A  VCR+WQ+LADDD VWYHMCEQHIDRKCP CGWGLPLLHMKRAR  ++   S+S   
Sbjct: 160 SAAAVCRRWQELADDDTVWYHMCEQHIDRKCPKCGWGLPLLHMKRARYIKSDKASASKGE 219

Query: 265 --DIQTQTTRPWKVIYRERFKVESNWRKGHCRIQEFKGHMDGVLTLQFNYRLLFTGSYDS 322
             D      RPWKV+YRERFKVESNWRKG  RIQEFKGHMDGVL+LQ   +LL TGSYDS
Sbjct: 220 GEDAPQSRMRPWKVVYRERFKVESNWRKGIYRIQEFKGHMDGVLSLQLTNKLLLTGSYDS 279

Query: 323 TIGIWDLFTGKLIRRLSGHSDGVKTLYFDDRKLITGSLDKTIRVWNYITGECISTYRGHS 382
           T+ IWDL TGKLIRRLSGH+DGVK L FDD+KLITGSLDKTIRVWNY+TG C+STYRGH 
Sbjct: 280 TVAIWDLATGKLIRRLSGHTDGVKALRFDDQKLITGSLDKTIRVWNYVTGACVSTYRGHQ 339

Query: 383 DSVLSVDSYQKVIVSGSADKTVKVWHVESRTCYTLRGHTEWVNCVKLHPKSFSCFSCSDD 442
           DSVLSVDS++K+IVSGSADKTVKVWHVESRTCYTLRGHT WVNCVKLHPKSF+CFS SDD
Sbjct: 340 DSVLSVDSFRKLIVSGSADKTVKVWHVESRTCYTLRGHTGWVNCVKLHPKSFTCFSGSDD 399

Query: 443 TTIRMWDIRTNSCLKVFRGHVGQVQKIIPLTIKDVENLATDNTSDGSSPQDDPTMTDGAD 502
            TIRMWDIRTN+C++VF GHVGQVQK+IPLT      L +D   D   P+D     D   
Sbjct: 400 MTIRMWDIRTNTCVRVFHGHVGQVQKVIPLT------LGSDLIED---PKDAVVPPDATA 450

Query: 503 ESDTPSNEQETVLDENIPYPTHLLSCGLDNTIKLWDVKTGKCIRTQFGHVEGVWDIAADN 562
            +  PS  Q    D ++PYPTHLLSC LDNTIKLW+VKTG CIRTQFGHVEGVWDIAADN
Sbjct: 451 PAHDPS-VQAANFDHSLPYPTHLLSCSLDNTIKLWNVKTGACIRTQFGHVEGVWDIAADN 509

Query: 563 FRIISGSHDGSIKVWDLQSGKCMHTFNGRRLQRETQHTQTQSLGDKVAPIACVCIGDSEC 622
           FRI+SGSHD S KVWDLQ+GKCMHTF G                   AP+ACV IGDSE 
Sbjct: 510 FRIVSGSHDRSCKVWDLQTGKCMHTFVGIH-----------------APVACVGIGDSEF 552

Query: 623 FSGDEFG 629
            SGDE G
Sbjct: 553 VSGDELG 559

 Score = 61.2 bits (147), Expect = 2e-09,   Method: Compositional matrix adjust.
 Identities = 36/117 (30%), Positives = 62/117 (52%), Gaps = 5/117 (4%)

Query: 300 GHMDGVLTLQFNYRL-----LFTGSYDSTIGIWDLFTGKLIRRLSGHSDGVKTLYFDDRK 354
            H   V    F++ L     L + S D+TI +W++ TG  IR   GH +GV  +  D+ +
Sbjct: 452 AHDPSVQAANFDHSLPYPTHLLSCSLDNTIKLWNVKTGACIRTQFGHVEGVWDIAADNFR 511

Query: 355 LITGSLDKTIRVWNYITGECISTYRGHSDSVLSVDSYQKVIVSGSADKTVKVWHVES 411
           +++GS D++ +VW+  TG+C+ T+ G    V  V       VSG     VK+++ ++
Sbjct: 512 IVSGSHDRSCKVWDLQTGKCMHTFVGIHAPVACVGIGDSEFVSGDELGCVKLYNFDT 568

 Score = 42.4 bits (98), Expect = 0.001,   Method: Compositional matrix adjust.
 Identities = 23/85 (27%), Positives = 44/85 (51%), Gaps = 1/85 (1%)

Query: 287 NWRKGHCRIQEFKGHMDGVLTLQFNYRLLFTGSYDSTIGIWDLFTGKLIRRLSGHSDGVK 346
           N + G C   +F GH++GV  +  +   + +GS+D +  +WDL TGK +    G    V 
Sbjct: 485 NVKTGACIRTQF-GHVEGVWDIAADNFRIVSGSHDRSCKVWDLQTGKCMHTFVGIHAPVA 543

Query: 347 TLYFDDRKLITGSLDKTIRVWNYIT 371
            +   D + ++G     ++++N+ T
Sbjct: 544 CVGIGDSEFVSGDELGCVKLYNFDT 568

>KLLA0F27511g 2546533..2548404 similar to sp|P39014 Saccharomyces
           cerevisiae YIL046w MET30 involved in regulation of
           sulfur assimilation genes and cell cycle progression,
           start by similarity
          Length = 623

 Score =  732 bits (1890), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 371/634 (58%), Positives = 440/634 (69%), Gaps = 72/634 (11%)

Query: 37  PPLKRLLITGSSD---DLAQGSSGKKKMTMATRSPSSSPDLATNDSGTRVQPLPEYNFTK 93
           P LKR      S+   D  Q + GK ++    R+ +S  +   N+       +P++NF K
Sbjct: 11  PDLKRKFEDVDSNGVSDQRQDTDGKGEIL---RNKASKVN-QNNEEIQLPSEMPQFNFFK 66

Query: 94  FCYRHNPDIQFSPTHTACYKQDLKRTQEINANIAKLPLQEQSDIHHIISKYSNSNDKIRK 153
           FCYRHNPDIQ +   +  ++  ++  + +    A     +++ I   +  + +SNDKIR+
Sbjct: 67  FCYRHNPDIQHTCKDSMVFQDQVRSEKWMEKMKALDKESDRAIIKQTLDNFQHSNDKIRR 126

Query: 154 LILDGILSTSCFPQLSYISSLVTHMIKIDFISILPQELSLKILSYLDCQSLCNATRVCRK 213
           L+L+GIL   CFPQLSYI+  V  +IKIDFIS LP+ELSLKIL YLDCQSLC A+  C++
Sbjct: 127 LMLEGILQLCCFPQLSYIADEVKQLIKIDFISTLPEELSLKILGYLDCQSLCIASLTCKR 186

Query: 214 WQKLADDDRVWYHMCEQHIDRKCPNCGWGLPLLHMKRARI---------QQNST------ 258
           W+ LADDDRVWYHMCEQHIDRKCPNCGWGLPLLHMKRAR           QN        
Sbjct: 187 WKTLADDDRVWYHMCEQHIDRKCPNCGWGLPLLHMKRARYLPVNEAHVHNQNGNQFQNVA 246

Query: 259 ----------------GSSSNADIQTQT------TRPWKVIYRERFKVESNWRKGHCRIQ 296
                           G+S N  +  +       TRPWKVIYRERF+VESNWR G CRIQ
Sbjct: 247 NGNGNEIGGGKSLINPGNSPNQTVAARARNSRYYTRPWKVIYRERFQVESNWRNGRCRIQ 306

Query: 297 EFKGHMDGVLTLQFNYRLLFTGSYDSTIGIWDLFTGKLIRRLSGHSDGVKTLYFDDRKLI 356
            FKGHMDGVL+L+FN+RLLFTGSYDST+ IWD  +G LIRRL+GH+DGVK +YFDD+K+I
Sbjct: 307 LFKGHMDGVLSLKFNHRLLFTGSYDSTVAIWDTKSGNLIRRLTGHTDGVKGIYFDDQKMI 366

Query: 357 TGSLDKTIRVWNYITGECISTYRGHSDSVLSVDSYQKVIVSGSADKTVKVWHVESRTCYT 416
           T SLDKTIRVWNYITG CISTYRGH DSVLSVDSY+K+IVS SADKTVKVWHVESRTCYT
Sbjct: 367 TASLDKTIRVWNYITGSCISTYRGHQDSVLSVDSYKKIIVSASADKTVKVWHVESRTCYT 426

Query: 417 LRGHTEWVNCVKLHPKSFSCFSCSDDTTIRMWDIRTNSCLKVFRGHVGQVQKIIPLTIKD 476
           LRGHTEWVNCVKLHPKSF+C+S SDD T+RMWDIRTNSC+KVFRGHVGQVQK+IPLTIKD
Sbjct: 427 LRGHTEWVNCVKLHPKSFTCYSSSDDKTLRMWDIRTNSCIKVFRGHVGQVQKVIPLTIKD 486

Query: 477 VENLATDNTSDG-SSPQDDPTMTDGADESDTPSNEQETVLDENIPYPTHLLSCGLDNTIK 535
            ENL  D   +   +P+ +    D              + D N+ YPTHLLSC LDNTIK
Sbjct: 487 TENLVVDEKIEKVPNPELEEDFADDC----------TGIFDPNLKYPTHLLSCSLDNTIK 536

Query: 536 LWDVKTGKCIRTQFGHVEGVWDIAADNFRIISGSHDGSIKVWDLQSGKCMHTFNGRRLQR 595
           LW+V +G+CIRTQFGHVEGVWDIAADNFRI+SGSHD SIKVWDLQ+GKC+ TF G +   
Sbjct: 537 LWEVSSGRCIRTQFGHVEGVWDIAADNFRIVSGSHDKSIKVWDLQNGKCIQTFTGHK--- 593

Query: 596 ETQHTQTQSLGDKVAPIACVCIGDSECFSGDEFG 629
                         API CV IGDS   SGDE G
Sbjct: 594 --------------APIVCVGIGDSSFVSGDELG 613

 Score = 75.1 bits (183), Expect = 6e-14,   Method: Compositional matrix adjust.
 Identities = 38/116 (32%), Positives = 64/116 (55%), Gaps = 1/116 (0%)

Query: 296 QEFKGHMDGVLTLQFNYRL-LFTGSYDSTIGIWDLFTGKLIRRLSGHSDGVKTLYFDDRK 354
           ++F     G+      Y   L + S D+TI +W++ +G+ IR   GH +GV  +  D+ +
Sbjct: 506 EDFADDCTGIFDPNLKYPTHLLSCSLDNTIKLWEVSSGRCIRTQFGHVEGVWDIAADNFR 565

Query: 355 LITGSLDKTIRVWNYITGECISTYRGHSDSVLSVDSYQKVIVSGSADKTVKVWHVE 410
           +++GS DK+I+VW+   G+CI T+ GH   ++ V       VSG     VK+WH +
Sbjct: 566 IVSGSHDKSIKVWDLQNGKCIQTFTGHKAPIVCVGIGDSSFVSGDELGEVKMWHFD 621

>CAGL0L02629g complement(307323..309710) similar to sp|P07834
           Saccharomyces cerevisiae YFL009w CDC4 cell division
           control, hypothetical start
          Length = 795

 Score =  123 bits (308), Expect = 5e-29,   Method: Compositional matrix adjust.
 Identities = 121/481 (25%), Positives = 190/481 (39%), Gaps = 143/481 (29%)

Query: 167 QLSYISSLVTHMIKIDFISILPQELSLKILSYLDCQSLCNATRVCRKWQKLADD-DRVWY 225
           +LS IS+L+   +K DF++ LP E++LKIL+ L  +S+ N  +V + W +L +    +W 
Sbjct: 244 ELSDISTLLRDNLKRDFVTSLPLEITLKILNKLPFESISNCLQVSKSWNRLINGTPALWK 303

Query: 226 HMC-------EQHIDRKCPNCGWGLPLLHMKRARIQQNSTGSSSNADIQTQTTRPWKVIY 278
           H+        +   D+K P               ++ N      + D +          Y
Sbjct: 304 HLLLSESFVSKDSFDKKYP---------------VENNKLDPPFDNDSR----------Y 338

Query: 279 RERF----KVESNWRKGHCRIQE--FKGHMDGVLT-LQFNYRLLFTGSYDSTIGIWDLFT 331
           R+ F     +  NW       Q    KGHM  V+T LQF    + TG+ D  I I+D  T
Sbjct: 339 RQDFLMNCSILQNWYNPDFIPQRTTLKGHMTSVVTCLQFEDNYVITGADDKMIRIYDSIT 398

Query: 332 GKLIRRLSGHSDGVKTL-YFDDRKLITGSLDKTIRVWNYITGECISTYRGHSDSVLSVDS 390
            K +  LSGH  GV  L Y  +  L++GS D+++R+WN   G+C   ++GH+ +V  +D 
Sbjct: 399 KKFLIELSGHDGGVWALKYAGNGILVSGSTDRSVRIWNIHLGKCTHVFKGHTSTVRCLDI 458

Query: 391 YQ----KVIVSGSADKTVKVW--------------------------HVESRTCY---TL 417
            +    K IV+GS D T+ +W                          H      Y    L
Sbjct: 459 VEHEGVKYIVTGSRDNTLHIWKLPQMSDSNIDEGMPNVYSNNGPLFFHSPEENPYFVGVL 518

Query: 418 RGHTEWVNCVKLHPKSFSCFSCSDDTTIRMWDIRTNSCLKVFRGHVGQVQKIIPLTIKDV 477
           RGH   V  V  H +     S S D  + +WDI    CL +  GH  ++      TI D 
Sbjct: 519 RGHIASVRTVSGHGR--IVISGSYDNNLIVWDIIQMKCLYILMGHTDRIYS----TIYDY 572

Query: 478 ENLATDNTSDGSSPQDDPTMTDGADESDTPSNEQETVLDENIPYPTHLLSCGLDNTIKLW 537
           +                                               +S  +D+TIK+W
Sbjct: 573 KR-------------------------------------------NRCISASMDSTIKIW 589

Query: 538 DVK----TGKCIR----------------TQFGHVEGVWDIAADNFRIISGSHDGSIKVW 577
           D++     G+C+                 T  GH   V  +   +  ++S + DGS++ W
Sbjct: 590 DLQNIWNNGECVNVTNATVPCTKITGPMMTLQGHTALVGLLKLSDKFLVSAAADGSLRGW 649

Query: 578 D 578
           D
Sbjct: 650 D 650

 Score = 70.9 bits (172), Expect = 2e-12,   Method: Compositional matrix adjust.
 Identities = 61/246 (24%), Positives = 107/246 (43%), Gaps = 32/246 (13%)

Query: 376 STYRGHSDSVLSVDSYQ-KVIVSGSADKTVKVW-HVESRTCYTLRGHTEWVNCVKLHPKS 433
           +T +GH  SV++   ++   +++G+ DK ++++  +  +    L GH   V  +K     
Sbjct: 362 TTLKGHMTSVVTCLQFEDNYVITGADDKMIRIYDSITKKFLIELSGHDGGVWALKYAGNG 421

Query: 434 FSCFSCSDDTTIRMWDIRTNSCLKVFRGHVGQVQKIIPLTIKDVENLATDNTSDGSSPQD 493
               S S D ++R+W+I    C  VF+GH   V+ +  +  + V+ + T +  +      
Sbjct: 422 I-LVSGSTDRSVRIWNIHLGKCTHVFKGHTSTVRCLDIVEHEGVKYIVTGSRDNTLHIWK 480

Query: 494 DPTMTDGADESDTP---SNEQETVL--DENIPYPTHLL------------------SCGL 530
            P M+D   +   P   SN         E  PY   +L                  S   
Sbjct: 481 LPQMSDSNIDEGMPNVYSNNGPLFFHSPEENPYFVGVLRGHIASVRTVSGHGRIVISGSY 540

Query: 531 DNTIKLWDVKTGKCIRTQFGHVEGVWDIAAD--NFRIISGSHDGSIKVWDLQ----SGKC 584
           DN + +WD+   KC+    GH + ++    D    R IS S D +IK+WDLQ    +G+C
Sbjct: 541 DNNLIVWDIIQMKCLYILMGHTDRIYSTIYDYKRNRCISASMDSTIKIWDLQNIWNNGEC 600

Query: 585 MHTFNG 590
           ++  N 
Sbjct: 601 VNVTNA 606

>YCR072C (YCR072C) [597] chr3 complement(240800..242347) Protein of
           unknown function, member of WD (WD-40) repeat family
           [1548 bp, 515 aa]
          Length = 515

 Score =  116 bits (290), Expect = 3e-27,   Method: Compositional matrix adjust.
 Identities = 107/369 (28%), Positives = 168/369 (45%), Gaps = 61/369 (16%)

Query: 279 RERFKVESNWRKGHCRIQEFKGHMDGVLTLQF---NYRLLFTGSYDSTIGIWDLFTGKLI 335
           R  FKV+   R          GH   +L   F       + TG+ D+T  IWD  T   +
Sbjct: 124 RAVFKVKPVTRSS----SAIAGHGSTILCSAFAPHTSSRMVTGAGDNTARIWDCDTQTPM 179

Query: 336 RRLSGHSDGVKTLYF--DDRKLITGSLDKTIRVWNYITGECIS-TYRGHSDSVLSVDSYQ 392
             L GH + V  + +  D   + TGS+D TIR+W+  +G+C+    RGHS  + S+ S++
Sbjct: 180 HTLKGHYNWVLCVSWSPDGEVIATGSMDNTIRLWDPKSGQCLGDALRGHSKWITSL-SWE 238

Query: 393 KV----------IVSGSADKTVKVWHVESRTC-YTLRGHTEWVNCVKLHPKSFSCFSCSD 441
            +          + S S D T+K+W   SR C YT+ GHT  V+CVK   +    +S S 
Sbjct: 239 PIHLVKPGSKPRLASSSKDGTIKIWDTVSRVCQYTMSGHTNSVSCVKWGGQGL-LYSGSH 297

Query: 442 DTTIRMWDIRTNS-CLKVFRGHVGQVQKII------------------PLTIKDVENLAT 482
           D T+R+WDI +   C+ + + H   V  +                   P T ++ +  A 
Sbjct: 298 DRTVRVWDINSQGRCINILKSHAHWVNHLSLSTDYALRIGAFDHTGKKPSTPEEAQKKAL 357

Query: 483 DN-----TSDGSSPQ------DDPTMTDGADESDTPSNEQETVLDENI------PYPTHL 525
           +N       +G+S +      DD TM        T    + T   + +      P   ++
Sbjct: 358 ENYEKICKKNGNSEEMMVTASDDYTMFLWNPLKSTKPIARMTGHQKLVNHVAFSPDGRYI 417

Query: 526 LSCGLDNTIKLWDVKTGKCIRTQFGHVEGVWDIA--ADNFRIISGSHDGSIKVWDLQSGK 583
           +S   DN+IKLWD + GK I T  GHV  V+ +A  +D   ++S S D ++KVWD+++ K
Sbjct: 418 VSASFDNSIKLWDGRDGKFISTFRGHVASVYQVAWSSDCRLLVSCSKDTTLKVWDVRTRK 477

Query: 584 CMHTFNGRR 592
                 G +
Sbjct: 478 LSVDLPGHK 486

 Score = 69.7 bits (169), Expect = 2e-12,   Method: Compositional matrix adjust.
 Identities = 79/345 (22%), Positives = 131/345 (37%), Gaps = 103/345 (29%)

Query: 289 RKGHCRIQEFKGHMDGVLTLQF---------NYRLLFTGSYDSTIGIWDLFTGKLIRRLS 339
           + G C     +GH   + +L +         +   L + S D TI IWD  +      +S
Sbjct: 216 KSGQCLGDALRGHSKWITSLSWEPIHLVKPGSKPRLASSSKDGTIKIWDTVSRVCQYTMS 275

Query: 340 GHSDGVKTLYFDDRKLI-TGSLDKTIRVWNYIT-GECISTYRGHSDSV----LSVD---- 389
           GH++ V  + +  + L+ +GS D+T+RVW+  + G CI+  + H+  V    LS D    
Sbjct: 276 GHTNSVSCVKWGGQGLLYSGSHDRTVRVWDINSQGRCINILKSHAHWVNHLSLSTDYALR 335

Query: 390 -----------------------SYQKV----------IVSGSADKTVKVWHV--ESRTC 414
                                  +Y+K+          +V+ S D T+ +W+    ++  
Sbjct: 336 IGAFDHTGKKPSTPEEAQKKALENYEKICKKNGNSEEMMVTASDDYTMFLWNPLKSTKPI 395

Query: 415 YTLRGHTEWVNCVKLHPKSFSCFSCSDDTTIRMWDIRTNSCLKVFRGHVGQVQKIIPLTI 474
             + GH + VN V   P      S S D +I++WD R    +  FR   G V  +  +  
Sbjct: 396 ARMTGHQKLVNHVAFSPDGRYIVSASFDNSIKLWDGRDGKFISTFR---GHVASVYQVAW 452

Query: 475 KDVENLATDNTSDGSSPQDDPTMTDGADESDTPSNEQETVLDENIPYPTHLLSCGLDNTI 534
                L                                            L+SC  D T+
Sbjct: 453 SSDCRL--------------------------------------------LVSCSKDTTL 468

Query: 535 KLWDVKTGKCIRTQFGHVEGVW--DIAADNFRIISGSHDGSIKVW 577
           K+WDV+T K      GH + V+  D + D  R+ SG  D  +++W
Sbjct: 469 KVWDVRTRKLSVDLPGHKDEVYTVDWSVDGKRVCSGGKDKMVRLW 513

 Score = 50.8 bits (120), Expect = 2e-06,   Method: Compositional matrix adjust.
 Identities = 28/79 (35%), Positives = 47/79 (59%), Gaps = 4/79 (5%)

Query: 295 IQEFKGHMDGVLTLQFNY--RLLFTGSYDSTIGIWDLFTGKLIRRLSGHSDGVKTLYF-- 350
           I  F+GH+  V  + ++   RLL + S D+T+ +WD+ T KL   L GH D V T+ +  
Sbjct: 437 ISTFRGHVASVYQVAWSSDCRLLVSCSKDTTLKVWDVRTRKLSVDLPGHKDEVYTVDWSV 496

Query: 351 DDRKLITGSLDKTIRVWNY 369
           D +++ +G  DK +R+W +
Sbjct: 497 DGKRVCSGGKDKMVRLWTH 515

>Kwal_23.5035
          Length = 744

 Score =  115 bits (289), Expect = 1e-26,   Method: Compositional matrix adjust.
 Identities = 129/512 (25%), Positives = 214/512 (41%), Gaps = 92/512 (17%)

Query: 147 SNDKIRKLILDGILSTSCFPQLSYISSLVTHMIKIDFISILPQELSLKILSYLDCQSLCN 206
           S+   R L+   ++S     +LS + +LV   +K DFI+ LP E+S+ IL+ L  + +  
Sbjct: 227 SDSAYRNLVFQ-LISKLSRSELSDLGTLVKDNLKRDFITSLPLEVSMNILTNLGFEDISR 285

Query: 207 ATRVCRKWQKLA-DDDRVWYHMC--EQHIDRKCPNCGWGLPLLHMKRARIQQNSTGS--S 261
              V + W  L  D   +W  +   E  I          +   H      QQ ++G    
Sbjct: 286 CLSVSKAWNSLIRDTSYLWRTLLVTENFIT---------VEEYHKYSQGPQQLNSGHLHE 336

Query: 262 SNADIQTQTTRPW-KVIYRERFKVESNWRKGHCRIQEFKGHMDGVLTLQFNYRLLFTGSY 320
               +     R + K  Y  +FK      +GH         M  V  LQF    + TG+ 
Sbjct: 337 DFFRLHFMENRAYLKNWYDSKFKPHRTTLRGHT--------MKIVTCLQFEDDYVITGAD 388

Query: 321 DSTIGIWDLFTGKLIRRLSGHSDGVKTL-YFDDRKLITGSLDKTIRVWNYITGECISTYR 379
           D  I ++D  T K I +LSGH  GV  L Y  D  L++GS D+++RVWN  +G+C   ++
Sbjct: 389 DKMIRVYDAKTEKFITQLSGHDGGVWALKYGHDGILVSGSTDRSVRVWNIKSGKCTHVFK 448

Query: 380 GHSDSVLSVD----SYQKVIVSGSADKTVKVWHVES--------RTCY------------ 415
           GH+ +V  +D    + +K IV+GS D T+ VW + +          C             
Sbjct: 449 GHTSTVRCLDIVEHNGKKFIVTGSRDHTLHVWKLPNCNAEDYNPEVCEVFNTTDANPYFV 508

Query: 416 -TLRGHTEWVNCVKLHPKSFSCFSCSDDTTIRMWDIRTNSCLKVFRGHVGQVQKII---- 470
             LRGH   V  V  H       S S D  + +WDI    CL V  GH  ++   I    
Sbjct: 509 GVLRGHMAAVRTVSGHGN--IVVSGSYDFNLMVWDIAQMKCLYVLTGHTDRIYSTIYDYQ 566

Query: 471 -----------PLTIKDVENLATDNTSDGSSPQDDP-TMTDGADESDTPSNEQETVLDEN 518
                       + + D+ +++ +      +  ++P T   G+  +         +L  +
Sbjct: 567 RNRCISAGMDSTVKVWDLADVSKNGPCTTITSSNNPCTKVTGSSITLQGHTALVGLLGLS 626

Query: 519 IPYPTHLLSCGLDNTIKLWDVKTGKCIRTQFGH----VEGVWDIAADNFRIISGSHDGSI 574
             +   L+S G D  ++ WD +       QF +    +  +     ++  ++SGS +G+ 
Sbjct: 627 DKF---LVSAGADGILRGWDSEN---YTRQFAYHHKDLSAITTFYVNDNILVSGS-EGNF 679

Query: 575 KVWDLQSGKCMHT-------------FNGRRL 593
            +++L+SGK +H+             FN RRL
Sbjct: 680 NIYNLRSGKLIHSYILSDADQIWSVKFNNRRL 711

>YFL009W (CDC4) [1673] chr6 (116139..118478) F-box protein and
           component of the SCF-Cdc4p complex
           (Skp1p-Cdc53p-Cdc34p-Cdc4p) which targets Sic1p, Far1p,
           Cdc6p, Ctf13p and Gcn4p for ubiquitin-dependent
           degradation, has WD (WD-40) repeats [2340 bp, 779 aa]
          Length = 779

 Score =  114 bits (286), Expect = 3e-26,   Method: Compositional matrix adjust.
 Identities = 97/340 (28%), Positives = 146/340 (42%), Gaps = 56/340 (16%)

Query: 167 QLSYISSLVTHMIKIDFISILPQELSLKILSYLDCQSLCNATRVCRKWQKLA-DDDRVWY 225
           +LS + +L+   +K D I+ LP E+SLKI +YL  + + N+  V + W K+      +W 
Sbjct: 258 ELSDLGTLIKDNLKRDLITSLPFEISLKIFNYLQFEDIINSLGVSQNWNKIIRKSTSLWK 317

Query: 226 HMC--EQHIDRKCPNCGWGLPL-LHMKRARIQQNSTGSSSNADIQTQTTRPWKVIYRERF 282
            +   E  +  K  N    L L L  K  ++ Q                   ++ + E  
Sbjct: 318 KLLISENFVSPKGFNS---LNLKLSQKYPKLSQQDR---------------LRLSFLENI 359

Query: 283 KVESNWRKGHCRIQE--FKGHMDGVLT-LQFNYRLLFTGSYDSTIGIWDLFTGKLIRRLS 339
            +  NW       Q    +GHM  V+T LQF    + TG+ D  I ++D    K + +LS
Sbjct: 360 FILKNWYNPKFVPQRTTLRGHMTSVITCLQFEDNYVITGADDKMIRVYDSINKKFLLQLS 419

Query: 340 GHSDGVKTL-YFDDRKLITGSLDKTIRVWNYITGECISTYRGHSDSVLSVDSYQ----KV 394
           GH  GV  L Y     L++GS D+T+RVW+   G C   ++GH+ +V  +D  +    K 
Sbjct: 420 GHDGGVWALKYAHGGILVSGSTDRTVRVWDIKKGCCTHVFKGHNSTVRCLDIVEYKNIKY 479

Query: 395 IVSGSADKTVKVW---------------------HVESRTCY---TLRGHTEWVNCVKLH 430
           IV+GS D T+ VW                     H      Y    LRGH   V  V  H
Sbjct: 480 IVTGSRDNTLHVWKLPKESSVPDHGEEHDYPLVFHTPEENPYFVGVLRGHMASVRTVSGH 539

Query: 431 PKSFSCFSCSDDTTIRMWDIRTNSCLKVFRGHVGQVQKII 470
                  S S D T+ +WD+    CL +  GH  ++   I
Sbjct: 540 GN--IVVSGSYDNTLIVWDVAQMKCLYILSGHTDRIYSTI 577

 Score = 78.6 bits (192), Expect = 7e-15,   Method: Compositional matrix adjust.
 Identities = 67/243 (27%), Positives = 114/243 (46%), Gaps = 33/243 (13%)

Query: 376 STYRGHSDSVLSVDSYQ-KVIVSGSADKTVKVW-HVESRTCYTLRGHTEWVNCVKLHPKS 433
           +T RGH  SV++   ++   +++G+ DK ++V+  +  +    L GH   V  +K +   
Sbjct: 375 TTLRGHMTSVITCLQFEDNYVITGADDKMIRVYDSINKKFLLQLSGHDGGVWALK-YAHG 433

Query: 434 FSCFSCSDDTTIRMWDIRTNSCLKVFRGHVGQVQKIIPLTIKDVENLAT---DNTSDGSS 490
               S S D T+R+WDI+   C  VF+GH   V+ +  +  K+++ + T   DNT     
Sbjct: 434 GILVSGSTDRTVRVWDIKKGCCTHVFKGHNSTVRCLDIVEYKNIKYIVTGSRDNTLHVWK 493

Query: 491 PQDDPTMTDGADESDTPSNEQETVLDENIPYPTHLL------------------SCGLDN 532
              + ++ D  +E D P        +EN PY   +L                  S   DN
Sbjct: 494 LPKESSVPDHGEEHDYPLVFHTP--EEN-PYFVGVLRGHMASVRTVSGHGNIVVSGSYDN 550

Query: 533 TIKLWDVKTGKCIRTQFGHVEGVWDIAADNF--RIISGSHDGSIKVWDLQ----SGKCMH 586
           T+ +WDV   KC+    GH + ++    D+   R IS S D +I++WDL+    +G+C +
Sbjct: 551 TLIVWDVAQMKCLYILSGHTDRIYSTIYDHERKRCISASMDTTIRIWDLENIWNNGECSY 610

Query: 587 TFN 589
             N
Sbjct: 611 ATN 613

 Score = 69.7 bits (169), Expect = 4e-12,   Method: Compositional matrix adjust.
 Identities = 57/185 (30%), Positives = 87/185 (47%), Gaps = 33/185 (17%)

Query: 298 FKGHMDGVLTLQFNYRLLFTGSYDSTIGIWDLFTGKLIRRLSGHSDGV-KTLYFDDRK-L 355
            +GHM  V T+  +  ++ +GSYD+T+ +WD+   K +  LSGH+D +  T+Y  +RK  
Sbjct: 526 LRGHMASVRTVSGHGNIVVSGSYDNTLIVWDVAQMKCLYILSGHTDRIYSTIYDHERKRC 585

Query: 356 ITGSLDKTIRVWN----YITGECISTYRGHSDSVLSVDSYQKVIVSGSADKTVKVWHVES 411
           I+ S+D TIR+W+    +  GEC               SY     + SA    K+     
Sbjct: 586 ISASMDTTIRIWDLENIWNNGEC---------------SY----ATNSASPCAKIL---- 622

Query: 412 RTCYTLRGHTEWVNCVKLHPKSFSCFSCSDDTTIRMWDIRTNSCLKVFRGHVGQVQKIIP 471
              YTL+GHT  V  ++L  K     S + D +IR WD   N   + F  H   +  I  
Sbjct: 623 GAMYTLQGHTALVGLLRLSDKFL--VSAAADGSIRGWD--ANDYSRKFSYHHTNLSAITT 678

Query: 472 LTIKD 476
             + D
Sbjct: 679 FYVSD 683

 Score = 45.1 bits (105), Expect = 1e-04,   Method: Compositional matrix adjust.
 Identities = 22/68 (32%), Positives = 38/68 (55%), Gaps = 1/68 (1%)

Query: 524 HLLSCGLDNTIKLWDVKTGKCIRTQFGHVEGVWDIA-ADNFRIISGSHDGSIKVWDLQSG 582
           ++++   D  I+++D    K +    GH  GVW +  A    ++SGS D +++VWD++ G
Sbjct: 394 YVITGADDKMIRVYDSINKKFLLQLSGHDGGVWALKYAHGGILVSGSTDRTVRVWDIKKG 453

Query: 583 KCMHTFNG 590
            C H F G
Sbjct: 454 CCTHVFKG 461

>KLLA0D07546g complement(647984..649927) some similarities with
           sp|P07834 Saccharomyces cerevisiae YFL009w CDC4 cell
           division control protein, hypothetical start
          Length = 647

 Score =  112 bits (279), Expect = 1e-25,   Method: Compositional matrix adjust.
 Identities = 148/616 (24%), Positives = 249/616 (40%), Gaps = 139/616 (22%)

Query: 70  SSPDLATNDSGTRVQPLPEYNFTKFCYRHNPDIQFSPTHTACYKQDLKRT---QEINANI 126
           SSP+L  +  G    PLP                 SP  + C+  +++     + I   +
Sbjct: 68  SSPNLIEDQDG----PLP----------------ISPIASPCHTPEVEEPSIDEVIGTTV 107

Query: 127 AKLPLQEQSDIHHIISKYSNSNDKIRKLILDGILSTSCFPQLSYISSLVTHMIKIDFISI 186
           A+L            S  ++  + +  LI  G++S     QLS + S++T  +K D    
Sbjct: 108 ARL------------SSTTSHPNALTSLIF-GLVSNMDRTQLSDLVSIITDNLKRDLFQS 154

Query: 187 LPQELSLKILSYLDCQSLCNATRVCRKWQKLADDDRV---WYHMCEQHI-DRKCPNCGWG 242
           LP E+++KIL  L  + +     V R W +L ++  V   W  + E  + + + P+    
Sbjct: 155 LPNEITVKILLNLSSEDIFACLLVNRNWNRLIEEAPVVWKWLMLNEGFVTEDQFPSYCNS 214

Query: 243 LPLLHMKRARIQQNSTGSSSNADIQTQTTRPWKVIYRERFKV---ESNWRKGHCRIQEFK 299
           LP  +               N D              +RF++   E+NW   +     +K
Sbjct: 215 LPSKYKHLI-----------NPD--------------DRFRLDFLENNWCLQNWYDPNYK 249

Query: 300 -------GHMDGVLT-LQFNYRLLFTGSYDSTIGIWDLFTGKLIRRLSGHSDGVKTLYFD 351
                  GH   V+T LQF    + TG+ D  I ++D      +  L+GH  GV  L F 
Sbjct: 250 PGRTCLDGHSTNVVTCLQFENNYIITGADDKKINVYDAENDLFLLELNGHEGGVWALKFV 309

Query: 352 DRK-LITGSLDKTIRVWNYITGECISTYRGHSDSV--LSVDSY--QKVIVSGSADKTVKV 406
           D K L++GS D+++R+WN  TG+C   ++GH+ +V  L V  Y   K IV+GS D T+ V
Sbjct: 310 DGKILVSGSTDRSVRIWNIETGKCTHVFKGHTSTVRCLEVVEYGDSKYIVTGSRDNTLHV 369

Query: 407 WHV-------------------ESRTCY--TLRGHTEWVNCVKLHPKSFSCFSCSDDTTI 445
           W +                   E    +   LRGH   V  V  H +     S S D  +
Sbjct: 370 WKLPPMKELDKGSQEPIFYRTPEENPYFVGVLRGHMSSVRTVSGHGR--IVISGSYDHNL 427

Query: 446 RMWDIRTNSCLKVFRGHVGQVQKII---------------PLTIKDVENLATDNTSDGSS 490
            +WDI +   L +  GH  +V   I                + I D+EN+  + T+    
Sbjct: 428 MVWDIISMKLLYILTGHTDRVYSTIYDYKRNRCISASMDTTVMIWDLENIENNGTTT--- 484

Query: 491 PQDDPTMTDGADESDTPSNE----QETVLDENIPYPTHLLSCGLDNTIKLWDVKTGKCIR 546
                T+ DGA      S +       ++         L+S   D +I+ WD       +
Sbjct: 485 -----TINDGASIKVVGSMKCLYGHTALVGLLCLSNKFLVSAAADGSIRGWD-PNDYSRK 538

Query: 547 TQFGH--VEGVWDIAADNFRIISGSHDGSIKVWDLQSGKCMHTFNGRRLQRETQHTQTQS 604
             F H  +  +   + ++  ++SGS +    V++L++GK +H    R+L  +++      
Sbjct: 539 FSFHHTNLAAITSFSMNDNILVSGS-ERQFNVYNLRTGKLIH----RKLLTDSEQVWGIK 593

Query: 605 LGDKVAPIACVCIGDS 620
           L ++    A   +G S
Sbjct: 594 LNNRKLVAAIESVGHS 609

>Scas_707.22
          Length = 730

 Score =  110 bits (276), Expect = 4e-25,   Method: Compositional matrix adjust.
 Identities = 93/339 (27%), Positives = 150/339 (44%), Gaps = 53/339 (15%)

Query: 159 ILSTSCFPQLSYISSLVTHMIKIDFISILPQELSLKILSYLDCQSLCNATRVCRKWQKLA 218
           ILS      LS ++S++   +K D +S LP E++LKI  +L    + N   VC  W  + 
Sbjct: 234 ILSNLNRTALSDLNSVLNGNLKRDIVSSLPIEIALKIFQHLSYDDIFNCQSVCSNWNAII 293

Query: 219 DDDRVWYHMCEQHIDRKCPNCGWGLPLLHMKRARIQQNSTGSSSNADIQTQTTRPWKVIY 278
           +                        PLL  K   I ++   +   A+   +++  +K  +
Sbjct: 294 NTT----------------------PLL-WKNLLISESFVSAQEVANNNNKSSF-FKEKF 329

Query: 279 RERFKVESNWRKGHCRIQE--FKGHMDGVLT-LQFNYRLLFTGSYDSTIGIWDLFTGKLI 335
            E  ++  NW     + +     GH   V+T LQF    + TG+ D  + I+D  + K +
Sbjct: 330 IESLRILQNWYNPSFKPERTTLTGHATSVVTCLQFEDDYVITGADDRQLRIYDARSKKFL 389

Query: 336 RRLSGHSDGVKTLYFD-DRKLITGSLDKTIRVWNYITGECISTYRGHSDSV--LSVDSYQ 392
           + LSGH  GV  L +D D  +++GS D+++R+W+   G C   ++GH+ +V  L + +Y+
Sbjct: 390 KELSGHEGGVWALKYDADGIIVSGSTDRSVRIWDIKRGCCTHVFKGHTSTVRCLEIVTYK 449

Query: 393 --KVIVSGSADKTVKVWHV--------ESRTCY-----------TLRGHTEWVNCVKLHP 431
             K IV+GS D T+ VW +        E    Y            LRGH   V  +  H 
Sbjct: 450 NMKYIVTGSRDNTLHVWKLIKEEKFDGELPMVYNTPEENPYFVGVLRGHMASVRTISGHG 509

Query: 432 KSFSCFSCSDDTTIRMWDIRTNSCLKVFRGHVGQVQKII 470
                 S S D  + +WDI    CL V  GH  ++   I
Sbjct: 510 N--IVISGSYDNNLMVWDIAQMKCLYVLIGHTDRIYSTI 546

 Score = 70.1 bits (170), Expect = 3e-12,   Method: Compositional matrix adjust.
 Identities = 61/237 (25%), Positives = 109/237 (45%), Gaps = 36/237 (15%)

Query: 376 STYRGHSDSVLSVDSYQK-VIVSGSADKTVKVWHVESRTCYT-LRGHTEWVNCVKLHPKS 433
           +T  GH+ SV++   ++   +++G+ D+ ++++   S+     L GH   V  +K     
Sbjct: 349 TTLTGHATSVVTCLQFEDDYVITGADDRQLRIYDARSKKFLKELSGHEGGVWALKYDADG 408

Query: 434 FSCFSCSDDTTIRMWDIRTNSCLKVFRGHVGQVQKIIPLTIKDVENLAT---DNT----- 485
               S S D ++R+WDI+   C  VF+GH   V+ +  +T K+++ + T   DNT     
Sbjct: 409 I-IVSGSTDRSVRIWDIKRGCCTHVFKGHTSTVRCLEIVTYKNMKYIVTGSRDNTLHVWK 467

Query: 486 ------SDG------SSPQDDPTMTDGADESDTPSNEQETVLDENIPYPTHLLSCGLDNT 533
                  DG      ++P+++P    G       S    +       +   ++S   DN 
Sbjct: 468 LIKEEKFDGELPMVYNTPEENPYFV-GVLRGHMASVRTIS------GHGNIVISGSYDNN 520

Query: 534 IKLWDVKTGKCIRTQFGHVEGVWDIAADNF--RIISGSHDGSIKVWDL----QSGKC 584
           + +WD+   KC+    GH + ++    D+   R IS S D +IKVWDL     +G C
Sbjct: 521 LMVWDIAQMKCLYVLIGHTDRIYSTIYDHKRQRCISASMDSTIKVWDLDNIWNNGNC 577

 Score = 68.9 bits (167), Expect = 7e-12,   Method: Compositional matrix adjust.
 Identities = 59/230 (25%), Positives = 101/230 (43%), Gaps = 44/230 (19%)

Query: 258 TGSSSNADIQTQTTRPWKVIYRERFK-----VESNWRKGHCRIQEFKGHMDGVLTLQFNY 312
           TGS  N      T   WK+I  E+F      V +   +    +   +GHM  V T+  + 
Sbjct: 456 TGSRDN------TLHVWKLIKEEKFDGELPMVYNTPEENPYFVGVLRGHMASVRTISGHG 509

Query: 313 RLLFTGSYDSTIGIWDLFTGKLIRRLSGHSDGVKTLYFDDR--KLITGSLDKTIRVWN-- 368
            ++ +GSYD+ + +WD+   K +  L GH+D + +  +D +  + I+ S+D TI+VW+  
Sbjct: 510 NIVISGSYDNNLMVWDIAQMKCLYVLIGHTDRIYSTIYDHKRQRCISASMDSTIKVWDLD 569

Query: 369 --YITGECISTYRGHSDSVLSVDSYQKVIVSGSADKTVKVWHVESRTCYTLRGHTEWVNC 426
             +  G C                    I++ SA    K+    + +  TL+GHT  V  
Sbjct: 570 NIWNNGNC-------------------TIITNSATPCTKI----TGSMLTLQGHTALVGL 606

Query: 427 VKLHPKSFSCFSCSDDTTIRMWDIRTNSCLKVFRGHVGQVQKIIPLTIKD 476
           ++L  K     S + D ++R WD  +N   + F  H   +  I    + D
Sbjct: 607 LRLSDKYL--VSAAADGSLRGWD--SNDYSRKFSYHHNNLSAITTFYMND 652

 Score = 51.6 bits (122), Expect = 1e-06,   Method: Compositional matrix adjust.
 Identities = 22/68 (32%), Positives = 42/68 (61%), Gaps = 1/68 (1%)

Query: 524 HLLSCGLDNTIKLWDVKTGKCIRTQFGHVEGVWDIAAD-NFRIISGSHDGSIKVWDLQSG 582
           ++++   D  ++++D ++ K ++   GH  GVW +  D +  I+SGS D S+++WD++ G
Sbjct: 368 YVITGADDRQLRIYDARSKKFLKELSGHEGGVWALKYDADGIIVSGSTDRSVRIWDIKRG 427

Query: 583 KCMHTFNG 590
            C H F G
Sbjct: 428 CCTHVFKG 435

>Scas_720.95
          Length = 515

 Score =  108 bits (269), Expect = 1e-24,   Method: Compositional matrix adjust.
 Identities = 98/338 (28%), Positives = 157/338 (46%), Gaps = 37/338 (10%)

Query: 276 VIYRER--FKVESNWRKGHCRIQEFKGHMDGVLTLQFNYRL---LFTGSYDSTIGIWDLF 330
           +IY  R  FKV+   R          GH   +L   F       + TG+ D+T  IWD  
Sbjct: 119 LIYTPRAVFKVKPVTRSS----SAIAGHGSTILCSAFAPNTSSRMVTGAGDNTARIWDCD 174

Query: 331 TGKLIRRLSGHSDGVKTLYF--DDRKLITGSLDKTIRVWNYITGECIS-TYRGHSDSVLS 387
           T      L+GH + V  + +  +   + TGS+D TIR+W+   G+ +    RGH   + S
Sbjct: 175 TQTPKATLTGHFNWVLCVSYCPNGEVIATGSMDNTIRLWDSKDGKPLGDALRGHLKWITS 234

Query: 388 VDSYQKV----------IVSGSADKTVKVWHVESRTC-YTLRGHTEWVNCVKLHPKSFSC 436
           + +++ +          + S S D T+++W +  R C YT+ GHT  V+C+K   +    
Sbjct: 235 L-AWEPIHLVKPGESPRLASASKDGTIRIWDITRRVCLYTMSGHTNSVSCIKWSGQGI-I 292

Query: 437 FSCSDDTTIRMWDIRTNS-CLKVFRGHVGQVQKIIPLTIKDVENLATDNTSDGSSPQDDP 495
           +S S D T+R+WD+  +  C+ + + H   V  +   T   +   A D+T  G+ P    
Sbjct: 293 YSGSHDKTVRVWDMNADGKCINILKSHAHWVNHLSLSTDYALRVGAFDHT--GAQP---- 346

Query: 496 TMTDGADESDTPSNEQETVLDENIPYPTHLLSCGLDNTIKLWD-VKTGKCIRTQFGHVEG 554
                 D  D      E V+ +N      +++   D T+ LW+ +K+ K I    GH + 
Sbjct: 347 --ASAKDARDKALANYEKVVKKNGKLEELMVTASDDFTMFLWNPLKSNKPIARMTGHQKL 404

Query: 555 VWDIA--ADNFRIISGSHDGSIKVWDLQSGKCMHTFNG 590
           V  +A   D   I+S S D SIK+WD + GK + TF G
Sbjct: 405 VNHVAFSPDGRYIVSASFDNSIKLWDGRDGKFISTFRG 442

 Score = 86.7 bits (213), Expect = 1e-17,   Method: Compositional matrix adjust.
 Identities = 89/341 (26%), Positives = 142/341 (41%), Gaps = 70/341 (20%)

Query: 298 FKGHMDGVLTLQF--NYRLLFTGSYDSTIGIWDLFTGK-LIRRLSGHSDGVKTLYFD--- 351
             GH + VL + +  N  ++ TGS D+TI +WD   GK L   L GH   + +L ++   
Sbjct: 182 LTGHFNWVLCVSYCPNGEVIATGSMDNTIRLWDSKDGKPLGDALRGHLKWITSLAWEPIH 241

Query: 352 ------DRKLITGSLDKTIRVWNYITGECISTYRGHSDSVLSVD-SYQKVIVSGSADKTV 404
                   +L + S D TIR+W+     C+ T  GH++SV  +  S Q +I SGS DKTV
Sbjct: 242 LVKPGESPRLASASKDGTIRIWDITRRVCLYTMSGHTNSVSCIKWSGQGIIYSGSHDKTV 301

Query: 405 KVW--HVESRTCYTLRGHTEWVNCVKL----------------HPKSFS----------- 435
           +VW  + + +    L+ H  WVN + L                 P S             
Sbjct: 302 RVWDMNADGKCINILKSHAHWVNHLSLSTDYALRVGAFDHTGAQPASAKDARDKALANYE 361

Query: 436 ------------CFSCSDDTTIRMWD-IRTNSCLKVFRGHVGQVQKIIPLTIKDVENLAT 482
                         + SDD T+ +W+ +++N  +    GH   V  +           + 
Sbjct: 362 KVVKKNGKLEELMVTASDDFTMFLWNPLKSNKPIARMTGHQKLVNHVA---------FSP 412

Query: 483 DNTSDGSSPQDDPT-MTDGADESDTPSNEQETVLDENIPYPTH---LLSCGLDNTIKLWD 538
           D     S+  D+   + DG D     +          + +      L+SC  D T+K+WD
Sbjct: 413 DGRYIVSASFDNSIKLWDGRDGKFISTFRGHVASVYQVAWSADCRLLVSCSKDTTLKVWD 472

Query: 539 VKTGKCIRTQFGHVEGVW--DIAADNFRIISGSHDGSIKVW 577
           V+T K      GH + V+  D + D  R+ SG  D  +++W
Sbjct: 473 VRTRKLSVDLPGHKDEVYTVDWSVDGKRVCSGGKDKMVRIW 513

 Score = 57.4 bits (137), Expect = 2e-08,   Method: Compositional matrix adjust.
 Identities = 40/124 (32%), Positives = 61/124 (49%), Gaps = 6/124 (4%)

Query: 290 KGHCRIQEFKGHMDGVLTLQF--NYRLLFTGSYDSTIGIWDLFTGKLIRRLSGHSDGVKT 347
           K +  I    GH   V  + F  + R + + S+D++I +WD   GK I    GH   V  
Sbjct: 390 KSNKPIARMTGHQKLVNHVAFSPDGRYIVSASFDNSIKLWDGRDGKFISTFRGHVASVYQ 449

Query: 348 LYF--DDRKLITGSLDKTIRVWNYITGECISTYRGHSDSVLSVDSY--QKVIVSGSADKT 403
           + +  D R L++ S D T++VW+  T +      GH D V +VD     K + SG  DK 
Sbjct: 450 VAWSADCRLLVSCSKDTTLKVWDVRTRKLSVDLPGHKDEVYTVDWSVDGKRVCSGGKDKM 509

Query: 404 VKVW 407
           V++W
Sbjct: 510 VRIW 513

 Score = 57.0 bits (136), Expect = 3e-08,   Method: Compositional matrix adjust.
 Identities = 54/222 (24%), Positives = 93/222 (41%), Gaps = 47/222 (21%)

Query: 295 IQEFKGHMDGVLTLQFNYR-LLFTGSYDSTIGIWDLFT-GKLIRRLSGHSDGVKTL---- 348
           +    GH + V  ++++ + ++++GS+D T+ +WD+   GK I  L  H+  V  L    
Sbjct: 271 LYTMSGHTNSVSCIKWSGQGIIYSGSHDKTVRVWDMNADGKCINILKSHAHWVNHLSLST 330

Query: 349 -------YFD------------------------------DRKLITGSLDKTIRVWNYI- 370
                   FD                              +  ++T S D T+ +WN + 
Sbjct: 331 DYALRVGAFDHTGAQPASAKDARDKALANYEKVVKKNGKLEELMVTASDDFTMFLWNPLK 390

Query: 371 TGECISTYRGHSDSV--LSVDSYQKVIVSGSADKTVKVWH-VESRTCYTLRGHTEWVNCV 427
           + + I+   GH   V  ++     + IVS S D ++K+W   + +   T RGH   V  V
Sbjct: 391 SNKPIARMTGHQKLVNHVAFSPDGRYIVSASFDNSIKLWDGRDGKFISTFRGHVASVYQV 450

Query: 428 KLHPKSFSCFSCSDDTTIRMWDIRTNSCLKVFRGHVGQVQKI 469
                     SCS DTT+++WD+RT        GH  +V  +
Sbjct: 451 AWSADCRLLVSCSKDTTLKVWDVRTRKLSVDLPGHKDEVYTV 492

 Score = 51.6 bits (122), Expect = 1e-06,   Method: Compositional matrix adjust.
 Identities = 28/79 (35%), Positives = 47/79 (59%), Gaps = 4/79 (5%)

Query: 295 IQEFKGHMDGVLTLQFNY--RLLFTGSYDSTIGIWDLFTGKLIRRLSGHSDGVKTLYF-- 350
           I  F+GH+  V  + ++   RLL + S D+T+ +WD+ T KL   L GH D V T+ +  
Sbjct: 437 ISTFRGHVASVYQVAWSADCRLLVSCSKDTTLKVWDVRTRKLSVDLPGHKDEVYTVDWSV 496

Query: 351 DDRKLITGSLDKTIRVWNY 369
           D +++ +G  DK +R+W +
Sbjct: 497 DGKRVCSGGKDKMVRIWTH 515

>CAGL0H03729g 342948..343859 highly similar to sp|P41318
           Saccharomyces cerevisiae YNL006w LST8, start by
           similarity
          Length = 303

 Score =  103 bits (258), Expect = 3e-24,   Method: Compositional matrix adjust.
 Identities = 80/295 (27%), Positives = 131/295 (44%), Gaps = 26/295 (8%)

Query: 314 LLFTGSYDSTIGIWDLFTGKLIRRLSGHSDGVKTLYF-DDRKLITGSLDKTIRVWNYITG 372
           LL +  YD TI  W+  TG  +R +      V  L   +D+KL+  +  + IR+++  T 
Sbjct: 4   LLVSAGYDHTIRFWEALTGVCLRTIQHPDSQVNRLEITNDKKLLAAAGHQNIRLYDIKTS 63

Query: 373 EC--ISTYRGHSDSVLSVDSYQ--KVIVSGSADKTVKVWHVESRTCYTLRGHTEWVNCVK 428
               ++++ GH  +V SV   Q  K +V+ S D T+KVW + S +      H   VN V 
Sbjct: 64  NSNPVASFEGHRGNVTSVSFQQDNKWMVTSSEDGTIKVWDIRSPSVPRNYKHNAPVNEVV 123

Query: 429 LHPKSFSCFSCSDDTTIRMWDIRTNSCLKVFRGHVGQVQKIIPL----TIKDVENLATDN 484
           +HP      SC  D  IR+WD+  N C      H    +  +PL       D   L   N
Sbjct: 124 IHPNQGELISCDRDGNIRIWDLGENQCT-----HQLTPEDDVPLQSLSVASDGSMLVAAN 178

Query: 485 TSDGSSPQDDPTMTDGADESDT------PSNEQETVLDENIPYPTHLLSCGLDNTIKLWD 538
                   + P  TD ++          PS     +L  ++    H+ +C  D+T ++W 
Sbjct: 179 NKGNCYVWEMPNHTDASNLKPATKFKAHPSYITRVLLSSDV---KHMATCSADHTARIWS 235

Query: 539 VKTGKCIRTQF-GHVEGVWDIA--ADNFRIISGSHDGSIKVWDLQSGKCMHTFNG 590
           V+    + +   GH   VWD A  AD+  +++ S D  +++WDL +   +  + G
Sbjct: 236 VEDNFNLESTLDGHQRWVWDCAFSADSAYLVTASSDHYVRLWDLSTRDIIRQYGG 290

 Score = 51.2 bits (121), Expect = 9e-07,   Method: Compositional matrix adjust.
 Identities = 44/183 (24%), Positives = 77/183 (42%), Gaps = 16/183 (8%)

Query: 295 IQEFKGHMDGVLTLQF--NYRLLFTGSYDSTIGIWDLFTGKLIRRLSGHSDGVK--TLYF 350
           +  F+GH   V ++ F  + + + T S D TI +WD+ +  + R    H+  V    ++ 
Sbjct: 68  VASFEGHRGNVTSVSFQQDNKWMVTSSEDGTIKVWDIRSPSVPRNYK-HNAPVNEVVIHP 126

Query: 351 DDRKLITGSLDKTIRVWNYITGECISTYRGHSD---SVLSVDSYQKVIVSGSADKTVKVW 407
           +  +LI+   D  IR+W+    +C        D     LSV S   ++V+ +      VW
Sbjct: 127 NQGELISCDRDGNIRIWDLGENQCTHQLTPEDDVPLQSLSVASDGSMLVAANNKGNCYVW 186

Query: 408 HVESRT-------CYTLRGHTEWVNCVKLHPKSFSCFSCSDDTTIRMWDIRTNSCLK-VF 459
            + + T           + H  ++  V L        +CS D T R+W +  N  L+   
Sbjct: 187 EMPNHTDASNLKPATKFKAHPSYITRVLLSSDVKHMATCSADHTARIWSVEDNFNLESTL 246

Query: 460 RGH 462
            GH
Sbjct: 247 DGH 249

 Score = 36.6 bits (83), Expect = 0.041,   Method: Compositional matrix adjust.
 Identities = 32/119 (26%), Positives = 45/119 (37%), Gaps = 20/119 (16%)

Query: 290 KGHCRIQEFKGHMDGV-----------------LTLQFNYRLLFTGSYDSTIGIWDLFTG 332
           KG+C + E   H D                   + L  + + + T S D T  IW +   
Sbjct: 180 KGNCYVWEMPNHTDASNLKPATKFKAHPSYITRVLLSSDVKHMATCSADHTARIWSVEDN 239

Query: 333 -KLIRRLSGHSDGVKTLYF--DDRKLITGSLDKTIRVWNYITGECISTYRGHSDSVLSV 388
             L   L GH   V    F  D   L+T S D  +R+W+  T + I  Y GH    + V
Sbjct: 240 FNLESTLDGHQRWVWDCAFSADSAYLVTASSDHYVRLWDLSTRDIIRQYGGHHKGAVCV 298

 Score = 34.3 bits (77), Expect = 0.28,   Method: Compositional matrix adjust.
 Identities = 25/86 (29%), Positives = 34/86 (39%), Gaps = 14/86 (16%)

Query: 269 QTTRPWKVIYRERFKVESNWRKGHCRIQEFKGHMDGVLTLQF--NYRLLFTGSYDSTIGI 326
            T R W V   + F +ES             GH   V    F  +   L T S D  + +
Sbjct: 229 HTARIWSV--EDNFNLEST----------LDGHQRWVWDCAFSADSAYLVTASSDHYVRL 276

Query: 327 WDLFTGKLIRRLSGHSDGVKTLYFDD 352
           WDL T  +IR+  GH  G   +  +D
Sbjct: 277 WDLSTRDIIRQYGGHHKGAVCVALND 302

>Kwal_23.6324
          Length = 514

 Score =  106 bits (264), Expect = 5e-24,   Method: Compositional matrix adjust.
 Identities = 101/338 (29%), Positives = 148/338 (43%), Gaps = 37/338 (10%)

Query: 276 VIYRER--FKVESNWRKGHCRIQEFKGHMDGVLTLQFNYRL---LFTGSYDSTIGIWDLF 330
           ++Y  R  FKV    R          GH   +L   F       + TGS D+T  IWD  
Sbjct: 118 IVYTPRAVFKVRPVTRSS----SAIAGHGSTILCSAFAPHTSGRMVTGSGDNTARIWDCN 173

Query: 331 TGKLIRRLSGHSDGVKTLYF--DDRKLITGSLDKTIRVWNYITGECIS-TYRGHSDSVLS 387
           T   +  L GH + V  + +  D   + TGS+D TIR+W+   GE      RGH+  + S
Sbjct: 174 TNTPMYTLKGHFNWVLCVAWCPDGELIATGSMDNTIRLWDSNKGESYGEALRGHAKWITS 233

Query: 388 VD---------SYQKVIVSGSADKTVKVWHVESRTC-YTLRGHTEWVNCVKLHPKSFSCF 437
           +            Q  + S S D T+K+W    R C  TL GHT  V+CVK   +    +
Sbjct: 234 LTWEPMHLVKAGDQPRLASASKDGTIKIWDTTRRVCVLTLSGHTNSVSCVKWGGRGI-LY 292

Query: 438 SCSDDTTIRMWDIRTNS-CLKVFRGHVGQVQKIIPLTIKDVENLATDNTSDG-SSPQDDP 495
           S S D TIR WD+     C+ + + H   +  +   T   +   A D+T +  SSP++  
Sbjct: 293 SGSHDKTIRAWDMAAGGKCINILKSHAHWINHLSLNTDYALRVGAFDHTGEKPSSPEE-- 350

Query: 496 TMTDGADESDTPSNEQETVLDENIPYPTHLLSCGLDNTIKLWD-VKTGKCIRTQFGHVEG 554
                           E +  +N      +++   D T+ LWD +K  K I    GH + 
Sbjct: 351 -------ARAKALKNYEKIAKKNGQLEELMVTASDDFTMYLWDPLKASKPITRMTGHQKL 403

Query: 555 VWDIA--ADNFRIISGSHDGSIKVWDLQSGKCMHTFNG 590
           V  +A   D   I+S S D SIK+WD ++G  + TF G
Sbjct: 404 VNHVAFSPDGRYIVSASFDNSIKLWDGRNGTFIATFRG 441

 Score = 76.6 bits (187), Expect = 2e-14,   Method: Compositional matrix adjust.
 Identities = 80/341 (23%), Positives = 143/341 (41%), Gaps = 70/341 (20%)

Query: 298 FKGHMDGVLTLQF--NYRLLFTGSYDSTIGIWDLFTGKLI-RRLSGHSDGVKTLYF---- 350
            KGH + VL + +  +  L+ TGS D+TI +WD   G+     L GH+  + +L +    
Sbjct: 181 LKGHFNWVLCVAWCPDGELIATGSMDNTIRLWDSNKGESYGEALRGHAKWITSLTWEPMH 240

Query: 351 -----DDRKLITGSLDKTIRVWNYITGECISTYRGHSDSVLSVD-SYQKVIVSGSADKTV 404
                D  +L + S D TI++W+     C+ T  GH++SV  V    + ++ SGS DKT+
Sbjct: 241 LVKAGDQPRLASASKDGTIKIWDTTRRVCVLTLSGHTNSVSCVKWGGRGILYSGSHDKTI 300

Query: 405 KVWHVES--RTCYTLRGHTEWVNCVKLH------------------------PKSFSCF- 437
           + W + +  +    L+ H  W+N + L+                         K+   + 
Sbjct: 301 RAWDMAAGGKCINILKSHAHWINHLSLNTDYALRVGAFDHTGEKPSSPEEARAKALKNYE 360

Query: 438 --------------SCSDDTTIRMWD-IRTNSCLKVFRGHVGQVQKIIPLTIKDVENLAT 482
                         + SDD T+ +WD ++ +  +    GH   V  +           + 
Sbjct: 361 KIAKKNGQLEELMVTASDDFTMYLWDPLKASKPITRMTGHQKLVNHVA---------FSP 411

Query: 483 DNTSDGSSPQDDPT-MTDGADESDTPSNEQETVLDENIPYPTH---LLSCGLDNTIKLWD 538
           D     S+  D+   + DG + +   +          + + +    L+SC  D T+K+WD
Sbjct: 412 DGRYIVSASFDNSIKLWDGRNGTFIATFRGHVASVYQVAWSSDCRLLVSCSKDTTLKVWD 471

Query: 539 VKTGKCIRTQFGHVEGVW--DIAADNFRIISGSHDGSIKVW 577
           V+T K      GH + V+  D + D  R+ S   D  +++W
Sbjct: 472 VRTKKLSVDLPGHNDEVYTVDWSVDGKRVCSAGKDKMVRIW 512

 Score = 72.4 bits (176), Expect = 4e-13,   Method: Compositional matrix adjust.
 Identities = 59/234 (25%), Positives = 98/234 (41%), Gaps = 54/234 (23%)

Query: 290 KGHCRIQEFKGHMDGVLTLQF---------NYRLLFTGSYDSTIGIWDLFTGKLIRRLSG 340
           KG    +  +GH   + +L +         +   L + S D TI IWD      +  LSG
Sbjct: 216 KGESYGEALRGHAKWITSLTWEPMHLVKAGDQPRLASASKDGTIKIWDTTRRVCVLTLSG 275

Query: 341 HSDGVKTLYFDDRKLI-TGSLDKTIRVWNYITG-ECISTYRGHS----------DSVLSV 388
           H++ V  + +  R ++ +GS DKTIR W+   G +CI+  + H+          D  L V
Sbjct: 276 HTNSVSCVKWGGRGILYSGSHDKTIRAWDMAAGGKCINILKSHAHWINHLSLNTDYALRV 335

Query: 389 DSY-------------------------------QKVIVSGSADKTVKVWHV--ESRTCY 415
            ++                               ++++V+ S D T+ +W     S+   
Sbjct: 336 GAFDHTGEKPSSPEEARAKALKNYEKIAKKNGQLEELMVTASDDFTMYLWDPLKASKPIT 395

Query: 416 TLRGHTEWVNCVKLHPKSFSCFSCSDDTTIRMWDIRTNSCLKVFRGHVGQVQKI 469
            + GH + VN V   P      S S D +I++WD R  + +  FRGHV  V ++
Sbjct: 396 RMTGHQKLVNHVAFSPDGRYIVSASFDNSIKLWDGRNGTFIATFRGHVASVYQV 449

 Score = 56.6 bits (135), Expect = 3e-08,   Method: Compositional matrix adjust.
 Identities = 54/222 (24%), Positives = 89/222 (40%), Gaps = 47/222 (21%)

Query: 295 IQEFKGHMDGVLTLQFNYR-LLFTGSYDSTIGIWDLFTG-KLIRRLSGHSDGVKTLYFD- 351
           +    GH + V  +++  R +L++GS+D TI  WD+  G K I  L  H+  +  L  + 
Sbjct: 270 VLTLSGHTNSVSCVKWGGRGILYSGSHDKTIRAWDMAAGGKCINILKSHAHWINHLSLNT 329

Query: 352 ----------------------------------------DRKLITGSLDKTIRVWNYI- 370
                                                   +  ++T S D T+ +W+ + 
Sbjct: 330 DYALRVGAFDHTGEKPSSPEEARAKALKNYEKIAKKNGQLEELMVTASDDFTMYLWDPLK 389

Query: 371 TGECISTYRGHSDSV--LSVDSYQKVIVSGSADKTVKVWHVESRT-CYTLRGHTEWVNCV 427
             + I+   GH   V  ++     + IVS S D ++K+W   + T   T RGH   V  V
Sbjct: 390 ASKPITRMTGHQKLVNHVAFSPDGRYIVSASFDNSIKLWDGRNGTFIATFRGHVASVYQV 449

Query: 428 KLHPKSFSCFSCSDDTTIRMWDIRTNSCLKVFRGHVGQVQKI 469
                     SCS DTT+++WD+RT        GH  +V  +
Sbjct: 450 AWSSDCRLLVSCSKDTTLKVWDVRTKKLSVDLPGHNDEVYTV 491

 Score = 53.9 bits (128), Expect = 3e-07,   Method: Compositional matrix adjust.
 Identities = 37/119 (31%), Positives = 58/119 (48%), Gaps = 6/119 (5%)

Query: 295 IQEFKGHMDGVLTLQF--NYRLLFTGSYDSTIGIWDLFTGKLIRRLSGHSDGVKTLYF-- 350
           I    GH   V  + F  + R + + S+D++I +WD   G  I    GH   V  + +  
Sbjct: 394 ITRMTGHQKLVNHVAFSPDGRYIVSASFDNSIKLWDGRNGTFIATFRGHVASVYQVAWSS 453

Query: 351 DDRKLITGSLDKTIRVWNYITGECISTYRGHSDSVLSVDSY--QKVIVSGSADKTVKVW 407
           D R L++ S D T++VW+  T +      GH+D V +VD     K + S   DK V++W
Sbjct: 454 DCRLLVSCSKDTTLKVWDVRTKKLSVDLPGHNDEVYTVDWSVDGKRVCSAGKDKMVRIW 512

 Score = 49.7 bits (117), Expect = 5e-06,   Method: Compositional matrix adjust.
 Identities = 27/79 (34%), Positives = 47/79 (59%), Gaps = 4/79 (5%)

Query: 295 IQEFKGHMDGVLTLQFNY--RLLFTGSYDSTIGIWDLFTGKLIRRLSGHSDGVKTLYF-- 350
           I  F+GH+  V  + ++   RLL + S D+T+ +WD+ T KL   L GH+D V T+ +  
Sbjct: 436 IATFRGHVASVYQVAWSSDCRLLVSCSKDTTLKVWDVRTKKLSVDLPGHNDEVYTVDWSV 495

Query: 351 DDRKLITGSLDKTIRVWNY 369
           D +++ +   DK +R+W +
Sbjct: 496 DGKRVCSAGKDKMVRIWTH 514

>Sklu_2173.2 YCR072C, Contig c2173 2732-4279
          Length = 515

 Score =  105 bits (261), Expect = 1e-23,   Method: Compositional matrix adjust.
 Identities = 104/369 (28%), Positives = 162/369 (43%), Gaps = 61/369 (16%)

Query: 279 RERFKVESNWRKGHCRIQEFKGHMDGVLTLQF---NYRLLFTGSYDSTIGIWDLFTGKLI 335
           R  FKV+   R          GH   +L   F       + TG+ D+T  IWD  T   +
Sbjct: 124 RAVFKVKPVTRSSSA----IAGHGSTILCSAFAPHTSSRMITGAGDNTARIWDCNTQTPM 179

Query: 336 RRLSGHSDGVKTLYF--DDRKLITGSLDKTIRVWNYITGECIS-TYRGHSDSVLSVDSYQ 392
             L GH + V  + +  D   + TGS+D TIR+W    G+ +    RGH   + S+ S++
Sbjct: 180 STLKGHFNWVLCVSWSPDGELIATGSMDNTIRLWEGNKGQPVGDALRGHGKWITSL-SWE 238

Query: 393 KV----------IVSGSADKTVKVWHVESRTCY-TLRGHTEWVNCVKLHPKSFSCFSCSD 441
            +          + S S D T+K+W    R C  TL GHT  V+C+K   +    +S S 
Sbjct: 239 PIHLVKPGQKPRLASASKDGTIKIWDTTRRVCLITLSGHTSSVSCIKWGGQGV-LYSGSH 297

Query: 442 DTTIRMWDIRTNS-CLKVFRGHVGQVQKIIPLTIKDVENLATDNTSDG-SSPQD------ 493
           D TIR WD+     C+ + + H   V  +   T   +   A D+TS+  S+P++      
Sbjct: 298 DKTIRAWDMNLGGKCINILKSHAHWVNHLSLSTDYALRIGAFDHTSEKPSTPEEAQKRAL 357

Query: 494 -------------DPTMTDGADE----------SDTP----SNEQETVLDENI-PYPTHL 525
                        +  M   +D+          S  P    +  Q+ V      P   H+
Sbjct: 358 KNYEKIAKRNGEVEELMVTASDDFTMYLWNPLKSTKPITRMTGHQKLVNHVAFSPDGRHI 417

Query: 526 LSCGLDNTIKLWDVKTGKCIRTQFGHVEGVWDIA--ADNFRIISGSHDGSIKVWDLQSGK 583
           +S   DN+IKLW+ + GK I T  GHV  V+ +A  +D   ++S S D ++KVWD+++ K
Sbjct: 418 VSASFDNSIKLWNGRDGKFISTFRGHVASVYQVAWSSDCRLLVSCSKDTTLKVWDVKTKK 477

Query: 584 CMHTFNGRR 592
                 G +
Sbjct: 478 LAVDLPGHK 486

 Score = 55.8 bits (133), Expect = 6e-08,   Method: Compositional matrix adjust.
 Identities = 55/219 (25%), Positives = 90/219 (41%), Gaps = 47/219 (21%)

Query: 298 FKGHMDGVLTLQFNYR-LLFTGSYDSTIGIWDL-FTGKLIRRLSGHSDGVKTL------- 348
             GH   V  +++  + +L++GS+D TI  WD+   GK I  L  H+  V  L       
Sbjct: 274 LSGHTSSVSCIKWGGQGVLYSGSHDKTIRAWDMNLGGKCINILKSHAHWVNHLSLSTDYA 333

Query: 349 ----YFD------------------------------DRKLITGSLDKTIRVWNYI-TGE 373
                FD                              +  ++T S D T+ +WN + + +
Sbjct: 334 LRIGAFDHTSEKPSTPEEAQKRALKNYEKIAKRNGEVEELMVTASDDFTMYLWNPLKSTK 393

Query: 374 CISTYRGHSDSV--LSVDSYQKVIVSGSADKTVKVWH-VESRTCYTLRGHTEWVNCVKLH 430
            I+   GH   V  ++     + IVS S D ++K+W+  + +   T RGH   V  V   
Sbjct: 394 PITRMTGHQKLVNHVAFSPDGRHIVSASFDNSIKLWNGRDGKFISTFRGHVASVYQVAWS 453

Query: 431 PKSFSCFSCSDDTTIRMWDIRTNSCLKVFRGHVGQVQKI 469
                  SCS DTT+++WD++T        GH  +V  +
Sbjct: 454 SDCRLLVSCSKDTTLKVWDVKTKKLAVDLPGHKDEVYTV 492

 Score = 55.1 bits (131), Expect = 1e-07,   Method: Compositional matrix adjust.
 Identities = 38/119 (31%), Positives = 59/119 (49%), Gaps = 6/119 (5%)

Query: 295 IQEFKGHMDGVLTLQF--NYRLLFTGSYDSTIGIWDLFTGKLIRRLSGHSDGVKTLYF-- 350
           I    GH   V  + F  + R + + S+D++I +W+   GK I    GH   V  + +  
Sbjct: 395 ITRMTGHQKLVNHVAFSPDGRHIVSASFDNSIKLWNGRDGKFISTFRGHVASVYQVAWSS 454

Query: 351 DDRKLITGSLDKTIRVWNYITGECISTYRGHSDSVLSVDSY--QKVIVSGSADKTVKVW 407
           D R L++ S D T++VW+  T +      GH D V +VD     K + SG  DK V++W
Sbjct: 455 DCRLLVSCSKDTTLKVWDVKTKKLAVDLPGHKDEVYTVDWSVDGKRVCSGGKDKMVRLW 513

 Score = 51.2 bits (121), Expect = 1e-06,   Method: Compositional matrix adjust.
 Identities = 28/79 (35%), Positives = 47/79 (59%), Gaps = 4/79 (5%)

Query: 295 IQEFKGHMDGVLTLQFNY--RLLFTGSYDSTIGIWDLFTGKLIRRLSGHSDGVKTLYF-- 350
           I  F+GH+  V  + ++   RLL + S D+T+ +WD+ T KL   L GH D V T+ +  
Sbjct: 437 ISTFRGHVASVYQVAWSSDCRLLVSCSKDTTLKVWDVKTKKLAVDLPGHKDEVYTVDWSV 496

Query: 351 DDRKLITGSLDKTIRVWNY 369
           D +++ +G  DK +R+W +
Sbjct: 497 DGKRVCSGGKDKMVRLWTH 515

>AER263C [2765] [Homologous to ScYCR072C - SH] (1118228..1119769)
           [1542 bp, 513 aa]
          Length = 513

 Score =  105 bits (261), Expect = 1e-23,   Method: Compositional matrix adjust.
 Identities = 90/294 (30%), Positives = 139/294 (47%), Gaps = 28/294 (9%)

Query: 315 LFTGSYDSTIGIWDLFTGKLIRRLSGHSDGVKTLYF--DDRKLITGSLDKTIRVWNYITG 372
           + TG+ D+T  IWD  T   +  L GHS+ V  + +  D   + TGS+D TIR+W+   G
Sbjct: 157 MVTGAGDNTARIWDCDTQTPLCTLKGHSNWVLCVAWSADGEVIATGSMDATIRLWDSEKG 216

Query: 373 ECIS-TYRGHSDSVLSVDSYQKV----------IVSGSADKTVKVWHVESRTC-YTLRGH 420
           + +    RGH+  + S+ S++ +          + S S D T+K+W    R C YTL GH
Sbjct: 217 QSLGDALRGHTKWITSL-SWEPIHLVKPGEKPRLASASKDGTIKIWDTTRRVCIYTLSGH 275

Query: 421 TEWVNCVKLHPKSFSCFSCSDDTTIRMWDIRTNS-CLKVFRGHVGQVQKIIPLTIKDVEN 479
           T  V+C+K   ++   +S S D T+R WD+     C+ + + H   V  +   T   +  
Sbjct: 276 TSSVSCIKWGGRNV-LYSASHDRTVRCWDMAAGGKCINILKSHAHWVNHLSLSTDYALRM 334

Query: 480 LATDNTSDGSSPQDDPTMTDGADESDTPSNEQETVLDENIPYPTHLLSCGLDNTIKLWD- 538
              D+T  G+ P          D         E V  +N      +++   D T+ LW+ 
Sbjct: 335 GPFDHT--GTKPASP------EDAQARALRNYEKVAKKNGTMEELMVTGSDDFTMYLWNP 386

Query: 539 VKTGKCIRTQFGHVEGVWDIA--ADNFRIISGSHDGSIKVWDLQSGKCMHTFNG 590
           +K  K I    GH + V  +A   D   I+S S D SIK+WD + GK + TF G
Sbjct: 387 LKGSKPILRMTGHQKLVNHVAFSPDGRYIVSASFDNSIKLWDGRDGKFIATFRG 440

 Score = 87.4 bits (215), Expect = 6e-18,   Method: Compositional matrix adjust.
 Identities = 88/312 (28%), Positives = 146/312 (46%), Gaps = 42/312 (13%)

Query: 298 FKGHMDGVLTLQFNY--RLLFTGSYDSTIGIWDLFTGK-LIRRLSGHSDGVKTLYF---- 350
            KGH + VL + ++    ++ TGS D+TI +WD   G+ L   L GH+  + +L +    
Sbjct: 180 LKGHSNWVLCVAWSADGEVIATGSMDATIRLWDSEKGQSLGDALRGHTKWITSLSWEPIH 239

Query: 351 -----DDRKLITGSLDKTIRVWNYITGECISTYRGHSDSVLSVD-SYQKVIVSGSADKTV 404
                +  +L + S D TI++W+     CI T  GH+ SV  +    + V+ S S D+TV
Sbjct: 240 LVKPGEKPRLASASKDGTIKIWDTTRRVCIYTLSGHTSSVSCIKWGGRNVLYSASHDRTV 299

Query: 405 KVWHVES--RTCYTLRGHTEWVNCVKLHPKSFSCFSCSDDTTIRMWDIRTNSCLKVFRGH 462
           + W + +  +    L+ H  WVN + L          S D  +RM     ++  K     
Sbjct: 300 RCWDMAAGGKCINILKSHAHWVNHLSL----------STDYALRMGPF-DHTGTKPASPE 348

Query: 463 VGQVQKIIPLTIKDVENLATDNTSDGS---SPQDDPTM-----TDGADESDTPSNEQETV 514
             Q +      +++ E +A  N +      +  DD TM       G+      +  Q+ V
Sbjct: 349 DAQAR-----ALRNYEKVAKKNGTMEELMVTGSDDFTMYLWNPLKGSKPILRMTGHQKLV 403

Query: 515 LDENI-PYPTHLLSCGLDNTIKLWDVKTGKCIRTQFGHVEGVWDIA--ADNFRIISGSHD 571
                 P   +++S   DN+IKLWD + GK I T  GHV  V+ +A  +D   ++S S D
Sbjct: 404 NHVAFSPDGRYIVSASFDNSIKLWDGRDGKFIATFRGHVASVYQVAWSSDCRLLVSCSKD 463

Query: 572 GSIKVWDLQSGK 583
            ++KVWD+++ K
Sbjct: 464 TTLKVWDVKTRK 475

 Score = 71.2 bits (173), Expect = 9e-13,   Method: Compositional matrix adjust.
 Identities = 79/310 (25%), Positives = 117/310 (37%), Gaps = 94/310 (30%)

Query: 315 LFTGSYDSTIGIWDLFTGKLIRRLSGHSDGVKTLYFDDRK-LITGSLDKTIRVWNYITG- 372
           L + S D TI IWD      I  LSGH+  V  + +  R  L + S D+T+R W+   G 
Sbjct: 249 LASASKDGTIKIWDTTRRVCIYTLSGHTSSVSCIKWGGRNVLYSASHDRTVRCWDMAAGG 308

Query: 373 ECISTYRGHSDSV----LSVD---------------------------SYQKV------- 394
           +CI+  + H+  V    LS D                           +Y+KV       
Sbjct: 309 KCINILKSHAHWVNHLSLSTDYALRMGPFDHTGTKPASPEDAQARALRNYEKVAKKNGTM 368

Query: 395 ---IVSGSADKTVKVWHV--ESRTCYTLRGHTEWVNCVKLHPKSFSCFSCSDDTTIRMWD 449
              +V+GS D T+ +W+    S+    + GH + VN V   P      S S D +I++WD
Sbjct: 369 EELMVTGSDDFTMYLWNPLKGSKPILRMTGHQKLVNHVAFSPDGRYIVSASFDNSIKLWD 428

Query: 450 IRTNSCLKVFRGHVGQVQKIIPLTIKDVENLATDNTSDGSSPQDDPTMTDGADESDTPSN 509
            R    +  FR   G V  +  +       L                             
Sbjct: 429 GRDGKFIATFR---GHVASVYQVAWSSDCRL----------------------------- 456

Query: 510 EQETVLDENIPYPTHLLSCGLDNTIKLWDVKTGKCIRTQFGHVEGVW--DIAADNFRIIS 567
                          L+SC  D T+K+WDVKT K      GH + V+  D + D  R+ S
Sbjct: 457 ---------------LVSCSKDTTLKVWDVKTRKLTVDLPGHNDEVYTVDWSVDGKRVCS 501

Query: 568 GSHDGSIKVW 577
           G  D  +++W
Sbjct: 502 GGKDKMVRLW 511

 Score = 58.5 bits (140), Expect = 9e-09,   Method: Compositional matrix adjust.
 Identities = 48/180 (26%), Positives = 79/180 (43%), Gaps = 20/180 (11%)

Query: 248 MKRARIQQNSTGSSSNADIQTQTTRPWKVIYRERFKVES--------------NWRKGHC 293
           ++        T  +S  D Q +  R ++ + ++   +E               N  KG  
Sbjct: 332 LRMGPFDHTGTKPASPEDAQARALRNYEKVAKKNGTMEELMVTGSDDFTMYLWNPLKGSK 391

Query: 294 RIQEFKGHMDGVLTLQF--NYRLLFTGSYDSTIGIWDLFTGKLIRRLSGHSDGVKTLYF- 350
            I    GH   V  + F  + R + + S+D++I +WD   GK I    GH   V  + + 
Sbjct: 392 PILRMTGHQKLVNHVAFSPDGRYIVSASFDNSIKLWDGRDGKFIATFRGHVASVYQVAWS 451

Query: 351 -DDRKLITGSLDKTIRVWNYITGECISTYRGHSDSVLSVDSY--QKVIVSGSADKTVKVW 407
            D R L++ S D T++VW+  T +      GH+D V +VD     K + SG  DK V++W
Sbjct: 452 SDCRLLVSCSKDTTLKVWDVKTRKLTVDLPGHNDEVYTVDWSVDGKRVCSGGKDKMVRLW 511

 Score = 57.0 bits (136), Expect = 3e-08,   Method: Compositional matrix adjust.
 Identities = 57/222 (25%), Positives = 89/222 (40%), Gaps = 47/222 (21%)

Query: 295 IQEFKGHMDGVLTLQFNYR-LLFTGSYDSTIGIWDLFTG-KLIRRLSGHSDGVKTLY--- 349
           I    GH   V  +++  R +L++ S+D T+  WD+  G K I  L  H+  V  L    
Sbjct: 269 IYTLSGHTSSVSCIKWGGRNVLYSASHDRTVRCWDMAAGGKCINILKSHAHWVNHLSLST 328

Query: 350 --------FD------------------------------DRKLITGSLDKTIRVWNYIT 371
                   FD                              +  ++TGS D T+ +WN + 
Sbjct: 329 DYALRMGPFDHTGTKPASPEDAQARALRNYEKVAKKNGTMEELMVTGSDDFTMYLWNPLK 388

Query: 372 G-ECISTYRGHSDSV--LSVDSYQKVIVSGSADKTVKVWHV-ESRTCYTLRGHTEWVNCV 427
           G + I    GH   V  ++     + IVS S D ++K+W   + +   T RGH   V  V
Sbjct: 389 GSKPILRMTGHQKLVNHVAFSPDGRYIVSASFDNSIKLWDGRDGKFIATFRGHVASVYQV 448

Query: 428 KLHPKSFSCFSCSDDTTIRMWDIRTNSCLKVFRGHVGQVQKI 469
                     SCS DTT+++WD++T        GH  +V  +
Sbjct: 449 AWSSDCRLLVSCSKDTTLKVWDVKTRKLTVDLPGHNDEVYTV 490

 Score = 51.2 bits (121), Expect = 2e-06,   Method: Compositional matrix adjust.
 Identities = 28/79 (35%), Positives = 48/79 (60%), Gaps = 4/79 (5%)

Query: 295 IQEFKGHMDGVLTLQFNY--RLLFTGSYDSTIGIWDLFTGKLIRRLSGHSDGVKTLYF-- 350
           I  F+GH+  V  + ++   RLL + S D+T+ +WD+ T KL   L GH+D V T+ +  
Sbjct: 435 IATFRGHVASVYQVAWSSDCRLLVSCSKDTTLKVWDVKTRKLTVDLPGHNDEVYTVDWSV 494

Query: 351 DDRKLITGSLDKTIRVWNY 369
           D +++ +G  DK +R+W +
Sbjct: 495 DGKRVCSGGKDKMVRLWTH 513

>Kwal_26.8776
          Length = 433

 Score =  103 bits (258), Expect = 1e-23,   Method: Compositional matrix adjust.
 Identities = 81/276 (29%), Positives = 125/276 (45%), Gaps = 21/276 (7%)

Query: 317 TGSYDSTIGIWDLFTGKLIRRLSGHSDGVKTLYFDDRK--LITGSLDKTIRVWNYITGEC 374
           TGS D+TI +WD+ +GKL   L+GH   V+++    R   + + S DK ++ W+      
Sbjct: 139 TGSNDTTIKVWDMASGKLKLTLTGHVMTVRSVAVSQRHPLMFSASEDKMVKCWDLERNAA 198

Query: 375 ISTYRGHSDSVLSVDSYQKV--IVSGSADKTVKVWHVESR-TCYTLRGHTEWVNCVKLHP 431
           I  Y GH   V +VD +  +  I S   D  V++W + +R    TL GH   +N VK  P
Sbjct: 199 IRDYHGHFSGVNTVDVHPTLDLIASAGRDAVVRLWDIRTRLPVMTLAGHKSPINQVKCFP 258

Query: 432 KSFSCFSCSDDTTIRMWDIRTNSCLKVFRGHVGQVQKIIPLTIKDVENLATDNTSDGSSP 491
                 SCS D T+R+WDIR     K+   H   V+ I     +   ++AT +TSD  S 
Sbjct: 259 VDPQIMSCSSDATVRLWDIRAGKATKILTHHSKSVRAIAAHPAE--SSVATASTSDVRSW 316

Query: 492 QDDPTMTDGADESDTPSNEQETVLDENIPYPTHLLSCGLDNTIKLWDVKTGK-------- 543
           +     +DG   ++  S     +   ++     L   G D  +  +D K+G         
Sbjct: 317 RH----SDGQLLTNYHSEGIGIINSLSVNADGVLFGGGDDGNLSFFDYKSGHKYQELPTT 372

Query: 544 CIRTQFGHVEGVWDIAAD--NFRIISGSHDGSIKVW 577
            I        G+   + D    R+I+G  D SIK+W
Sbjct: 373 KIPGSLDSERGILSASFDQTGLRLITGESDKSIKMW 408

 Score = 82.8 bits (203), Expect = 1e-16,   Method: Compositional matrix adjust.
 Identities = 63/234 (26%), Positives = 95/234 (40%), Gaps = 53/234 (22%)

Query: 333 KLIRRLSGHSDGVKTL---YFDDRKLITGSLDKTIRVWNYITGECISTYRGHSDSVLSVD 389
           KL+R ++GH+  V+ +     D+    TGS D TI+VW+  +G+   T  GH  +V SV 
Sbjct: 112 KLMRVINGHNGWVRCVCPDPVDNAWFATGSNDTTIKVWDMASGKLKLTLTGHVMTVRSVA 171

Query: 390 SYQK--VIVSGSADKTVKVWHVESRTCYT-LRGHTEWVNCVKLHPKSFSCFSCSDDTTIR 446
             Q+  ++ S S DK VK W +E         GH   VN V +HP      S   D  +R
Sbjct: 172 VSQRHPLMFSASEDKMVKCWDLERNAAIRDYHGHFSGVNTVDVHPTLDLIASAGRDAVVR 231

Query: 447 MWDIRTNSCLKVFRGHVGQVQKIIPLTIKDVENLATDNTSDGSSPQDDPTMTDGADESDT 506
           +WDIRT   +    GH   + ++                                     
Sbjct: 232 LWDIRTRLPVMTLAGHKSPINQV------------------------------------- 254

Query: 507 PSNEQETVLDENIPYPTHLLSCGLDNTIKLWDVKTGKCIRTQFGHVEGVWDIAA 560
                     +  P    ++SC  D T++LWD++ GK  +    H + V  IAA
Sbjct: 255 ----------KCFPVDPQIMSCSSDATVRLWDIRAGKATKILTHHSKSVRAIAA 298

 Score = 60.1 bits (144), Expect = 2e-09,   Method: Compositional matrix adjust.
 Identities = 47/190 (24%), Positives = 83/190 (43%), Gaps = 26/190 (13%)

Query: 407 WHVESRTCYTLRGHTEWVNCVKLHPKSFSCFSC-SDDTTIRMWDIRTNSCLKVFRGHVGQ 465
           WH   +    + GH  WV CV   P   + F+  S+DTTI++WD+ +        GHV  
Sbjct: 107 WHAPWKLMRVINGHNGWVRCVCPDPVDNAWFATGSNDTTIKVWDMASGKLKLTLTGHVMT 166

Query: 466 VQKII-----PLTIKDVENLATD--NTSDGSSPQDDPTMTDGADESDTPSNEQETVLDEN 518
           V+ +      PL     E+      +    ++ +D      G +  D             
Sbjct: 167 VRSVAVSQRHPLMFSASEDKMVKCWDLERNAAIRDYHGHFSGVNTVDV------------ 214

Query: 519 IPYPT--HLLSCGLDNTIKLWDVKTGKCIRTQFGHVEGVWDIA--ADNFRIISGSHDGSI 574
             +PT   + S G D  ++LWD++T   + T  GH   +  +     + +I+S S D ++
Sbjct: 215 --HPTLDLIASAGRDAVVRLWDIRTRLPVMTLAGHKSPINQVKCFPVDPQIMSCSSDATV 272

Query: 575 KVWDLQSGKC 584
           ++WD+++GK 
Sbjct: 273 RLWDIRAGKA 282

 Score = 56.2 bits (134), Expect = 4e-08,   Method: Compositional matrix adjust.
 Identities = 43/156 (27%), Positives = 71/156 (45%), Gaps = 8/156 (5%)

Query: 300 GHMDGVLTLQFNYR--LLFTGSYDSTIGIWDLFTGKLIRRLSGHSDGVKTLYFDDRKLIT 357
           GH+  V ++  + R  L+F+ S D  +  WDL     IR   GH  GV T+       + 
Sbjct: 162 GHVMTVRSVAVSQRHPLMFSASEDKMVKCWDLERNAAIRDYHGHFSGVNTVDVHPTLDLI 221

Query: 358 GSL--DKTIRVWNYITGECISTYRGHSDSVLSVDSY--QKVIVSGSADKTVKVWHVES-R 412
            S   D  +R+W+  T   + T  GH   +  V  +     I+S S+D TV++W + + +
Sbjct: 222 ASAGRDAVVRLWDIRTRLPVMTLAGHKSPINQVKCFPVDPQIMSCSSDATVRLWDIRAGK 281

Query: 413 TCYTLRGHTEWVNCVKLHPKSFSCFSCSDDTTIRMW 448
               L  H++ V  +  HP   S  + S  + +R W
Sbjct: 282 ATKILTHHSKSVRAIAAHPAESSVATAS-TSDVRSW 316

 Score = 41.6 bits (96), Expect = 0.002,   Method: Compositional matrix adjust.
 Identities = 22/62 (35%), Positives = 32/62 (51%), Gaps = 2/62 (3%)

Query: 531 DNTIKLWDVKTGKCIRTQFGHVEGVWDIAADNFR--IISGSHDGSIKVWDLQSGKCMHTF 588
           D TIK+WD+ +GK   T  GHV  V  +A       + S S D  +K WDL+    +  +
Sbjct: 143 DTTIKVWDMASGKLKLTLTGHVMTVRSVAVSQRHPLMFSASEDKMVKCWDLERNAAIRDY 202

Query: 589 NG 590
           +G
Sbjct: 203 HG 204

 Score = 33.5 bits (75), Expect = 0.50,   Method: Compositional matrix adjust.
 Identities = 20/51 (39%), Positives = 25/51 (49%)

Query: 540 KTGKCIRTQFGHVEGVWDIAADNFRIISGSHDGSIKVWDLQSGKCMHTFNG 590
           K  + I    G V  V     DN    +GS+D +IKVWD+ SGK   T  G
Sbjct: 112 KLMRVINGHNGWVRCVCPDPVDNAWFATGSNDTTIKVWDMASGKLKLTLTG 162

 Score = 29.6 bits (65), Expect = 8.7,   Method: Compositional matrix adjust.
 Identities = 36/135 (26%), Positives = 53/135 (39%), Gaps = 23/135 (17%)

Query: 247 HMKRARIQQNSTGSSSNADIQTQTTRPWKVIYRERFKVESNWR-KGHCRIQEFKGHMDGV 305
           H K  R        SS A   T   R W+       ++ +N+  +G   I     + DGV
Sbjct: 289 HSKSVRAIAAHPAESSVATASTSDVRSWR---HSDGQLLTNYHSEGIGIINSLSVNADGV 345

Query: 306 LTLQFNYRLLFTGSYDSTIGIWDLFTGKLIRRLS-----GHSD---GVKTLYFDDR--KL 355
           L         F G  D  +  +D  +G   + L      G  D   G+ +  FD    +L
Sbjct: 346 L---------FGGGDDGNLSFFDYKSGHKYQELPTTKIPGSLDSERGILSASFDQTGLRL 396

Query: 356 ITGSLDKTIRVWNYI 370
           ITG  DK+I++W  I
Sbjct: 397 ITGESDKSIKMWKQI 411

>KLLA0F11231g complement(1034708..1036012) similar to sp|Q12417
           Saccharomyces cerevisiae YPL151c PRP46, start by
           similarity
          Length = 434

 Score =  103 bits (258), Expect = 1e-23,   Method: Compositional matrix adjust.
 Identities = 87/290 (30%), Positives = 131/290 (45%), Gaps = 23/290 (7%)

Query: 317 TGSYDSTIGIWDLFTGKLIRRLSGHSDGVKTLYFDDRK--LITGSLDKTIRVWNYITGEC 374
           TGS D+TI IWDL  GKL   L GH   V+ +    R   + + S DK ++ W+      
Sbjct: 140 TGSNDTTIKIWDLAAGKLKITLIGHVMSVRDIAISKRHPYMFSASEDKLVKCWDLERNTA 199

Query: 375 ISTYRGHSDSVLSVDSYQK--VIVSGSADKTVKVWHVESRT-CYTLRGHTEWVNCVKLHP 431
           I  + GH   V +VD +    +I +   D  V++W + SR+    L GH   +N VK  P
Sbjct: 200 IRDFHGHLSGVHTVDVHPSLDIIATAGRDAVVRLWDIRSRSEIMVLPGHKSPINKVKCLP 259

Query: 432 KSFSCFSCSDDTTIRMWDIRTNSCLKVFRGHVGQVQKIIPLTIKDVE-NLATDNTSDGSS 490
                 SCS D T+R+WDI      KV   H   ++    LT+   E + A+ +T+D  S
Sbjct: 260 VDPQIISCSGDATVRLWDIIAGKASKVLTHHSRNIRD---LTLHPAEFSFASVSTNDVRS 316

Query: 491 PQDDPTMTDGADESDTPSNEQETVLDENIPYPTHLLSCGLDNTIKLWDVKTGKCIRTQF- 549
            +    + +G   ++  S     +   +I +   LL+ G D T+  +D KTG   ++   
Sbjct: 317 WK----LPEGQLLTNFQSQNTGILNTVSINHDNVLLAGGDDGTLCFYDYKTGHKYQSMMT 372

Query: 550 ----GHVEGVWDIAADNF-----RIISGSHDGSIKVWDLQSGKCMHTFNG 590
               G +E    I    F     R+I+G  D SIK+W         TF G
Sbjct: 373 TEVAGSLESERSILCSTFDVTGTRLITGEGDKSIKIWKQVPDATEDTFPG 422

 Score = 79.7 bits (195), Expect = 1e-15,   Method: Compositional matrix adjust.
 Identities = 64/267 (23%), Positives = 105/267 (39%), Gaps = 56/267 (20%)

Query: 333 KLIRRLSGHSDGVKTL---YFDDRKLITGSLDKTIRVWNYITGECISTYRGHSDSV--LS 387
           KL + ++GH+  V+ +     D+    TGS D TI++W+   G+   T  GH  SV  ++
Sbjct: 113 KLSKVINGHTGWVRCVCVDPVDNEWFATGSNDTTIKIWDLAAGKLKITLIGHVMSVRDIA 172

Query: 388 VDSYQKVIVSGSADKTVKVWHVESRTCYT-LRGHTEWVNCVKLHPKSFSCFSCSDDTTIR 446
           +      + S S DK VK W +E  T      GH   V+ V +HP      +   D  +R
Sbjct: 173 ISKRHPYMFSASEDKLVKCWDLERNTAIRDFHGHLSGVHTVDVHPSLDIIATAGRDAVVR 232

Query: 447 MWDIRTNSCLKVFRGHVGQVQKIIPLTIKDVENLATDNTSDGSSPQDDPTMTDGADESDT 506
           +WDIR+ S + V  GH   + K+                                     
Sbjct: 233 LWDIRSRSEIMVLPGHKSPINKV------------------------------------- 255

Query: 507 PSNEQETVLDENIPYPTHLLSCGLDNTIKLWDVKTGKCIRTQFGHVEGVWDIA--ADNFR 564
                     + +P    ++SC  D T++LWD+  GK  +    H   + D+      F 
Sbjct: 256 ----------KCLPVDPQIISCSGDATVRLWDIIAGKASKVLTHHSRNIRDLTLHPAEFS 305

Query: 565 IISGSHDGSIKVWDLQSGKCMHTFNGR 591
             S S +  ++ W L  G+ +  F  +
Sbjct: 306 FASVSTN-DVRSWKLPEGQLLTNFQSQ 331

 Score = 55.8 bits (133), Expect = 5e-08,   Method: Compositional matrix adjust.
 Identities = 50/205 (24%), Positives = 85/205 (41%), Gaps = 24/205 (11%)

Query: 407 WHVESRTCYTLRGHTEWVNCVKLHPKSFSCFSC-SDDTTIRMWDIRTNSCLKVFRGHVGQ 465
           WH   +    + GHT WV CV + P     F+  S+DTTI++WD+          GHV  
Sbjct: 108 WHAPWKLSKVINGHTGWVRCVCVDPVDNEWFATGSNDTTIKIWDLAAGKLKITLIGHVMS 167

Query: 466 VQKII-----PLTIKDVENLATD--NTSDGSSPQDDPTMTDGADESDTPSNEQETVLDEN 518
           V+ I      P      E+      +    ++ +D      G    D             
Sbjct: 168 VRDIAISKRHPYMFSASEDKLVKCWDLERNTAIRDFHGHLSGVHTVDVH----------- 216

Query: 519 IPYPTHLLSCGLDNTIKLWDVKTGKCIRTQFGHVEGVWDIA--ADNFRIISGSHDGSIKV 576
            P    + + G D  ++LWD+++   I    GH   +  +     + +IIS S D ++++
Sbjct: 217 -PSLDIIATAGRDAVVRLWDIRSRSEIMVLPGHKSPINKVKCLPVDPQIISCSGDATVRL 275

Query: 577 WDLQSGKC--MHTFNGRRLQRETQH 599
           WD+ +GK   + T + R ++  T H
Sbjct: 276 WDIIAGKASKVLTHHSRNIRDLTLH 300

>CAGL0J03476g 331933..333486 highly similar to sp|P25382
           Saccharomyces cerevisiae YCR072c, start by similarity
          Length = 517

 Score =  103 bits (256), Expect = 5e-23,   Method: Compositional matrix adjust.
 Identities = 105/353 (29%), Positives = 160/353 (45%), Gaps = 40/353 (11%)

Query: 259 GSSSNADIQTQTTRPWKVIYRERFKVESNWRKGHCRIQEFKGHMDGVLTLQF---NYRLL 315
           G +S  DI T   +P     R  FKV+   R          GH   +L   F       +
Sbjct: 111 GHNSTEDIITLDFQP-----RAVFKVKPITRSS----SAIAGHGATILCSAFAPHTSSRV 161

Query: 316 FTGSYDSTIGIWDLFTGKLIRRLSGHSDGVKTLYF--DDRKLITGSLDKTIRVWNYITGE 373
            TG  D+T  IWD  T      L+GH + V  + +  D   + TGS+D TIR+W+  +G+
Sbjct: 162 VTGGGDNTARIWDCDTQTPKVTLNGHRNWVLCVSWSADGEVIATGSMDNTIRLWDAESGK 221

Query: 374 CIS-TYRGHSDSVLSVDSYQKV----------IVSGSADKTVKVWHVESRTCY-TLRGHT 421
            +    RGHS  + S+ +++ +          + S S D T+++W    R C  TL GHT
Sbjct: 222 PLGDALRGHSKWITSL-TWEPIHLVEPGSKPRLASASKDGTIRIWDSSRRVCLMTLGGHT 280

Query: 422 EWVNCVKLHPKSFSCFSCSDDTTIRMWDIRTNS-CLKVFRGHVGQVQKIIPLTIKDVENL 480
             V+CVK   +    +S S D T+R WD++ N  C+ + + H   V  +   T   +   
Sbjct: 281 NSVSCVKWGGEGI-LYSGSHDKTVRAWDMKQNGKCINILKSHAHWVNHLSLSTDYALRVG 339

Query: 481 ATDNTSDGSSPQDDPTMTDGADESDTPSNEQETVLDENIPYPTHLLSCGLDNTIKLWD-V 539
           A D T  G  P +     D A ++       E V  +N  +   +++   D T+ LW+ +
Sbjct: 340 AFDYT--GVKPANAKEARDKALQN------YEKVARKNGKHEELMVTASDDFTMFLWNPL 391

Query: 540 KTGKCIRTQFGHVEGVWDIA--ADNFRIISGSHDGSIKVWDLQSGKCMHTFNG 590
           K  K I    GH + V  +A   D   I+S S D SIK+WD + G  + TF G
Sbjct: 392 KGTKPISRMTGHQKLVNHVAFSPDGKYIVSASFDNSIKLWDGKEGTFLSTFRG 444

 Score = 71.2 bits (173), Expect = 1e-12,   Method: Compositional matrix adjust.
 Identities = 85/341 (24%), Positives = 143/341 (41%), Gaps = 70/341 (20%)

Query: 298 FKGHMDGVLTLQFNY--RLLFTGSYDSTIGIWDLFTGK-LIRRLSGHSDGVKTLYFD--- 351
             GH + VL + ++    ++ TGS D+TI +WD  +GK L   L GHS  + +L ++   
Sbjct: 184 LNGHRNWVLCVSWSADGEVIATGSMDNTIRLWDAESGKPLGDALRGHSKWITSLTWEPIH 243

Query: 352 ------DRKLITGSLDKTIRVWNYITGECISTYRGHSDSVLSVD-SYQKVIVSGSADKTV 404
                   +L + S D TIR+W+     C+ T  GH++SV  V    + ++ SGS DKTV
Sbjct: 244 LVEPGSKPRLASASKDGTIRIWDSSRRVCLMTLGGHTNSVSCVKWGGEGILYSGSHDKTV 303

Query: 405 KVW--------------------HVESRTCYTLR-GHTEW-----VNCVKLHPKSFSCF- 437
           + W                    H+   T Y LR G  ++      N  +   K+   + 
Sbjct: 304 RAWDMKQNGKCINILKSHAHWVNHLSLSTDYALRVGAFDYTGVKPANAKEARDKALQNYE 363

Query: 438 --------------SCSDDTTIRMWD-IRTNSCLKVFRGHVGQVQKIIPLTIKDVENLAT 482
                         + SDD T+ +W+ ++    +    GH   V  +           + 
Sbjct: 364 KVARKNGKHEELMVTASDDFTMFLWNPLKGTKPISRMTGHQKLVNHVA---------FSP 414

Query: 483 DNTSDGSSPQDDPT-MTDGADESDTPSNEQETVLDENIPYPTH---LLSCGLDNTIKLWD 538
           D     S+  D+   + DG + +   +          + + +    L+SC  D T+K+WD
Sbjct: 415 DGKYIVSASFDNSIKLWDGKEGTFLSTFRGHVASVYQVAWSSDCRLLVSCSKDTTLKVWD 474

Query: 539 VKTGKCIRTQFGHVEGVW--DIAADNFRIISGSHDGSIKVW 577
           VKT K      GH + V+  D + D  R+ SG  D  +++W
Sbjct: 475 VKTRKLSVDLPGHQDEVYTVDWSVDGKRVCSGGKDKMMRLW 515

 Score = 57.8 bits (138), Expect = 2e-08,   Method: Compositional matrix adjust.
 Identities = 58/222 (26%), Positives = 90/222 (40%), Gaps = 47/222 (21%)

Query: 295 IQEFKGHMDGVLTLQFNYR-LLFTGSYDSTIGIWDLF-TGKLIRRLSGHSDGVKTL---- 348
           +    GH + V  +++    +L++GS+D T+  WD+   GK I  L  H+  V  L    
Sbjct: 273 LMTLGGHTNSVSCVKWGGEGILYSGSHDKTVRAWDMKQNGKCINILKSHAHWVNHLSLST 332

Query: 349 -------YFD------------------------------DRKLITGSLDKTIRVWNYIT 371
                   FD                              +  ++T S D T+ +WN + 
Sbjct: 333 DYALRVGAFDYTGVKPANAKEARDKALQNYEKVARKNGKHEELMVTASDDFTMFLWNPLK 392

Query: 372 G-ECISTYRGHSDSV--LSVDSYQKVIVSGSADKTVKVWHVESRT-CYTLRGHTEWVNCV 427
           G + IS   GH   V  ++     K IVS S D ++K+W  +  T   T RGH   V  V
Sbjct: 393 GTKPISRMTGHQKLVNHVAFSPDGKYIVSASFDNSIKLWDGKEGTFLSTFRGHVASVYQV 452

Query: 428 KLHPKSFSCFSCSDDTTIRMWDIRTNSCLKVFRGHVGQVQKI 469
                     SCS DTT+++WD++T        GH  +V  +
Sbjct: 453 AWSSDCRLLVSCSKDTTLKVWDVKTRKLSVDLPGHQDEVYTV 494

 Score = 52.0 bits (123), Expect = 1e-06,   Method: Compositional matrix adjust.
 Identities = 37/124 (29%), Positives = 60/124 (48%), Gaps = 6/124 (4%)

Query: 290 KGHCRIQEFKGHMDGVLTLQF--NYRLLFTGSYDSTIGIWDLFTGKLIRRLSGHSDGVKT 347
           KG   I    GH   V  + F  + + + + S+D++I +WD   G  +    GH   V  
Sbjct: 392 KGTKPISRMTGHQKLVNHVAFSPDGKYIVSASFDNSIKLWDGKEGTFLSTFRGHVASVYQ 451

Query: 348 LYF--DDRKLITGSLDKTIRVWNYITGECISTYRGHSDSVLSVDSY--QKVIVSGSADKT 403
           + +  D R L++ S D T++VW+  T +      GH D V +VD     K + SG  DK 
Sbjct: 452 VAWSSDCRLLVSCSKDTTLKVWDVKTRKLSVDLPGHQDEVYTVDWSVDGKRVCSGGKDKM 511

Query: 404 VKVW 407
           +++W
Sbjct: 512 MRLW 515

 Score = 48.5 bits (114), Expect = 1e-05,   Method: Compositional matrix adjust.
 Identities = 27/79 (34%), Positives = 47/79 (59%), Gaps = 4/79 (5%)

Query: 295 IQEFKGHMDGVLTLQFNY--RLLFTGSYDSTIGIWDLFTGKLIRRLSGHSDGVKTLYF-- 350
           +  F+GH+  V  + ++   RLL + S D+T+ +WD+ T KL   L GH D V T+ +  
Sbjct: 439 LSTFRGHVASVYQVAWSSDCRLLVSCSKDTTLKVWDVKTRKLSVDLPGHQDEVYTVDWSV 498

Query: 351 DDRKLITGSLDKTIRVWNY 369
           D +++ +G  DK +R+W +
Sbjct: 499 DGKRVCSGGKDKMMRLWTH 517

>AEL246C [2260] [Homologous to ScYBR198C (TAF90) - SH]
           (172849..175296) [2448 bp, 815 aa]
          Length = 815

 Score =  103 bits (258), Expect = 7e-23,   Method: Compositional matrix adjust.
 Identities = 83/291 (28%), Positives = 126/291 (43%), Gaps = 72/291 (24%)

Query: 313 RLLFTGSYDSTIGIWDLFTGKLIRRLS-------------GHSDGVKTLYF--DDRKLIT 357
           RL+  G  DS I +W L    L  +L              GHS  V ++ F  D+R L++
Sbjct: 500 RLVAAGFQDSYIKLWSLDGTPLESQLPSKAKDASNTVTLIGHSGPVYSVSFSPDNRYLVS 559

Query: 358 GSLDKTIRVWNYITGECISTYRGHSDSVLSV--DSYQKVIVSGSADKTVKVWHVESRTCY 415
            S DKT+R+W+  T  C+ +Y+GH+  V  V          +GS D+T ++W  +    Y
Sbjct: 560 ASEDKTVRLWSLDTYTCLVSYKGHNHPVWDVKFSPLGHYFATGSHDQTARLWSCDH--IY 617

Query: 416 TLR---GHTEWVNCVKLHPKSFSCFSCSDDTTIRMWDIRTNSCLKVFRGHVGQVQKIIPL 472
            LR   GH   V+CV  HP      + S D T RMWDI+T   +++F GH   V  +   
Sbjct: 618 PLRIFAGHLNDVDCVTFHPNGTYVLTGSSDKTCRMWDIQTGDSVRLFLGHTASVVSV--- 674

Query: 473 TIKDVENLATDNTSDGSSPQDDPTMTDGADESDTPSNEQETVLDENIPYPTHLLSCGLDN 532
                            SP D   +T G++                            D 
Sbjct: 675 ---------------AVSP-DGRWLTTGSE----------------------------DG 690

Query: 533 TIKLWDVKTGKCIRTQFGHVE-GVWDIA--ADNFRIISGSHDGSIKVWDLQ 580
            I +WD+ TGK I+   GH +  V+ ++   +   ++SG  D S++VWDL+
Sbjct: 691 VIIVWDIGTGKRIKQMRGHGKSAVYSLSFNKEGNILVSGGADQSVRVWDLK 741

 Score = 76.6 bits (187), Expect = 3e-14,   Method: Compositional matrix adjust.
 Identities = 47/123 (38%), Positives = 68/123 (55%), Gaps = 7/123 (5%)

Query: 298 FKGHMDGV--LTLQFNYRLLFTGSYDSTIGIWDLFTGKLIRRLSGHSDGVKTLYF--DDR 353
           F GH++ V  +T   N   + TGS D T  +WD+ TG  +R   GH+  V ++    D R
Sbjct: 622 FAGHLNDVDCVTFHPNGTYVLTGSSDKTCRMWDIQTGDSVRLFLGHTASVVSVAVSPDGR 681

Query: 354 KLITGSLDKTIRVWNYITGECISTYRGHSDSVLSVDSYQK---VIVSGSADKTVKVWHVE 410
            L TGS D  I VW+  TG+ I   RGH  S +   S+ K   ++VSG AD++V+VW ++
Sbjct: 682 WLTTGSEDGVIIVWDIGTGKRIKQMRGHGKSAVYSLSFNKEGNILVSGGADQSVRVWDLK 741

Query: 411 SRT 413
             T
Sbjct: 742 KFT 744

 Score = 75.9 bits (185), Expect = 4e-14,   Method: Compositional matrix adjust.
 Identities = 68/262 (25%), Positives = 106/262 (40%), Gaps = 68/262 (25%)

Query: 349 YFDDRKLIT-GSLDKTIRVWNYITGECIS--------------TYRGHSDSVLSVD--SY 391
           + DD +L+  G  D  I++W+ + G  +               T  GHS  V SV     
Sbjct: 495 FSDDSRLVAAGFQDSYIKLWS-LDGTPLESQLPSKAKDASNTVTLIGHSGPVYSVSFSPD 553

Query: 392 QKVIVSGSADKTVKVWHVESRTCY-TLRGHTEWVNCVKLHPKSFSCFSCSDDTTIRMWDI 450
            + +VS S DKTV++W +++ TC  + +GH   V  VK  P      + S D T R+W  
Sbjct: 554 NRYLVSASEDKTVRLWSLDTYTCLVSYKGHNHPVWDVKFSPLGHYFATGSHDQTARLWSC 613

Query: 451 RTNSCLKVFRGHVGQVQKIIPLTIKDVENLATDNTSDGSSPQDDPTMTDGADESDTPSNE 510
                L++F GH           + DV+ +                              
Sbjct: 614 DHIYPLRIFAGH-----------LNDVDCVTFH--------------------------- 635

Query: 511 QETVLDENIPYPTHLLSCGLDNTIKLWDVKTGKCIRTQFGHVEGVWDIAA--DNFRIISG 568
                    P  T++L+   D T ++WD++TG  +R   GH   V  +A   D   + +G
Sbjct: 636 ---------PNGTYVLTGSSDKTCRMWDIQTGDSVRLFLGHTASVVSVAVSPDGRWLTTG 686

Query: 569 SHDGSIKVWDLQSGKCMHTFNG 590
           S DG I VWD+ +GK +    G
Sbjct: 687 SEDGVIIVWDIGTGKRIKQMRG 708

>AGL024W [4287] [Homologous to ScYFL009W (CDC4) - SH; ScYER066W -
           NSH] complement(667539..669809) [2271 bp, 756 aa]
          Length = 756

 Score =  103 bits (256), Expect = 1e-22,   Method: Compositional matrix adjust.
 Identities = 91/350 (26%), Positives = 146/350 (41%), Gaps = 62/350 (17%)

Query: 159 ILSTSCFPQLSYISSLVTHMIKIDFISILPQELSLKILSYLDCQSLCNATRVCRKWQKLA 218
           +LS     +LS +S+ +   +K DF+  LP E+S+ IL+ LD + +C+   V R W  L 
Sbjct: 234 LLSKLNRSELSDLSTYLKDHLKRDFLQYLPMEVSMNILNNLDFEDICSCLLVNRTWNNLI 293

Query: 219 -DDDRVWYHMCEQHIDRKCPNCGWGLPLLHMKRARIQQNSTGSSSNADIQTQTTRP---- 273
            +   +W HM                    +    + ++   S  ++  +     P    
Sbjct: 294 RNSPYLWKHMM-------------------LSEGFVTEDCFSSYCDSIPEKHRHLPNPSD 334

Query: 274 -WKVIYRERFKVESNW-----RKGHCRIQEFKGHMDGVLT-LQFNYRLLFTGSYDSTIGI 326
            +++ + E   +  NW     R G   +    GH   V+T  QF    + TG+ D  I +
Sbjct: 335 RFRLDFLENRWLLENWCNPCYRPGRTCLD---GHRTKVVTCFQFEGNYIITGADDKRINV 391

Query: 327 WDLFTGKLIRRLSGHSDGVKTL-YFDDRKLITGSLDKTIRVWNYITGECISTYRGHSDSV 385
           +D    +    L GH  GV  L Y  D  L++GS D+T+R+WN   G+C   +RGH+ +V
Sbjct: 392 YDADREQFKLELVGHEGGVWALKYAGDEILVSGSTDRTVRIWNVKAGKCTHVFRGHTSTV 451

Query: 386 LSVDSYQ----KVIVSGSADKTVKVWH-------------------VESRTCY--TLRGH 420
             +D  +    K +V+GS D T+ VW                    +E    +   LRGH
Sbjct: 452 RCLDVVEHGGIKYVVTGSRDNTLHVWKLPDPNSPDYNPNAMRQFNSIEDNPFFVGVLRGH 511

Query: 421 TEWVNCVKLHPKSFSCFSCSDDTTIRMWDIRTNSCLKVFRGHVGQVQKII 470
              V  V  H       S S D  + +WDI     L V  GH  ++   +
Sbjct: 512 MASVRTVSGHGN--IVVSGSYDHNLMVWDIAKMKLLYVLTGHTDRIYSTL 559

 Score = 62.8 bits (151), Expect = 6e-10,   Method: Compositional matrix adjust.
 Identities = 69/285 (24%), Positives = 117/285 (41%), Gaps = 52/285 (18%)

Query: 338 LSGHSDGVKTLY-FDDRKLITGSLDKTIRVWNYITGECISTYRGHSDSVLSVD-SYQKVI 395
           L GH   V T + F+   +ITG+ DK I V++    +      GH   V ++  +  +++
Sbjct: 362 LDGHRTKVVTCFQFEGNYIITGADDKRINVYDADREQFKLELVGHEGGVWALKYAGDEIL 421

Query: 396 VSGSADKTVKVWHVESRTC-YTLRGHTEWVNCVKL--HPKSFSCFSCSDDTTIRMW---- 448
           VSGS D+TV++W+V++  C +  RGHT  V C+ +  H       + S D T+ +W    
Sbjct: 422 VSGSTDRTVRIWNVKAGKCTHVFRGHTSTVRCLDVVEHGGIKYVVTGSRDNTLHVWKLPD 481

Query: 449 ----DIRTNSC------------LKVFRGHVGQVQKIIPLTIKDVENLATDNTSDGS-SP 491
               D   N+             + V RGH+  V+     T+    N+    + D +   
Sbjct: 482 PNSPDYNPNAMRQFNSIEDNPFFVGVLRGHMASVR-----TVSGHGNIVVSGSYDHNLMV 536

Query: 492 QDDPTMTDGADESDTPSNEQETVLDENIPYPTHLLSCGLDNTIKLWDV------------ 539
            D   M      +        T+ D         +S  +D T+K+WD+            
Sbjct: 537 WDIAKMKLLYVLTGHTDRIYSTLYDHK---RKRCISASMDTTVKVWDLSDINNNGPVSQI 593

Query: 540 ------KTGKCIRTQFGHVEGVWDIAADNFRIISGSHDGSIKVWD 578
                 K    +RT  GH   V  +   +  ++S + DGS++ WD
Sbjct: 594 NSTSALKVSGSVRTLCGHTALVGLLGLSDKYLVSAAADGSLRGWD 638

 Score = 60.8 bits (146), Expect = 2e-09,   Method: Compositional matrix adjust.
 Identities = 43/154 (27%), Positives = 75/154 (48%), Gaps = 25/154 (16%)

Query: 298 FKGHMDGVLTLQFNYRLLFTGSYDSTIGIWDLFTGKLIRRLSGHSDGVKTLYFDD--RKL 355
            +GHM  V T+  +  ++ +GSYD  + +WD+   KL+  L+GH+D + +  +D   ++ 
Sbjct: 508 LRGHMASVRTVSGHGNIVVSGSYDHNLMVWDIAKMKLLYVLTGHTDRIYSTLYDHKRKRC 567

Query: 356 ITGSLDKTIRVWNYITGECISTYRGHSDSVLSVDSYQKVIVSGSADKTVKVWHVESRTCY 415
           I+ S+D T++VW+        +   ++  V  ++S   + VSGS                
Sbjct: 568 ISASMDTTVKVWDL-------SDINNNGPVSQINSTSALKVSGSVR-------------- 606

Query: 416 TLRGHTEWVNCVKLHPKSFSCFSCSDDTTIRMWD 449
           TL GHT  V  + L  K     S + D ++R WD
Sbjct: 607 TLCGHTALVGLLGLSDKYL--VSAAADGSLRGWD 638

 Score = 58.9 bits (141), Expect = 9e-09,   Method: Compositional matrix adjust.
 Identities = 59/224 (26%), Positives = 97/224 (43%), Gaps = 30/224 (13%)

Query: 380 GHSDSVLSVDSYQ-KVIVSGSADKTVKVWHVESRTC-YTLRGHTEWVNCVKLHPKSFSCF 437
           GH   V++   ++   I++G+ DK + V+  +       L GH   V  +K         
Sbjct: 364 GHRTKVVTCFQFEGNYIITGADDKRINVYDADREQFKLELVGHEGGVWALKYAGDEI-LV 422

Query: 438 SCSDDTTIRMWDIRTNSCLKVFRGHVGQVQKIIPLT---IKDVENLATDNT------SDG 488
           S S D T+R+W+++   C  VFRGH   V+ +  +    IK V   + DNT       D 
Sbjct: 423 SGSTDRTVRIWNVKAGKCTHVFRGHTSTVRCLDVVEHGGIKYVVTGSRDNTLHVWKLPDP 482

Query: 489 SSPQDDP-TMTDGADESDTP----------SNEQETVLDENIPYPTHLLSCGLDNTIKLW 537
           +SP  +P  M       D P          ++ +      NI     ++S   D+ + +W
Sbjct: 483 NSPDYNPNAMRQFNSIEDNPFFVGVLRGHMASVRTVSGHGNI-----VVSGSYDHNLMVW 537

Query: 538 DVKTGKCIRTQFGHVEGVWDIAADN--FRIISGSHDGSIKVWDL 579
           D+   K +    GH + ++    D+   R IS S D ++KVWDL
Sbjct: 538 DIAKMKLLYVLTGHTDRIYSTLYDHKRKRCISASMDTTVKVWDL 581

 Score = 45.4 bits (106), Expect = 1e-04,   Method: Compositional matrix adjust.
 Identities = 21/69 (30%), Positives = 39/69 (56%), Gaps = 3/69 (4%)

Query: 524 HLLSCGLDNTIKLWDVKTGKCIRTQFGHVEGVWDI--AADNFRIISGSHDGSIKVWDLQS 581
           ++++   D  I ++D    +      GH  GVW +  A D   ++SGS D ++++W++++
Sbjct: 379 YIITGADDKRINVYDADREQFKLELVGHEGGVWALKYAGDEI-LVSGSTDRTVRIWNVKA 437

Query: 582 GKCMHTFNG 590
           GKC H F G
Sbjct: 438 GKCTHVFRG 446

>KLLA0C08547g 749737..751284 highly similar to sp|P25382
           Saccharomyces cerevisiae YCR072c, start by similarity
          Length = 515

 Score =  100 bits (249), Expect = 4e-22,   Method: Compositional matrix adjust.
 Identities = 103/365 (28%), Positives = 160/365 (43%), Gaps = 63/365 (17%)

Query: 276 VIYRER--FKVESNWRKGHCRIQEFKGHMDGVLTLQF---NYRLLFTGSYDSTIGIWDLF 330
           ++Y  R  FKV+   R          GH   +L   F       + TG+ D+T  IWD  
Sbjct: 119 LVYTPRAIFKVKPVTRSS----SAIAGHGSTILCSAFAPNTSSRMVTGAGDNTACIWDCD 174

Query: 331 TGKLIRRLSGHSDGVKTLYF--DDRKLITGSLDKTIRVWNYITGECIS-TYRGHSDSVLS 387
           T   +  L GH + V    +  D   + TGS+D TIR+W    G+      RGHS  + S
Sbjct: 175 TQTRMCTLQGHHNWVLCCSWSPDGELIATGSMDNTIRLWESSKGKPYGDALRGHSKWITS 234

Query: 388 VDSYQKV----------IVSGSADKTVKVWHVESRTCY-TLRGHTEWVNCVKLHPKSFSC 436
           + S++ +          + + S D T+K+W    R C  TL GHT  V+CVK   K+   
Sbjct: 235 L-SWEPIHLVKPGDKPRLATASKDGTIKIWDTTRRVCLLTLCGHTSSVSCVKWGGKNV-L 292

Query: 437 FSCSDDTTIRMWDIRTNS-CLKVFRGHVGQVQKI------------------IPLTIKDV 477
           +S S D TIR WD+  N  C+ + + H   V  +                   P + ++ 
Sbjct: 293 YSGSHDKTIRCWDMNLNGKCINILKSHAHWVNHLSLSTDYALRLGAFDHKGETPASPEEA 352

Query: 478 ENLATDNTSDGSSPQDD--PTMTDGADE----------SDTP----SNEQETVLDENI-P 520
           +  A  N    +  + D    M   +D+          S  P    +  Q+ V      P
Sbjct: 353 QQKALKNYEKVAKRKGDFEELMVTASDDFTMYLWNPLKSTKPITRMTGHQKLVNHVAFSP 412

Query: 521 YPTHLLSCGLDNTIKLWDVKTGKCIRTQFGHVEGVWDIA--ADNFRIISGSHDGSIKVWD 578
              +++S   DN+IKLWD + GK + T  GHV  V+ +A  +D   ++S S D ++KVWD
Sbjct: 413 DGRYIVSASFDNSIKLWDGRDGKFLSTFRGHVASVYQVAWSSDCRLLVSCSKDTTLKVWD 472

Query: 579 LQSGK 583
           +++ K
Sbjct: 473 VKTRK 477

 Score = 71.2 bits (173), Expect = 8e-13,   Method: Compositional matrix adjust.
 Identities = 79/310 (25%), Positives = 117/310 (37%), Gaps = 94/310 (30%)

Query: 315 LFTGSYDSTIGIWDLFTGKLIRRLSGHSDGVKTLYFDDRK-LITGSLDKTIRVWNY-ITG 372
           L T S D TI IWD      +  L GH+  V  + +  +  L +GS DKTIR W+  + G
Sbjct: 251 LATASKDGTIKIWDTTRRVCLLTLCGHTSSVSCVKWGGKNVLYSGSHDKTIRCWDMNLNG 310

Query: 373 ECISTYRGHSDSV----LSVD---------------------------SYQKV------- 394
           +CI+  + H+  V    LS D                           +Y+KV       
Sbjct: 311 KCINILKSHAHWVNHLSLSTDYALRLGAFDHKGETPASPEEAQQKALKNYEKVAKRKGDF 370

Query: 395 ---IVSGSADKTVKVWHV--ESRTCYTLRGHTEWVNCVKLHPKSFSCFSCSDDTTIRMWD 449
              +V+ S D T+ +W+    ++    + GH + VN V   P      S S D +I++WD
Sbjct: 371 EELMVTASDDFTMYLWNPLKSTKPITRMTGHQKLVNHVAFSPDGRYIVSASFDNSIKLWD 430

Query: 450 IRTNSCLKVFRGHVGQVQKIIPLTIKDVENLATDNTSDGSSPQDDPTMTDGADESDTPSN 509
            R    L  FR   G V  +  +       L                             
Sbjct: 431 GRDGKFLSTFR---GHVASVYQVAWSSDCRL----------------------------- 458

Query: 510 EQETVLDENIPYPTHLLSCGLDNTIKLWDVKTGKCIRTQFGHVEGVW--DIAADNFRIIS 567
                          L+SC  D T+K+WDVKT K      GH + V+  D + D  R+ S
Sbjct: 459 ---------------LVSCSKDTTLKVWDVKTRKLSVDLPGHQDEVYTVDWSVDGKRVCS 503

Query: 568 GSHDGSIKVW 577
           G  D  +++W
Sbjct: 504 GGKDKMVRIW 513

 Score = 56.6 bits (135), Expect = 4e-08,   Method: Compositional matrix adjust.
 Identities = 38/119 (31%), Positives = 59/119 (49%), Gaps = 6/119 (5%)

Query: 295 IQEFKGHMDGVLTLQF--NYRLLFTGSYDSTIGIWDLFTGKLIRRLSGHSDGVKTLYF-- 350
           I    GH   V  + F  + R + + S+D++I +WD   GK +    GH   V  + +  
Sbjct: 395 ITRMTGHQKLVNHVAFSPDGRYIVSASFDNSIKLWDGRDGKFLSTFRGHVASVYQVAWSS 454

Query: 351 DDRKLITGSLDKTIRVWNYITGECISTYRGHSDSVLSVDSY--QKVIVSGSADKTVKVW 407
           D R L++ S D T++VW+  T +      GH D V +VD     K + SG  DK V++W
Sbjct: 455 DCRLLVSCSKDTTLKVWDVKTRKLSVDLPGHQDEVYTVDWSVDGKRVCSGGKDKMVRIW 513

 Score = 55.1 bits (131), Expect = 9e-08,   Method: Compositional matrix adjust.
 Identities = 55/217 (25%), Positives = 89/217 (41%), Gaps = 47/217 (21%)

Query: 300 GHMDGVLTLQFNYR-LLFTGSYDSTIGIWDL-FTGKLIRRLSGHSDGVKTL--------- 348
           GH   V  +++  + +L++GS+D TI  WD+   GK I  L  H+  V  L         
Sbjct: 276 GHTSSVSCVKWGGKNVLYSGSHDKTIRCWDMNLNGKCINILKSHAHWVNHLSLSTDYALR 335

Query: 349 --YFDDRK------------------------------LITGSLDKTIRVWNYI-TGECI 375
              FD +                               ++T S D T+ +WN + + + I
Sbjct: 336 LGAFDHKGETPASPEEAQQKALKNYEKVAKRKGDFEELMVTASDDFTMYLWNPLKSTKPI 395

Query: 376 STYRGHSDSV--LSVDSYQKVIVSGSADKTVKVWH-VESRTCYTLRGHTEWVNCVKLHPK 432
           +   GH   V  ++     + IVS S D ++K+W   + +   T RGH   V  V     
Sbjct: 396 TRMTGHQKLVNHVAFSPDGRYIVSASFDNSIKLWDGRDGKFLSTFRGHVASVYQVAWSSD 455

Query: 433 SFSCFSCSDDTTIRMWDIRTNSCLKVFRGHVGQVQKI 469
                SCS DTT+++WD++T        GH  +V  +
Sbjct: 456 CRLLVSCSKDTTLKVWDVKTRKLSVDLPGHQDEVYTV 492

 Score = 50.4 bits (119), Expect = 3e-06,   Method: Compositional matrix adjust.
 Identities = 27/79 (34%), Positives = 47/79 (59%), Gaps = 4/79 (5%)

Query: 295 IQEFKGHMDGVLTLQFNY--RLLFTGSYDSTIGIWDLFTGKLIRRLSGHSDGVKTLYF-- 350
           +  F+GH+  V  + ++   RLL + S D+T+ +WD+ T KL   L GH D V T+ +  
Sbjct: 437 LSTFRGHVASVYQVAWSSDCRLLVSCSKDTTLKVWDVKTRKLSVDLPGHQDEVYTVDWSV 496

Query: 351 DDRKLITGSLDKTIRVWNY 369
           D +++ +G  DK +R+W +
Sbjct: 497 DGKRVCSGGKDKMVRIWTH 515

>Sklu_2420.2 YPL151C, Contig c2420 3924-5249
          Length = 441

 Score = 99.8 bits (247), Expect = 5e-22,   Method: Compositional matrix adjust.
 Identities = 89/291 (30%), Positives = 127/291 (43%), Gaps = 25/291 (8%)

Query: 317 TGSYDSTIGIWDLFTGKLIRRLSGHSDGVKTLYFDDRK--LITGSLDKTIRVWNYITGEC 374
           TGS D+TI IWDL TGKL   LSGH   VK +    R   + + S DK ++ W+      
Sbjct: 147 TGSNDTTIKIWDLATGKLKLTLSGHIMTVKDICISKRHPYMFSASEDKLVKCWDLEKNRV 206

Query: 375 ISTYRGHSDSVLSVDSYQ--KVIVSGSADKTVKVWHVESR-TCYTLRGHTEWVNCVKLHP 431
           I  Y GH   V +VD +    +I +   D  V++W + ++    T+ GH   +N VK  P
Sbjct: 207 IRDYHGHLSGVHTVDIHPTLNLIATAGRDSVVRLWDIRTKLPVMTMAGHKSPINRVKCLP 266

Query: 432 KSFSCFSCSDDTTIRMWDIRTNSCLKVFRGHVGQVQKI-IPLTIKDVENLATDNTSDGSS 490
                 SCS D T+R+WDI     LKV   H   V+ I I      + +  TD+      
Sbjct: 267 VDPQVVSCSADATVRLWDITAGKTLKVLTHHKRSVRDIGIHPGEFSISSACTDDIRSWKL 326

Query: 491 PQDDPTMTDGADESDTPSNEQETVLDENIPYPTHLLSCGLDN-TIKLWDVKTGKCIR--- 546
           P+    +T+   E     N      D+       +L  G DN  +  +D KTG   +   
Sbjct: 327 PEGQ-LLTNFQSEKTGIINTLSINQDD-------VLFAGSDNGVLSFYDYKTGHKYQQLD 378

Query: 547 -TQF-GHVEGVWDIAADNF-----RIISGSHDGSIKVWDLQSGKCMHTFNG 590
            T+  G +E    I    F     R+I+G  D SIK+W         T+ G
Sbjct: 379 TTEIPGSLESERGILTSTFDQTGLRLITGESDKSIKIWKQDQDATPETYTG 429

 Score = 89.0 bits (219), Expect = 1e-18,   Method: Compositional matrix adjust.
 Identities = 68/268 (25%), Positives = 108/268 (40%), Gaps = 56/268 (20%)

Query: 333 KLIRRLSGHSDGVKTLY---FDDRKLITGSLDKTIRVWNYITGECISTYRGHSDSV--LS 387
           KL+R ++GH+  V+T+     D+    TGS D TI++W+  TG+   T  GH  +V  + 
Sbjct: 120 KLMRVINGHNGWVRTVAVDPIDNEWFATGSNDTTIKIWDLATGKLKLTLSGHIMTVKDIC 179

Query: 388 VDSYQKVIVSGSADKTVKVWHVE-SRTCYTLRGHTEWVNCVKLHPKSFSCFSCSDDTTIR 446
           +      + S S DK VK W +E +R      GH   V+ V +HP      +   D+ +R
Sbjct: 180 ISKRHPYMFSASEDKLVKCWDLEKNRVIRDYHGHLSGVHTVDIHPTLNLIATAGRDSVVR 239

Query: 447 MWDIRTNSCLKVFRGHVGQVQKIIPLTIKDVENLATDNTSDGSSPQDDPTMTDGADESDT 506
           +WDIRT   +    GH   + ++                                     
Sbjct: 240 LWDIRTKLPVMTMAGHKSPINRV------------------------------------- 262

Query: 507 PSNEQETVLDENIPYPTHLLSCGLDNTIKLWDVKTGKCIRTQFGHVEGVWDIA--ADNFR 564
                     + +P    ++SC  D T++LWD+  GK ++    H   V DI      F 
Sbjct: 263 ----------KCLPVDPQVVSCSADATVRLWDITAGKTLKVLTHHKRSVRDIGIHPGEFS 312

Query: 565 IISGSHDGSIKVWDLQSGKCMHTFNGRR 592
           I S   D  I+ W L  G+ +  F   +
Sbjct: 313 ISSACTD-DIRSWKLPEGQLLTNFQSEK 339

 Score = 68.2 bits (165), Expect = 7e-12,   Method: Compositional matrix adjust.
 Identities = 53/179 (29%), Positives = 80/179 (44%), Gaps = 14/179 (7%)

Query: 315 LFTGSYDSTIGIWDLFTGKLIRRLSGHSDGVKTLYFDD--RKLITGSLDKTIRVWNYITG 372
           +F+ S D  +  WDL   ++IR   GH  GV T+        + T   D  +R+W+  T 
Sbjct: 187 MFSASEDKLVKCWDLEKNRVIRDYHGHLSGVHTVDIHPTLNLIATAGRDSVVRLWDIRTK 246

Query: 373 ECISTYRGHSDSV-----LSVDSYQKVIVSGSADKTVKVWHVES-RTCYTLRGHTEWVNC 426
             + T  GH   +     L VD     +VS SAD TV++W + + +T   L  H   V  
Sbjct: 247 LPVMTMAGHKSPINRVKCLPVDPQ---VVSCSADATVRLWDITAGKTLKVLTHHKRSVRD 303

Query: 427 VKLHPKSFSCFS-CSDDTTIRMWDIRTNSCLKVFRGHVGQVQKIIPLTIKDVENLATDN 484
           + +HP  FS  S C+DD  IR W +     L  F+     +   + +   DV    +DN
Sbjct: 304 IGIHPGEFSISSACTDD--IRSWKLPEGQLLTNFQSEKTGIINTLSINQDDVLFAGSDN 360

 Score = 57.0 bits (136), Expect = 3e-08,   Method: Compositional matrix adjust.
 Identities = 43/189 (22%), Positives = 72/189 (38%), Gaps = 50/189 (26%)

Query: 407 WHVESRTCYTLRGHTEWVNCVKLHPKSFSCFSC-SDDTTIRMWDIRTNSCLKVFRGHVGQ 465
           WH   +    + GH  WV  V + P     F+  S+DTTI++WD+ T        GH+  
Sbjct: 115 WHAPWKLMRVINGHNGWVRTVAVDPIDNEWFATGSNDTTIKIWDLATGKLKLTLSGHI-- 172

Query: 466 VQKIIPLTIKDVENLATDNTSDGSSPQDDPTMTDGADESDTPSNEQETVLDENIPYPTHL 525
                 +T+KD+                                     + +  PY   +
Sbjct: 173 ------MTVKDI------------------------------------CISKRHPY---M 187

Query: 526 LSCGLDNTIKLWDVKTGKCIRTQFGHVEGVW--DIAADNFRIISGSHDGSIKVWDLQSGK 583
            S   D  +K WD++  + IR   GH+ GV   DI      I +   D  +++WD+++  
Sbjct: 188 FSASEDKLVKCWDLEKNRVIRDYHGHLSGVHTVDIHPTLNLIATAGRDSVVRLWDIRTKL 247

Query: 584 CMHTFNGRR 592
            + T  G +
Sbjct: 248 PVMTMAGHK 256

>YNL006W (LST8) [4579] chr14 (620066..620977) Protein required for
           transport of permeases from the Golgi to the plasma
           membrane [912 bp, 303 aa]
          Length = 303

 Score = 96.3 bits (238), Expect = 1e-21,   Method: Compositional matrix adjust.
 Identities = 76/288 (26%), Positives = 126/288 (43%), Gaps = 12/288 (4%)

Query: 314 LLFTGSYDSTIGIWDLFTGKLIRRLSGHSDGVKTLYF-DDRKLITGSLDKTIRVWNYITG 372
           +L +  YD TI  W+  TG   R +      V  L   +D+KL+  +  + +R+++  T 
Sbjct: 4   ILVSAGYDHTIRFWEALTGVCSRTIQHSDSQVNRLEITNDKKLLATAGHQNVRLYDIRTT 63

Query: 373 EC--ISTYRGHSDSVLSVDSYQ--KVIVSGSADKTVKVWHVESRTCYTLRGHTEWVNCVK 428
               ++++ GH  +V SV   Q  + +V+ S D T+KVW V S +      H   VN V 
Sbjct: 64  NPNPVASFEGHRGNVTSVSFQQDNRWMVTSSEDGTIKVWDVRSPSIPRNYKHNAPVNEVV 123

Query: 429 LHPKSFSCFSCSDDTTIRMWDIRTNSCLKVFRGHVGQVQKIIPLTIKDVENLATDNTSDG 488
           +HP      SC  D  IR+WD+  N C            + + +   D   LA  NT   
Sbjct: 124 IHPNQGELISCDRDGNIRIWDLGENQCTHQLTPEDDTSLQSLSMA-SDGSMLAAANTKGN 182

Query: 489 SSPQDDPTMTDGADESDTPSNEQETVLDENIPYPT---HLLSCGLDNTIKLWDVKTGKCI 545
               + P  TD +           +     I   +   HL +C  D+T ++W +     +
Sbjct: 183 CYVWEMPNHTDASHLKPVTKFRAHSTYITRILLSSDVKHLATCSADHTARVWSIDDDFKL 242

Query: 546 RTQF-GHVEGVWDIA--ADNFRIISGSHDGSIKVWDLQSGKCMHTFNG 590
            T   GH   VWD A  AD+  +++ S D  +++WDL + + +  + G
Sbjct: 243 ETTLDGHQRWVWDCAFSADSAYLVTASSDHYVRLWDLSTREIVRQYGG 290

 Score = 53.1 bits (126), Expect = 2e-07,   Method: Compositional matrix adjust.
 Identities = 49/225 (21%), Positives = 87/225 (38%), Gaps = 58/225 (25%)

Query: 295 IQEFKGHMDGVLTLQF--NYRLLFTGSYDSTIGIWDLFTGKLIRRLSGHSDGVK--TLYF 350
           +  F+GH   V ++ F  + R + T S D TI +WD+ +  + R    H+  V    ++ 
Sbjct: 68  VASFEGHRGNVTSVSFQQDNRWMVTSSEDGTIKVWDVRSPSIPRNYK-HNAPVNEVVIHP 126

Query: 351 DDRKLITGSLDKTIRVWNYITGEC------------------------------------ 374
           +  +LI+   D  IR+W+    +C                                    
Sbjct: 127 NQGELISCDRDGNIRIWDLGENQCTHQLTPEDDTSLQSLSMASDGSMLAAANTKGNCYVW 186

Query: 375 -------------ISTYRGHSDSV--LSVDSYQKVIVSGSADKTVKVWHVES--RTCYTL 417
                        ++ +R HS  +  + + S  K + + SAD T +VW ++   +   TL
Sbjct: 187 EMPNHTDASHLKPVTKFRAHSTYITRILLSSDVKHLATCSADHTARVWSIDDDFKLETTL 246

Query: 418 RGHTEWVNCVKLHPKSFSCFSCSDDTTIRMWDIRTNSCLKVFRGH 462
            GH  WV        S    + S D  +R+WD+ T   ++ + GH
Sbjct: 247 DGHQRWVWDCAFSADSAYLVTASSDHYVRLWDLSTREIVRQYGGH 291

 Score = 38.9 bits (89), Expect = 0.009,   Method: Compositional matrix adjust.
 Identities = 33/119 (27%), Positives = 46/119 (38%), Gaps = 20/119 (16%)

Query: 290 KGHCRIQEFKGHMDGV-----------------LTLQFNYRLLFTGSYDSTIGIWDLFTG 332
           KG+C + E   H D                   + L  + + L T S D T  +W +   
Sbjct: 180 KGNCYVWEMPNHTDASHLKPVTKFRAHSTYITRILLSSDVKHLATCSADHTARVWSIDDD 239

Query: 333 -KLIRRLSGHSDGVKTLYF--DDRKLITGSLDKTIRVWNYITGECISTYRGHSDSVLSV 388
            KL   L GH   V    F  D   L+T S D  +R+W+  T E +  Y GH    + V
Sbjct: 240 FKLETTLDGHQRWVWDCAFSADSAYLVTASSDHYVRLWDLSTREIVRQYGGHHKGAVCV 298

 Score = 33.1 bits (74), Expect = 0.57,   Method: Compositional matrix adjust.
 Identities = 23/86 (26%), Positives = 36/86 (41%), Gaps = 14/86 (16%)

Query: 269 QTTRPWKVIYRERFKVESNWRKGHCRIQEFKGHMDGVLTLQF--NYRLLFTGSYDSTIGI 326
            T R W +   + FK+E+             GH   V    F  +   L T S D  + +
Sbjct: 229 HTARVWSI--DDDFKLETT----------LDGHQRWVWDCAFSADSAYLVTASSDHYVRL 276

Query: 327 WDLFTGKLIRRLSGHSDGVKTLYFDD 352
           WDL T +++R+  GH  G   +  +D
Sbjct: 277 WDLSTREIVRQYGGHHKGAVCVALND 302

>Scas_721.115*
          Length = 318

 Score = 96.3 bits (238), Expect = 1e-21,   Method: Compositional matrix adjust.
 Identities = 63/189 (33%), Positives = 94/189 (49%), Gaps = 17/189 (8%)

Query: 298 FKGHMDGVLTLQFNY---RLLFTGSYDSTIGIWDLFT-----GKLIRRLSGHSDGVK--T 347
            +GH   V +L  +     LL +GS D T+  W L       G  +R   GHS  V+  T
Sbjct: 13  LEGHNGWVTSLATSAGQPNLLLSGSRDKTLISWKLTGDDQKFGVPVRSFKGHSHIVQDCT 72

Query: 348 LYFDDRKLITGSLDKTIRVWNYITGECISTYRGHSDSVLSV--DSYQKVIVSGSADKTVK 405
           L  D    ++ S DKT+R+W+  TGE    + GH   V+SV  D    +I+SGS DKT+K
Sbjct: 73  LTQDGAYALSASWDKTLRLWDVATGETYQRFVGHKSDVMSVAIDRKASMIISGSRDKTIK 132

Query: 406 VWHVESRTCYTLRGHTEWVNCVKLHPK-----SFSCFSCSDDTTIRMWDIRTNSCLKVFR 460
           VW ++ +   TL GH +WV+ V++ P      S +  S  +D  ++ W++        F 
Sbjct: 133 VWTIKGQCLATLLGHNDWVSQVRIAPTDQNDDSVTVISAGNDKMVKAWNLNQFQIEADFV 192

Query: 461 GHVGQVQKI 469
           GH G V  +
Sbjct: 193 GHNGNVNTV 201

 Score = 61.6 bits (148), Expect = 5e-10,   Method: Compositional matrix adjust.
 Identities = 73/272 (26%), Positives = 108/272 (39%), Gaps = 66/272 (24%)

Query: 338 LSGHSDGVKTLYFDDRK---LITGSLDKTIRVWNYIT-----GECISTYRGHS----DSV 385
           L GH+  V +L     +   L++GS DKT+  W         G  + +++GHS    D  
Sbjct: 13  LEGHNGWVTSLATSAGQPNLLLSGSRDKTLISWKLTGDDQKFGVPVRSFKGHSHIVQDCT 72

Query: 386 LSVDSYQKVIVSGSADKTVKVWHVESRTCYT-LRGHTEWVNCVKLHPKSFSCFSCSDDTT 444
           L+ D      +S S DKT+++W V +   Y    GH   V  V +  K+    S S D T
Sbjct: 73  LTQDG--AYALSASWDKTLRLWDVATGETYQRFVGHKSDVMSVAIDRKASMIISGSRDKT 130

Query: 445 IRMWDIRTNSCLKVFRGH---VGQVQKIIPLTIKDVENLATDNTSDGSSPQDDPTMTDGA 501
           I++W I+   CL    GH   V QV +I P                          TD  
Sbjct: 131 IKVWTIK-GQCLATLLGHNDWVSQV-RIAP--------------------------TDQN 162

Query: 502 DESDTPSNEQETVLDENIPYPTHLLSCGLDNTIKLWDVKTGKCIRTQFGHVEGVWDIAA- 560
           D+S T                  ++S G D  +K W++   +      GH   V  + A 
Sbjct: 163 DDSVT------------------VISAGNDKMVKAWNLNQFQIEADFVGHNGNVNTVTAS 204

Query: 561 -DNFRIISGSHDGSIKVWDLQSGKCMHTFNGR 591
            D   I S   DG I +W+L   K M+T + +
Sbjct: 205 PDGTLIASAGKDGEIMLWNLAEKKAMYTLSAQ 236

 Score = 52.0 bits (123), Expect = 5e-07,   Method: Compositional matrix adjust.
 Identities = 43/178 (24%), Positives = 78/178 (43%), Gaps = 27/178 (15%)

Query: 269 QTTRPWKVIYRERFKVESNWRKGHCRIQEFKGHMDGVLTLQFNYR--LLFTGSYDSTIGI 326
           +T R W V   E +             Q F GH   V+++  + +  ++ +GS D TI +
Sbjct: 87  KTLRLWDVATGETY-------------QRFVGHKSDVMSVAIDRKASMIISGSRDKTIKV 133

Query: 327 WDLFTGKLIRRLSGHSDGVKTLYF-------DDRKLITGSLDKTIRVWNYITGECISTYR 379
           W +  G+ +  L GH+D V  +         D   +I+   DK ++ WN    +  + + 
Sbjct: 134 WTI-KGQCLATLLGHNDWVSQVRIAPTDQNDDSVTVISAGNDKMVKAWNLNQFQIEADFV 192

Query: 380 GHSDSVLSVDSY--QKVIVSGSADKTVKVWHV-ESRTCYTLRGHTEWVNCVKLHPKSF 434
           GH+ +V +V +     +I S   D  + +W++ E +  YTL    E V  +   P  +
Sbjct: 193 GHNGNVNTVTASPDGTLIASAGKDGEIMLWNLAEKKAMYTLSAQDE-VFALAFSPNRY 249

 Score = 35.0 bits (79), Expect = 0.17,   Method: Compositional matrix adjust.
 Identities = 27/91 (29%), Positives = 41/91 (45%), Gaps = 7/91 (7%)

Query: 509 NEQETVLDENIPYPTHLLSCGLDNTIKLW-----DVKTGKCIRTQFGHVEGVWD--IAAD 561
           N   T L  +   P  LLS   D T+  W     D K G  +R+  GH   V D  +  D
Sbjct: 17  NGWVTSLATSAGQPNLLLSGSRDKTLISWKLTGDDQKFGVPVRSFKGHSHIVQDCTLTQD 76

Query: 562 NFRIISGSHDGSIKVWDLQSGKCMHTFNGRR 592
               +S S D ++++WD+ +G+    F G +
Sbjct: 77  GAYALSASWDKTLRLWDVATGETYQRFVGHK 107

>Scas_592.4*
          Length = 318

 Score = 95.9 bits (237), Expect = 2e-21,   Method: Compositional matrix adjust.
 Identities = 62/189 (32%), Positives = 94/189 (49%), Gaps = 17/189 (8%)

Query: 298 FKGHMDGVLTLQFNY---RLLFTGSYDSTIGIWDLFT-----GKLIRRLSGHSDGVK--T 347
            +GH   V +L  +     LL +GS D T+  W L       G  +R   GHS  V+  T
Sbjct: 13  LEGHNGWVTSLATSAGQPNLLLSGSRDKTLISWKLTGDDQKFGVPVRSFKGHSHIVQDCT 72

Query: 348 LYFDDRKLITGSLDKTIRVWNYITGECISTYRGHSDSVLSV--DSYQKVIVSGSADKTVK 405
           L  D    ++ S DKT+R+W+  TGE    + GH   V+SV  D    +I+SGS DKT+K
Sbjct: 73  LTQDGAYALSASWDKTLRLWDVATGETYQRFVGHKSDVMSVAIDRKASMIISGSRDKTIK 132

Query: 406 VWHVESRTCYTLRGHTEWVNCVKLHPK-----SFSCFSCSDDTTIRMWDIRTNSCLKVFR 460
           VW ++ +   TL GH +WV+ V++ P      + +  S  +D  ++ W++        F 
Sbjct: 133 VWTIKGQCLATLLGHNDWVSQVRIAPTDQNDDAVTVISAGNDKMVKAWNLNQFQIEADFV 192

Query: 461 GHVGQVQKI 469
           GH G V  +
Sbjct: 193 GHNGNVNAV 201

 Score = 61.2 bits (147), Expect = 6e-10,   Method: Compositional matrix adjust.
 Identities = 71/272 (26%), Positives = 108/272 (39%), Gaps = 66/272 (24%)

Query: 338 LSGHSDGVKTLYFDDRK---LITGSLDKTIRVWNYIT-----GECISTYRGHS----DSV 385
           L GH+  V +L     +   L++GS DKT+  W         G  + +++GHS    D  
Sbjct: 13  LEGHNGWVTSLATSAGQPNLLLSGSRDKTLISWKLTGDDQKFGVPVRSFKGHSHIVQDCT 72

Query: 386 LSVDSYQKVIVSGSADKTVKVWHVESRTCYT-LRGHTEWVNCVKLHPKSFSCFSCSDDTT 444
           L+ D      +S S DKT+++W V +   Y    GH   V  V +  K+    S S D T
Sbjct: 73  LTQDG--AYALSASWDKTLRLWDVATGETYQRFVGHKSDVMSVAIDRKASMIISGSRDKT 130

Query: 445 IRMWDIRTNSCLKVFRGH---VGQVQKIIPLTIKDVENLATDNTSDGSSPQDDPTMTDGA 501
           I++W I+   CL    GH   V QV +I P                  + Q+D  +T   
Sbjct: 131 IKVWTIK-GQCLATLLGHNDWVSQV-RIAP------------------TDQNDDAVT--- 167

Query: 502 DESDTPSNEQETVLDENIPYPTHLLSCGLDNTIKLWDVKTGKCIRTQFGHVEGVWDIAA- 560
                                  ++S G D  +K W++   +      GH   V  + A 
Sbjct: 168 -----------------------VISAGNDKMVKAWNLNQFQIEADFVGHNGNVNAVTAS 204

Query: 561 -DNFRIISGSHDGSIKVWDLQSGKCMHTFNGR 591
            D   I S   DG I +W+L   K M+T + +
Sbjct: 205 PDGTLIASAGKDGEIMLWNLAEKKAMYTLSAQ 236

 Score = 51.6 bits (122), Expect = 7e-07,   Method: Compositional matrix adjust.
 Identities = 43/178 (24%), Positives = 78/178 (43%), Gaps = 27/178 (15%)

Query: 269 QTTRPWKVIYRERFKVESNWRKGHCRIQEFKGHMDGVLTLQFNYR--LLFTGSYDSTIGI 326
           +T R W V   E +             Q F GH   V+++  + +  ++ +GS D TI +
Sbjct: 87  KTLRLWDVATGETY-------------QRFVGHKSDVMSVAIDRKASMIISGSRDKTIKV 133

Query: 327 WDLFTGKLIRRLSGHSDGVKTLYF-------DDRKLITGSLDKTIRVWNYITGECISTYR 379
           W +  G+ +  L GH+D V  +         D   +I+   DK ++ WN    +  + + 
Sbjct: 134 WTI-KGQCLATLLGHNDWVSQVRIAPTDQNDDAVTVISAGNDKMVKAWNLNQFQIEADFV 192

Query: 380 GHSDSVLSVDSY--QKVIVSGSADKTVKVWHV-ESRTCYTLRGHTEWVNCVKLHPKSF 434
           GH+ +V +V +     +I S   D  + +W++ E +  YTL    E V  +   P  +
Sbjct: 193 GHNGNVNAVTASPDGTLIASAGKDGEIMLWNLAEKKAMYTLSAQDE-VFSLAFSPNRY 249

 Score = 35.0 bits (79), Expect = 0.17,   Method: Compositional matrix adjust.
 Identities = 27/91 (29%), Positives = 41/91 (45%), Gaps = 7/91 (7%)

Query: 509 NEQETVLDENIPYPTHLLSCGLDNTIKLW-----DVKTGKCIRTQFGHVEGVWD--IAAD 561
           N   T L  +   P  LLS   D T+  W     D K G  +R+  GH   V D  +  D
Sbjct: 17  NGWVTSLATSAGQPNLLLSGSRDKTLISWKLTGDDQKFGVPVRSFKGHSHIVQDCTLTQD 76

Query: 562 NFRIISGSHDGSIKVWDLQSGKCMHTFNGRR 592
               +S S D ++++WD+ +G+    F G +
Sbjct: 77  GAYALSASWDKTLRLWDVATGETYQRFVGHK 107

>KLLA0E23529g 2088516..2090996 similar to sp|P38129 Saccharomyces
           cerevisiae YBR198c TAF90 TFIID and SAGA subunit, start
           by similarity
          Length = 826

 Score = 99.4 bits (246), Expect = 2e-21,   Method: Compositional matrix adjust.
 Identities = 85/293 (29%), Positives = 126/293 (43%), Gaps = 76/293 (25%)

Query: 313 RLLFTGSYDSTIGIWDLFTGKL-------------IRRLSGHSDGVKTLYF--DDRKLIT 357
           RL   G  DSTI +W L    L                L GHS  V ++ F  D+R L++
Sbjct: 511 RLTAAGFQDSTIKVWYLDGSPLQSILPSKAKDQSNSATLVGHSGPVYSVAFSPDNRYLLS 570

Query: 358 GSLDKTIRVWNYITGECISTYRGHSDSV--LSVDSYQKVIVSGSADKTVKVWHVESRTCY 415
            S DKT+R+W+  T  C+  Y+GH+  V  +         ++ S D+T ++W  +    Y
Sbjct: 571 ASEDKTVRLWSLDTFTCLVCYKGHNHPVWYVKFSPLGHYFITASHDQTARLWSCDH--IY 628

Query: 416 TLR---GHTEWVNCVKLHPKSFSCFSCSDDTTIRMWDIRTNSCLKVFRGHVGQVQKIIPL 472
            LR   GH   V+C   HP     F+ S D T RMWDI+T   +++F GH        P+
Sbjct: 629 PLRIFSGHLNDVDCSTFHPNGCYVFTGSSDKTCRMWDIQTGDSVRLFLGHTS------PV 682

Query: 473 TIKDVENLATDNTSDGSSPQDDPTMTDGADESDTPSNEQETVLDENIPYPTHLLSCGLDN 532
           T  +V            SP D   +T G++                            D 
Sbjct: 683 TALEV------------SP-DGRWLTTGSE----------------------------DG 701

Query: 533 TIKLWDVKTGKCIRTQFGHVEGVWDIAADNFR-----IISGSHDGSIKVWDLQ 580
           TI +WD+ TGK I+   GH  G   I +  F      +++G  D S++VWD++
Sbjct: 702 TIIVWDIGTGKRIKQMKGH--GKNPIYSITFNKEGNCLVTGGADQSVRVWDIK 752

 Score = 78.2 bits (191), Expect = 1e-14,   Method: Compositional matrix adjust.
 Identities = 68/262 (25%), Positives = 106/262 (40%), Gaps = 68/262 (25%)

Query: 349 YFDDRKLIT-GSLDKTIRVWNYITGECI--------------STYRGHSDSVLSV--DSY 391
           + DD +L   G  D TI+VW Y+ G  +              +T  GHS  V SV     
Sbjct: 506 FSDDARLTAAGFQDSTIKVW-YLDGSPLQSILPSKAKDQSNSATLVGHSGPVYSVAFSPD 564

Query: 392 QKVIVSGSADKTVKVWHVESRTCYT-LRGHTEWVNCVKLHPKSFSCFSCSDDTTIRMWDI 450
            + ++S S DKTV++W +++ TC    +GH   V  VK  P      + S D T R+W  
Sbjct: 565 NRYLLSASEDKTVRLWSLDTFTCLVCYKGHNHPVWYVKFSPLGHYFITASHDQTARLWSC 624

Query: 451 RTNSCLKVFRGHVGQVQKIIPLTIKDVENLATDNTSDGSSPQDDPTMTDGADESDTPSNE 510
                L++F GH+                    N  D S+                    
Sbjct: 625 DHIYPLRIFSGHL--------------------NDVDCSTFH------------------ 646

Query: 511 QETVLDENIPYPTHLLSCGLDNTIKLWDVKTGKCIRTQFGHVEGV--WDIAADNFRIISG 568
                    P   ++ +   D T ++WD++TG  +R   GH   V   +++ D   + +G
Sbjct: 647 ---------PNGCYVFTGSSDKTCRMWDIQTGDSVRLFLGHTSPVTALEVSPDGRWLTTG 697

Query: 569 SHDGSIKVWDLQSGKCMHTFNG 590
           S DG+I VWD+ +GK +    G
Sbjct: 698 SEDGTIIVWDIGTGKRIKQMKG 719

>ACR137W [1184] [Homologous to ScYPL151C (PRP46) - SH]
           complement(590077..591354) [1278 bp, 425 aa]
          Length = 425

 Score = 97.4 bits (241), Expect = 2e-21,   Method: Compositional matrix adjust.
 Identities = 76/269 (28%), Positives = 111/269 (41%), Gaps = 56/269 (20%)

Query: 333 KLIRRLSGHSDGVKTL---YFDDRKLITGSLDKTIRVWNYITGECISTYRGHSDSV--LS 387
           KL R ++GH+  V+ +     D+    TGS D TIRVW+  TG+   T +GH  +V  + 
Sbjct: 104 KLTRVINGHTGWVRCVCVDPVDNAWFATGSNDSTIRVWDLATGKLKVTLQGHIMTVRDIC 163

Query: 388 VDSYQKVIVSGSADKTVKVWHVESRTCYT-LRGHTEWVNCVKLHPKSFSCFSCSDDTTIR 446
           + +    + S S DK VK W +E  T      G    V+ V LHP      S   D+ +R
Sbjct: 164 ISARHPYMFSASQDKLVKCWDLERNTVVRDFHGTLSGVHSVDLHPSLDLIVSAGRDSVVR 223

Query: 447 MWDIRTNSCLKVFRGHVGQVQKIIPLTIKDVENLATDNTSDGSSPQDDPTMTDGADESDT 506
           +WDIR+ SC+    GH G + K+                                     
Sbjct: 224 VWDIRSRSCVLTLAGHRGPINKV------------------------------------- 246

Query: 507 PSNEQETVLDENIPYPTHLLSCGLDNTIKLWDVKTGKCIRTQFGHVEGVWDIAAD--NFR 564
                       +P    ++SC  D T+KLWD+  GK ++T   H   V D+A +   F 
Sbjct: 247 ----------RCLPVDPQIVSCSTDATVKLWDLVAGKPMKTLTHHKRNVRDLAFNPTEFS 296

Query: 565 IISGSHDGSIKVWDLQSGKCMHTFNGRRL 593
             S   D  I+ W L  G+ +  FN   L
Sbjct: 297 FASACTD-DIRSWKLVDGQLLTNFNSEAL 324

 Score = 89.4 bits (220), Expect = 9e-19,   Method: Compositional matrix adjust.
 Identities = 84/294 (28%), Positives = 125/294 (42%), Gaps = 31/294 (10%)

Query: 317 TGSYDSTIGIWDLFTGKLIRRLSGHSDGVKTLYFDDRK--LITGSLDKTIRVWNYITGEC 374
           TGS DSTI +WDL TGKL   L GH   V+ +    R   + + S DK ++ W+      
Sbjct: 131 TGSNDSTIRVWDLATGKLKVTLQGHIMTVRDICISARHPYMFSASQDKLVKCWDLERNTV 190

Query: 375 ISTYRGHSDSVLSVDSYQK--VIVSGSADKTVKVWHVESRTC-YTLRGHTEWVNCVKLHP 431
           +  + G    V SVD +    +IVS   D  V+VW + SR+C  TL GH   +N V+  P
Sbjct: 191 VRDFHGTLSGVHSVDLHPSLDLIVSAGRDSVVRVWDIRSRSCVLTLAGHRGPINKVRCLP 250

Query: 432 KSFSCFSCSDDTTIRMWDIRTNSCLKVFRGHVGQVQKIIPLTIKDVENLATDNT--SDGS 489
                 SCS D T+++WD+     +K    H            ++V +LA + T  S  S
Sbjct: 251 VDPQIVSCSTDATVKLWDLVAGKPMKTLTHHK-----------RNVRDLAFNPTEFSFAS 299

Query: 490 SPQDDP---TMTDGADESDTPSNEQETVLDENIPYPTHLLSCGLDNTIKLWDVKTGKCIR 546
           +  DD     + DG   ++  S     V          L + G    +  +D KTG   +
Sbjct: 300 ACTDDIRSWKLVDGQLLTNFNSEALGIVNTLACNQDGVLFAGGDTGELSFFDYKTGHKFQ 359

Query: 547 -----TQFGHVEGVWDIAADNF-----RIISGSHDGSIKVWDLQSGKCMHTFNG 590
                   G +E    + A  F     R+++   D SIK+W    G    +  G
Sbjct: 360 KLETTAMPGSLESEKGVLASTFDRTGLRLLTCERDKSIKIWKHIDGATQDSHPG 413

 Score = 70.9 bits (172), Expect = 8e-13,   Method: Compositional matrix adjust.
 Identities = 51/190 (26%), Positives = 93/190 (48%), Gaps = 18/190 (9%)

Query: 407 WHVESRTCYTLRGHTEWVNCVKLHPKSFSCFSC-SDDTTIRMWDIRTNSCLKVFRGHVGQ 465
           WH   +    + GHT WV CV + P   + F+  S+D+TIR+WD+ T       +GH+  
Sbjct: 99  WHAPWKLTRVINGHTGWVRCVCVDPVDNAWFATGSNDSTIRVWDLATGKLKVTLQGHI-- 156

Query: 466 VQKIIPLTIKDVENLATDNTSDGSSPQDDPTMTDGADESDTPSNEQETVLDENI----PY 521
                 +T++D+  ++  +    S+ QD        + +    +   T+   +     P 
Sbjct: 157 ------MTVRDI-CISARHPYMFSASQDKLVKCWDLERNTVVRDFHGTLSGVHSVDLHPS 209

Query: 522 PTHLLSCGLDNTIKLWDVKTGKCIRTQFGH---VEGVWDIAADNFRIISGSHDGSIKVWD 578
              ++S G D+ +++WD+++  C+ T  GH   +  V  +  D  +I+S S D ++K+WD
Sbjct: 210 LDLIVSAGRDSVVRVWDIRSRSCVLTLAGHRGPINKVRCLPVDP-QIVSCSTDATVKLWD 268

Query: 579 LQSGKCMHTF 588
           L +GK M T 
Sbjct: 269 LVAGKPMKTL 278

 Score = 42.0 bits (97), Expect = 0.001,   Method: Compositional matrix adjust.
 Identities = 24/96 (25%), Positives = 52/96 (54%), Gaps = 6/96 (6%)

Query: 295 IQEFKGHMDGV--LTLQFNYRLLFTGSYDSTIGIWDLFTGKLIRRLSGHS---DGVKTLY 349
           +++F G + GV  + L  +  L+ +   DS + +WD+ +   +  L+GH    + V+ L 
Sbjct: 191 VRDFHGTLSGVHSVDLHPSLDLIVSAGRDSVVRVWDIRSRSCVLTLAGHRGPINKVRCLP 250

Query: 350 FDDRKLITGSLDKTIRVWNYITGECISTYRGHSDSV 385
            D  ++++ S D T+++W+ + G+ + T   H  +V
Sbjct: 251 VDP-QIVSCSTDATVKLWDLVAGKPMKTLTHHKRNV 285

>YPL151C (PRP46) [5296] chr16 complement(266179..267534) Putative
           spliceosomal protein with similarity to S. pombe prp5p,
           has four WD (WD-40) repeats [1356 bp, 451 aa]
          Length = 451

 Score = 97.1 bits (240), Expect = 4e-21,   Method: Compositional matrix adjust.
 Identities = 79/281 (28%), Positives = 124/281 (44%), Gaps = 27/281 (9%)

Query: 315 LFTGSYDSTIGIWDLFTGKLIRRLSGHSDGVKTLYFDDRK--LITGSLDKTIRVWNYITG 372
             TGS D+T+ +WDL TGKL   L+GH   V+ +   DR   L + S DKT++ W+    
Sbjct: 155 FITGSNDTTMKVWDLATGKLKTTLAGHVMTVRDVAVSDRHPYLFSVSEDKTVKCWDLEKN 214

Query: 373 ECISTYRGHSDSV--LSVDSYQKVIVSGSADKTVKVWHVESRT-CYTLRGHTEWVNCVKL 429
           + I  Y GH   V  +S+     +I +   D  +K+W + +R    TL GH   +N V+ 
Sbjct: 215 QIIRDYYGHLSGVRTVSIHPTLDLIATAGRDSVIKLWDMRTRIPVITLVGHKGPINQVQC 274

Query: 430 HPKSFSCFSCSDDTTIRMWDIRTNSCLKVFRGHVGQVQKIIPLTIKDVENLATDNTSDGS 489
            P      S S D T+R+WD+     +KV   H   V+            L     S  S
Sbjct: 275 TPVDPQVVSSSTDATVRLWDVVAGKTMKVLTHHKRSVRATA---------LHPKEFSVAS 325

Query: 490 SPQDDPT---MTDGADESDTPSNEQETVLDENIPYPTHLLSCGLDNTIKLWDVKTGK--- 543
           +  DD     + +G+  ++  S +   +   +I     L + G +  +  +D K+G    
Sbjct: 326 ACTDDIRSWGLAEGSLLTNFESEKTGIINTLSINQDDVLFAGGDNGVLSFYDYKSGHKYQ 385

Query: 544 --CIRTQFGHVEGVWDIAADNF-----RIISGSHDGSIKVW 577
               R   G +EG   +    F     R+I+G  D SIK+W
Sbjct: 386 SLATREMVGSLEGERSVLCSTFDKTGLRLITGEADKSIKIW 426

 Score = 77.4 bits (189), Expect = 8e-15,   Method: Compositional matrix adjust.
 Identities = 67/268 (25%), Positives = 105/268 (39%), Gaps = 56/268 (20%)

Query: 333 KLIRRLSGHSDGVKTLYFD---DRKLITGSLDKTIRVWNYITGECISTYRGHSDSV--LS 387
           KL R ++GH   V+ +  D   +   ITGS D T++VW+  TG+  +T  GH  +V  ++
Sbjct: 130 KLSRVINGHLGWVRCVAIDPVDNEWFITGSNDTTMKVWDLATGKLKTTLAGHVMTVRDVA 189

Query: 388 VDSYQKVIVSGSADKTVKVWHVE-SRTCYTLRGHTEWVNCVKLHPKSFSCFSCSDDTTIR 446
           V      + S S DKTVK W +E ++      GH   V  V +HP      +   D+ I+
Sbjct: 190 VSDRHPYLFSVSEDKTVKCWDLEKNQIIRDYYGHLSGVRTVSIHPTLDLIATAGRDSVIK 249

Query: 447 MWDIRTNSCLKVFRGHVGQVQKIIPLTIKDVENLATDNTSDGSSPQDDPTMTDGADESDT 506
           +WD+RT   +    GH G + ++                                     
Sbjct: 250 LWDMRTRIPVITLVGHKGPINQV------------------------------------- 272

Query: 507 PSNEQETVLDENIPYPTHLLSCGLDNTIKLWDVKTGKCIRTQFGHVEGVWDIA--ADNFR 564
                     +  P    ++S   D T++LWDV  GK ++    H   V   A     F 
Sbjct: 273 ----------QCTPVDPQVVSSSTDATVRLWDVVAGKTMKVLTHHKRSVRATALHPKEFS 322

Query: 565 IISGSHDGSIKVWDLQSGKCMHTFNGRR 592
           + S   D  I+ W L  G  +  F   +
Sbjct: 323 VASACTD-DIRSWGLAEGSLLTNFESEK 349

 Score = 65.1 bits (157), Expect = 7e-11,   Method: Compositional matrix adjust.
 Identities = 55/221 (24%), Positives = 94/221 (42%), Gaps = 23/221 (10%)

Query: 407 WHVESRTCYTLRGHTEWVNCVKLHPKSFSCF-SCSDDTTIRMWDIRTNSCLKVFRGHVGQ 465
           WH   +    + GH  WV CV + P     F + S+DTT+++WD+ T        GHV  
Sbjct: 125 WHAPWKLSRVINGHLGWVRCVAIDPVDNEWFITGSNDTTMKVWDLATGKLKTTLAGHV-- 182

Query: 466 VQKIIPLTIKDVENLATDNTSDGSSPQDDPTMTDGADESDTPSNEQETVLDENIPYPTH- 524
                 +T++DV    +D      S  +D T+     E +    +    L        H 
Sbjct: 183 ------MTVRDVA--VSDRHPYLFSVSEDKTVKCWDLEKNQIIRDYYGHLSGVRTVSIHP 234

Query: 525 ----LLSCGLDNTIKLWDVKTGKCIRTQFGHVEGVWDIAADNF--RIISGSHDGSIKVWD 578
               + + G D+ IKLWD++T   + T  GH   +  +       +++S S D ++++WD
Sbjct: 235 TLDLIATAGRDSVIKLWDMRTRIPVITLVGHKGPINQVQCTPVDPQVVSSSTDATVRLWD 294

Query: 579 LQSGKCMHTFNGRRLQRETQHTQTQSLGDKVAPIACVCIGD 619
           + +GK M     + L    +  +  +L  K   +A  C  D
Sbjct: 295 VVAGKTM-----KVLTHHKRSVRATALHPKEFSVASACTDD 330

>Scas_721.32
          Length = 822

 Score = 98.6 bits (244), Expect = 4e-21,   Method: Compositional matrix adjust.
 Identities = 86/315 (27%), Positives = 125/315 (39%), Gaps = 81/315 (25%)

Query: 298 FKGHMDGVLTLQF--NYRLLFTGSYDSTIGIWDLFTGKLIR------------------- 336
           F     G+ +LQF  + RL+  G  DS I +W L    L +                   
Sbjct: 483 FHNTNGGMTSLQFSEDSRLVAAGFQDSYIKLWSLDGSSLKQIQEKSADSINTGDMNDNTS 542

Query: 337 -RLSGHSDGVKTLYF--DDRKLITGSLDKTIRVWNYITGECISTYRGHSDSVLSV--DSY 391
             L GHS  V +  F  D+R L++GS DKT+R+W+  T   + +Y+GH+  V  V     
Sbjct: 543 TTLIGHSGAVYSTSFSPDNRYLLSGSEDKTVRLWSTDTYTSLVSYKGHNHPVWDVQFSPL 602

Query: 392 QKVIVSGSADKTVKVWHVESRTCYTLR---GHTEWVNCVKLHPKSFSCFSCSDDTTIRMW 448
                + S D+T ++W  +    Y LR   GH   V+CV  HP     F+ S D T RMW
Sbjct: 603 GHYFATASHDQTARLWSCDH--IYPLRIFAGHLSDVDCVSFHPNGCYVFTGSSDKTCRMW 660

Query: 449 DIRTNSCLKVFRGHVGQVQKIIPLTIKDVENLATDNTSDGSSPQDDPTMTDGADESDTPS 508
           DI T   +++F GH   V             L T  + DG                    
Sbjct: 661 DISTGDSVRLFLGHTAPV-------------LCTAVSPDGR------------------- 688

Query: 509 NEQETVLDENIPYPTHLLSCGLDNTIKLWDVKTGKCIRTQFGHVEGV---WDIAADNFRI 565
                           L +   D  I LWD+ T K ++   GH +          +   +
Sbjct: 689 ---------------WLATGSEDGIINLWDIGTAKRLKVMRGHGKNAIHSLSYCKEGNVL 733

Query: 566 ISGSHDGSIKVWDLQ 580
           +SG  D S++VWDL+
Sbjct: 734 VSGGADHSVRVWDLK 748

 Score = 70.9 bits (172), Expect = 2e-12,   Method: Compositional matrix adjust.
 Identities = 46/124 (37%), Positives = 65/124 (52%), Gaps = 7/124 (5%)

Query: 298 FKGHMDGVLTLQF--NYRLLFTGSYDSTIGIWDLFTGKLIRRLSGHSDGV--KTLYFDDR 353
           F GH+  V  + F  N   +FTGS D T  +WD+ TG  +R   GH+  V    +  D R
Sbjct: 629 FAGHLSDVDCVSFHPNGCYVFTGSSDKTCRMWDISTGDSVRLFLGHTAPVLCTAVSPDGR 688

Query: 354 KLITGSLDKTIRVWNYITGECISTYRGHSDSVLSVDSYQK---VIVSGSADKTVKVWHVE 410
            L TGS D  I +W+  T + +   RGH  + +   SY K   V+VSG AD +V+VW ++
Sbjct: 689 WLATGSEDGIINLWDIGTAKRLKVMRGHGKNAIHSLSYCKEGNVLVSGGADHSVRVWDLK 748

Query: 411 SRTC 414
             T 
Sbjct: 749 KSTA 752

>AFR199C [3391] [Homologous to ScYMR116C (ASC1) - SH]
           (799876..800298,800493..801074) [1005 bp, 334 aa]
          Length = 334

 Score = 94.7 bits (234), Expect = 6e-21,   Method: Compositional matrix adjust.
 Identities = 58/172 (33%), Positives = 89/172 (51%), Gaps = 14/172 (8%)

Query: 314 LLFTGSYDSTIGIWDLFT-----GKLIRRLSGHSDGVK--TLYFDDRKLITGSLDKTIRV 366
           +L +GS D T+  W L       G  +R   GHS  V+  T+  D +  ++ S DKT+R+
Sbjct: 48  MLLSGSRDKTLITWKLTGEDQQYGVPVRSFKGHSHIVQDCTVTHDGKYALSASWDKTLRL 107

Query: 367 WNYITGECISTYRGHSDSVLSV--DSYQKVIVSGSADKTVKVWHVESRTCYTLRGHTEWV 424
           W+  +G+CI  + GH   V+SV  D     IVS S DKTVKVW+       TL GH +WV
Sbjct: 108 WDLQSGKCIKRFVGHKSDVMSVSIDPRATQIVSASRDKTVKVWNTVGDCVVTLLGHNDWV 167

Query: 425 NCVKLHPK-----SFSCFSCSDDTTIRMWDIRTNSCLKVFRGHVGQVQKIIP 471
           + V++ P      + +  S   D  +++WD+++ +    F GH   V  + P
Sbjct: 168 SNVRIAPSEKSDDAVTVISAGMDKVVKVWDLQSFTIEADFIGHNNYVTTVTP 219

 Score = 62.8 bits (151), Expect = 2e-10,   Method: Compositional matrix adjust.
 Identities = 64/268 (23%), Positives = 108/268 (40%), Gaps = 58/268 (21%)

Query: 338 LSGHSDGVKTLYFDDRK---LITGSLDKTIRVWNYITGE------CISTYRGHSDSV--L 386
           L GH+  V +L     +   L++GS DKT+  W  +TGE       + +++GHS  V   
Sbjct: 29  LEGHNGWVTSLSTSPAQPNMLLSGSRDKTLITWK-LTGEDQQYGVPVRSFKGHSHIVQDC 87

Query: 387 SVDSYQKVIVSGSADKTVKVWHVESRTCYT-LRGHTEWVNCVKLHPKSFSCFSCSDDTTI 445
           +V    K  +S S DKT+++W ++S  C     GH   V  V + P++    S S D T+
Sbjct: 88  TVTHDGKYALSASWDKTLRLWDLQSGKCIKRFVGHKSDVMSVSIDPRATQIVSASRDKTV 147

Query: 446 RMWDIRTNSCLKVFRGHVGQVQKIIPLTIKDVENLATDNTSDGSSPQDDPTMTDGADESD 505
           ++W+     C+    GH                N    N     S + D  +T       
Sbjct: 148 KVWN-TVGDCVVTLLGH----------------NDWVSNVRIAPSEKSDDAVT------- 183

Query: 506 TPSNEQETVLDENIPYPTHLLSCGLDNTIKLWDVKTGKCIRTQFGHVEGVWDI--AADNF 563
                              ++S G+D  +K+WD+++        GH   V  +  + D  
Sbjct: 184 -------------------VISAGMDKVVKVWDLQSFTIEADFIGHNNYVTTVTPSPDGS 224

Query: 564 RIISGSHDGSIKVWDLQSGKCMHTFNGR 591
              S   DG I +W+L     ++T + +
Sbjct: 225 IFASAGKDGQIILWNLNEKTALYTLDAK 252

 Score = 52.0 bits (123), Expect = 7e-07,   Method: Compositional matrix adjust.
 Identities = 44/202 (21%), Positives = 91/202 (45%), Gaps = 25/202 (12%)

Query: 276 VIYRERFKVESNWRK---------GHCRIQEFKGHMDGVLTLQFNYRL--LFTGSYDSTI 324
           V +  ++ + ++W K         G C I+ F GH   V+++  + R   + + S D T+
Sbjct: 89  VTHDGKYALSASWDKTLRLWDLQSGKC-IKRFVGHKSDVMSVSIDPRATQIVSASRDKTV 147

Query: 325 GIWDLFTGKLIRRLSGHSDGVKTLYF-------DDRKLITGSLDKTIRVWNYITGECIST 377
            +W+   G  +  L GH+D V  +         D   +I+  +DK ++VW+  +    + 
Sbjct: 148 KVWNT-VGDCVVTLLGHNDWVSNVRIAPSEKSDDAVTVISAGMDKVVKVWDLQSFTIEAD 206

Query: 378 YRGHSDSVLSVDSYQ--KVIVSGSADKTVKVWHVESRTC-YTLRGHTEWVNCVKLHPKSF 434
           + GH++ V +V       +  S   D  + +W++  +T  YTL    E V  V   P  +
Sbjct: 207 FIGHNNYVTTVTPSPDGSIFASAGKDGQIILWNLNEKTALYTLDAKDE-VFAVAFSPNRY 265

Query: 435 SCFSCSDDTTIRMWDIRTNSCL 456
              + +  + I+++D+   + +
Sbjct: 266 -WLTAATASGIKIFDLEERTIV 286

 Score = 44.3 bits (103), Expect = 2e-04,   Method: Compositional matrix adjust.
 Identities = 31/91 (34%), Positives = 44/91 (48%), Gaps = 7/91 (7%)

Query: 509 NEQETVLDENIPYPTHLLSCGLDNTIKLW-----DVKTGKCIRTQFGHVEGVWD--IAAD 561
           N   T L  +   P  LLS   D T+  W     D + G  +R+  GH   V D  +  D
Sbjct: 33  NGWVTSLSTSPAQPNMLLSGSRDKTLITWKLTGEDQQYGVPVRSFKGHSHIVQDCTVTHD 92

Query: 562 NFRIISGSHDGSIKVWDLQSGKCMHTFNGRR 592
               +S S D ++++WDLQSGKC+  F G +
Sbjct: 93  GKYALSASWDKTLRLWDLQSGKCIKRFVGHK 123

>Scas_695.15
          Length = 327

 Score = 94.0 bits (232), Expect = 1e-20,   Method: Compositional matrix adjust.
 Identities = 83/306 (27%), Positives = 133/306 (43%), Gaps = 44/306 (14%)

Query: 314 LLFTGSYDSTIGIWDLFTGKLIRRLSGHSDGVKTLYF-DDRKLITGSLDKTIRVWNYITG 372
           +L +  YD TI  W+  TG   R +      V  L   +D+KL+  +  + +R+++  T 
Sbjct: 24  ILVSAGYDHTIRFWEALTGVCSRTIQHSDSQVNRLEITNDKKLLAAAGYQNVRLYDIRTT 83

Query: 373 E--CISTYRGHSDSVLSVDSYQ--KVIVSGSADKTVKVWHVESRTCYTLRGHTEWVNCVK 428
               ++T+ GH  +V SV   Q  K +V+ S D T+KVW V S +      H   VN V 
Sbjct: 84  NPNAVATFEGHKGNVTSVSFQQDNKWMVTSSEDGTIKVWDVRSPSVPRNYKHNAPVNEVV 143

Query: 429 LHPKSFSCFSCSDDTTIRMWDIRTNSCLKVFRGHVGQVQKIIP---------LTIK-DVE 478
           +HP      SC  D TI++WD+  N C            ++IP         L++  D  
Sbjct: 144 IHPNQGELISCDRDGTIKIWDLGENQC----------THQLIPDDDNTSLQSLSVASDGS 193

Query: 479 NLATDNTSDGSSPQDDPTMTDGADESDTPSNE--------QETVLDENIPYPTHLLSCGL 530
            L   N        + P  TD ++    P N+           VL  ++    H+ +C  
Sbjct: 194 MLVAANNKGDCYVWEMPNHTDASNLK--PINKFSAHKDYITRVVLSSDVK---HMATCSA 248

Query: 531 DNTIKLWDVKTGK----CIRTQFGHVEGVWDIA--ADNFRIISGSHDGSIKVWDLQSGKC 584
           D T K+W V   +       T  GH   VWD A  AD+  +++ S D  +++WDL + + 
Sbjct: 249 DRTAKIWSVGETEDDFNLETTLDGHQRWVWDCAFSADSAYLVTASSDHYVRLWDLSTREI 308

Query: 585 MHTFNG 590
           +  + G
Sbjct: 309 VRQYGG 314

 Score = 50.8 bits (120), Expect = 2e-06,   Method: Compositional matrix adjust.
 Identities = 51/229 (22%), Positives = 88/229 (38%), Gaps = 62/229 (27%)

Query: 295 IQEFKGHMDGVLTLQF--NYRLLFTGSYDSTIGIWDLFTGKLIRRLSGHSDGVK--TLYF 350
           +  F+GH   V ++ F  + + + T S D TI +WD+ +  + R    H+  V    ++ 
Sbjct: 88  VATFEGHKGNVTSVSFQQDNKWMVTSSEDGTIKVWDVRSPSVPRNYK-HNAPVNEVVIHP 146

Query: 351 DDRKLITGSLDKTIRVWNYITGEC------------------------------------ 374
           +  +LI+   D TI++W+    +C                                    
Sbjct: 147 NQGELISCDRDGTIKIWDLGENQCTHQLIPDDDNTSLQSLSVASDGSMLVAANNKGDCYV 206

Query: 375 --------------ISTYRGHSDSVLSV--DSYQKVIVSGSADKTVKVWHV-ESRTCY-- 415
                         I+ +  H D +  V   S  K + + SAD+T K+W V E+   +  
Sbjct: 207 WEMPNHTDASNLKPINKFSAHKDYITRVVLSSDVKHMATCSADRTAKIWSVGETEDDFNL 266

Query: 416 --TLRGHTEWVNCVKLHPKSFSCFSCSDDTTIRMWDIRTNSCLKVFRGH 462
             TL GH  WV        S    + S D  +R+WD+ T   ++ + GH
Sbjct: 267 ETTLDGHQRWVWDCAFSADSAYLVTASSDHYVRLWDLSTREIVRQYGGH 315

 Score = 38.1 bits (87), Expect = 0.016,   Method: Compositional matrix adjust.
 Identities = 30/102 (29%), Positives = 44/102 (43%), Gaps = 8/102 (7%)

Query: 295 IQEFKGHMDGV--LTLQFNYRLLFTGSYDSTIGIWDLFTGK----LIRRLSGHSDGVKTL 348
           I +F  H D +  + L  + + + T S D T  IW +   +    L   L GH   V   
Sbjct: 221 INKFSAHKDYITRVVLSSDVKHMATCSADRTAKIWSVGETEDDFNLETTLDGHQRWVWDC 280

Query: 349 YF--DDRKLITGSLDKTIRVWNYITGECISTYRGHSDSVLSV 388
            F  D   L+T S D  +R+W+  T E +  Y GH    + V
Sbjct: 281 AFSADSAYLVTASSDHYVRLWDLSTREIVRQYGGHHKGAVCV 322

 Score = 31.6 bits (70), Expect = 1.8,   Method: Compositional matrix adjust.
 Identities = 13/38 (34%), Positives = 21/38 (55%)

Query: 315 LFTGSYDSTIGIWDLFTGKLIRRLSGHSDGVKTLYFDD 352
           L T S D  + +WDL T +++R+  GH  G   +  +D
Sbjct: 289 LVTASSDHYVRLWDLSTREIVRQYGGHHKGAVCVALND 326

>CAGL0M05335g complement(569132..571552) similar to sp|P38129
           Saccharomyces cerevisiae YBR198c Transcription
           initiation factor TFIID 90, hypothetical start
          Length = 806

 Score = 96.7 bits (239), Expect = 1e-20,   Method: Compositional matrix adjust.
 Identities = 85/298 (28%), Positives = 118/298 (39%), Gaps = 77/298 (25%)

Query: 313 RLLFTGSYDSTIGIWDLFTGKLIR------------------RLSGHSDGVKTLYF--DD 352
           RL   G  DS I IW L    LI                    L GHS  V +  F  D+
Sbjct: 486 RLAAAGFQDSYIKIWSLDGSSLINPKYSSSQFDRFSQDNTCSTLVGHSGTVYSTSFSPDN 545

Query: 353 RKLITGSLDKTIRVWNYITGECISTYRGHSDSVLSV--DSYQKVIVSGSADKTVKVWHVE 410
             L++GS DKT+++W+  T   +  Y+GH+  V  V          S S D+T ++W  +
Sbjct: 546 MYLVSGSEDKTVKLWSMDTHTALVNYKGHNHPVWDVKFSPLGHYFASASHDQTARLWACD 605

Query: 411 SRTCYTLR---GHTEWVNCVKLHPKSFSCFSCSDDTTIRMWDIRTNSCLKVFRGHVGQVQ 467
               Y LR   GHT  V+ V  HP     F+ S D T RMWD+ T   +++F GH   V 
Sbjct: 606 H--IYPLRIFAGHTNDVDTVSFHPNGCYVFTGSSDKTCRMWDVSTGDSVRLFLGHTAPV- 662

Query: 468 KIIPLTIKDVENLATDNTSDGSSPQDDPTMTDGADESDTPSNEQETVLDENIPYPTHLLS 527
                       L+T  + DG                                    L +
Sbjct: 663 ------------LSTQVSPDGR----------------------------------WLAT 676

Query: 528 CGLDNTIKLWDVKTGKCIRTQFGHVEGVWDIAADNFR---IISGSHDGSIKVWDLQSG 582
              D  I LWD+ TGK I+   GH +      + N     +ISG  D S++VWD++ G
Sbjct: 677 GSEDGVICLWDIGTGKRIKQMRGHGKNAVHSLSFNKEGNVLISGGADHSVRVWDVKHG 734

 Score = 72.0 bits (175), Expect = 7e-13,   Method: Compositional matrix adjust.
 Identities = 53/199 (26%), Positives = 95/199 (47%), Gaps = 14/199 (7%)

Query: 292 HCRIQEFKGHMDGVLTLQFNY--RLLFTGSYDSTIGIWDLFTGKLIRRLSGHSDGVKTLY 349
           H  +  +KGH   V  ++F+       + S+D T  +W       +R  +GH++ V T+ 
Sbjct: 565 HTALVNYKGHNHPVWDVKFSPLGHYFASASHDQTARLWACDHIYPLRIFAGHTNDVDTVS 624

Query: 350 FDDRK--LITGSLDKTIRVWNYITGECISTYRGHSDSVLS--VDSYQKVIVSGSADKTVK 405
           F      + TGS DKT R+W+  TG+ +  + GH+  VLS  V    + + +GS D  + 
Sbjct: 625 FHPNGCYVFTGSSDKTCRMWDVSTGDSVRLFLGHTAPVLSTQVSPDGRWLATGSEDGVIC 684

Query: 406 VWHVES-RTCYTLRGHTE-WVNCVKLHPKSFSCFSCSDDTTIRMWDIRTNSC------LK 457
           +W + + +    +RGH +  V+ +  + +     S   D ++R+WD++  +        +
Sbjct: 685 LWDIGTGKRIKQMRGHGKNAVHSLSFNKEGNVLISGGADHSVRVWDVKHGTTEQGPEPEQ 744

Query: 458 VFRGHVGQVQKIIPLTIKD 476
            F  HVG +   I   IKD
Sbjct: 745 PFNAHVGDITASINQDIKD 763

 Score = 37.7 bits (86), Expect = 0.027,   Method: Compositional matrix adjust.
 Identities = 25/88 (28%), Positives = 35/88 (39%), Gaps = 7/88 (7%)

Query: 520 PYPTHLLSCGLDNTIKLWDVKTGKCIRTQFGHVEGVWDIAADNF--RIISGSHDGSIKVW 577
           P   +L+S   D T+KLW + T   +    GH   VWD+          S SHD + ++W
Sbjct: 543 PDNMYLVSGSEDKTVKLWSMDTHTALVNYKGHNHPVWDVKFSPLGHYFASASHDQTARLW 602

Query: 578 DLQSGKCMHTFNGRRLQRETQHTQTQSL 605
                 C H +  R     T    T S 
Sbjct: 603 -----ACDHIYPLRIFAGHTNDVDTVSF 625

>KLLA0D04840g 413362..414273 highly similar to sp|P41318
           Saccharomyces cerevisiae YNL006w LST8 required for
           transport of permeases from the golgi to the plasma
           membrane, start by similarity
          Length = 303

 Score = 92.4 bits (228), Expect = 2e-20,   Method: Compositional matrix adjust.
 Identities = 76/299 (25%), Positives = 132/299 (44%), Gaps = 34/299 (11%)

Query: 314 LLFTGSYDSTIGIWDLFTGKLIRRLSGHSDGVKTLYF-DDRKLITGSLDKTIRVWNYITG 372
           +L +  YD TI  W+  TG   R +      V  L    D+K +  +    +R+++  + 
Sbjct: 4   ILASAGYDHTIRFWEALTGVCSRTIQHADSQVNRLEITSDKKYLAAAGHLHVRLYDIRSN 63

Query: 373 EC--ISTYRGHSDSVLSVDSYQ--KVIVSGSADKTVKVWHVESRTCYTLRGHTEWVNCVK 428
               +S++ GH  +V S+   Q  + +VS S D T+KVW V S +      H   VN V 
Sbjct: 64  NPNPVSSFEGHKGNVTSIAFQQENRWMVSSSEDGTIKVWDVRSPSVQRNYKHNAPVNEVA 123

Query: 429 LHPKSFSCFSCSDDTTIRMWDIRTNSCLKVFRGHVGQVQKIIPLTIKDVENLATDNTSDG 488
           +HP      SC  D  IR+WD+  N C            ++ P     +++L+    SDG
Sbjct: 124 IHPNQGELISCDQDGNIRIWDLGENQC----------TNQLTPEDNTPLQSLSV--ASDG 171

Query: 489 S-----SPQDDPTMTDGADESDTPSNEQETVLDENIPYPT---------HLLSCGLDNTI 534
           S     + + +  +      +D  + E  T    +  Y T         HL +C  D+T 
Sbjct: 172 SMLVAGNNKGNCYVWKMPHHTDASTLEPVTKFKSHTKYITRVLLSADVKHLATCSADHTA 231

Query: 535 KLWDVKTGKCIRTQF-GHVEGVWDIA--ADNFRIISGSHDGSIKVWDLQSGKCMHTFNG 590
           ++W+++    + T   GH   VWD A  AD+  +++   D  +++WDL + + +  + G
Sbjct: 232 RVWNIEDNFELETTLDGHQRWVWDCAFSADSAYLVTACSDHYVRLWDLSTSEIVRQYGG 290

 Score = 54.3 bits (129), Expect = 9e-08,   Method: Compositional matrix adjust.
 Identities = 47/183 (25%), Positives = 84/183 (45%), Gaps = 16/183 (8%)

Query: 295 IQEFKGHMDGVLTLQFNY--RLLFTGSYDSTIGIWDLFTGKLIRRLSGHSDGVK--TLYF 350
           +  F+GH   V ++ F    R + + S D TI +WD+ +   ++R   H+  V    ++ 
Sbjct: 68  VSSFEGHKGNVTSIAFQQENRWMVSSSEDGTIKVWDVRSPS-VQRNYKHNAPVNEVAIHP 126

Query: 351 DDRKLITGSLDKTIRVWNYITGECISTYRGHSDS---VLSVDSYQKVIVSGSADKTVKVW 407
           +  +LI+   D  IR+W+    +C +      ++    LSV S   ++V+G+      VW
Sbjct: 127 NQGELISCDQDGNIRIWDLGENQCTNQLTPEDNTPLQSLSVASDGSMLVAGNNKGNCYVW 186

Query: 408 ----HVESRT---CYTLRGHTEWVNCVKLHPKSFSCFSCSDDTTIRMWDIRTNSCLK-VF 459
               H ++ T       + HT+++  V L        +CS D T R+W+I  N  L+   
Sbjct: 187 KMPHHTDASTLEPVTKFKSHTKYITRVLLSADVKHLATCSADHTARVWNIEDNFELETTL 246

Query: 460 RGH 462
            GH
Sbjct: 247 DGH 249

 Score = 38.1 bits (87), Expect = 0.017,   Method: Compositional matrix adjust.
 Identities = 28/99 (28%), Positives = 44/99 (44%), Gaps = 5/99 (5%)

Query: 295 IQEFKGHMDGV--LTLQFNYRLLFTGSYDSTIGIWDLFTG-KLIRRLSGHSDGVKTLYF- 350
           + +FK H   +  + L  + + L T S D T  +W++    +L   L GH   V    F 
Sbjct: 200 VTKFKSHTKYITRVLLSADVKHLATCSADHTARVWNIEDNFELETTLDGHQRWVWDCAFS 259

Query: 351 -DDRKLITGSLDKTIRVWNYITGECISTYRGHSDSVLSV 388
            D   L+T   D  +R+W+  T E +  Y GH    + V
Sbjct: 260 ADSAYLVTACSDHYVRLWDLSTSEIVRQYGGHHKGAVCV 298

 Score = 32.3 bits (72), Expect = 1.0,   Method: Compositional matrix adjust.
 Identities = 21/86 (24%), Positives = 35/86 (40%), Gaps = 14/86 (16%)

Query: 269 QTTRPWKVIYRERFKVESNWRKGHCRIQEFKGHMDGVLTLQF--NYRLLFTGSYDSTIGI 326
            T R W +   + F++E+             GH   V    F  +   L T   D  + +
Sbjct: 229 HTARVWNI--EDNFELETT----------LDGHQRWVWDCAFSADSAYLVTACSDHYVRL 276

Query: 327 WDLFTGKLIRRLSGHSDGVKTLYFDD 352
           WDL T +++R+  GH  G   +  +D
Sbjct: 277 WDLSTSEIVRQYGGHHKGAVCVALND 302

>YMR116C (ASC1) [4073] chr13
           complement(499455..499877,500151..500687) Ribosomal
           protein of the 40S ribosomal subunit that influences
           translational efficiency and cell size, contains two WD
           (WD-40) repeats [960 bp, 319 aa]
          Length = 319

 Score = 91.7 bits (226), Expect = 6e-20,   Method: Compositional matrix adjust.
 Identities = 61/183 (33%), Positives = 92/183 (50%), Gaps = 18/183 (9%)

Query: 298 FKGHMDGVLTLQFNY---RLLFTGSYDSTIGIWDLFT-----GKLIRRLSGHSDGVK--T 347
            +GH   V +L  +     LL + S D T+  W L       G  +R   GHS  V+  T
Sbjct: 13  LEGHNGWVTSLATSAGQPNLLLSASRDKTLISWKLTGDDQKFGVPVRSFKGHSHIVQDCT 72

Query: 348 LYFDDRKLITGSLDKTIRVWNYITGECISTYRGHSDSVLSVDSYQK--VIVSGSADKTVK 405
           L  D    ++ S DKT+R+W+  TGE    + GH   V+SVD  +K  +I+SGS DKT+K
Sbjct: 73  LTADGAYALSASWDKTLRLWDVATGETYQRFVGHKSDVMSVDIDKKASMIISGSRDKTIK 132

Query: 406 VWHVESRTCYTLRGHTEWVNCVKLHPK------SFSCFSCSDDTTIRMWDIRTNSCLKVF 459
           VW ++ +   TL GH +WV+ V++ P       S +  S  +D  ++ W++        F
Sbjct: 133 VWTIKGQCLATLLGHNDWVSQVRVVPNEKADDDSVTIISAGNDKMVKAWNLNQFQIEADF 192

Query: 460 RGH 462
            GH
Sbjct: 193 IGH 195

 Score = 62.0 bits (149), Expect = 3e-10,   Method: Compositional matrix adjust.
 Identities = 69/273 (25%), Positives = 112/273 (41%), Gaps = 67/273 (24%)

Query: 338 LSGHSDGVKTLYFDDRK---LITGSLDKTIRVWNYITGE------CISTYRGHS----DS 384
           L GH+  V +L     +   L++ S DKT+  W  +TG+       + +++GHS    D 
Sbjct: 13  LEGHNGWVTSLATSAGQPNLLLSASRDKTLISWK-LTGDDQKFGVPVRSFKGHSHIVQDC 71

Query: 385 VLSVDSYQKVIVSGSADKTVKVWHVESRTCYT-LRGHTEWVNCVKLHPKSFSCFSCSDDT 443
            L+ D      +S S DKT+++W V +   Y    GH   V  V +  K+    S S D 
Sbjct: 72  TLTADG--AYALSASWDKTLRLWDVATGETYQRFVGHKSDVMSVDIDKKASMIISGSRDK 129

Query: 444 TIRMWDIRTNSCLKVFRGH---VGQVQKIIPLTIKDVENLATDNTSDGSSPQDDPTMTDG 500
           TI++W I+   CL    GH   V QV +++P                 +   DD ++T  
Sbjct: 130 TIKVWTIK-GQCLATLLGHNDWVSQV-RVVP-----------------NEKADDDSVT-- 168

Query: 501 ADESDTPSNEQETVLDENIPYPTHLLSCGLDNTIKLWDVKTGKCIRTQFGHVEGVWDIAA 560
                                   ++S G D  +K W++   +      GH   +  + A
Sbjct: 169 ------------------------IISAGNDKMVKAWNLNQFQIEADFIGHNSNINTLTA 204

Query: 561 --DNFRIISGSHDGSIKVWDLQSGKCMHTFNGR 591
             D   I S   DG I +W+L + K M+T + +
Sbjct: 205 SPDGTLIASAGKDGEIMLWNLAAKKAMYTLSAQ 237

 Score = 49.3 bits (116), Expect = 4e-06,   Method: Compositional matrix adjust.
 Identities = 43/195 (22%), Positives = 85/195 (43%), Gaps = 29/195 (14%)

Query: 269 QTTRPWKVIYRERFKVESNWRKGHCRIQEFKGHMDGVLTLQFNYR--LLFTGSYDSTIGI 326
           +T R W V   E +             Q F GH   V+++  + +  ++ +GS D TI +
Sbjct: 87  KTLRLWDVATGETY-------------QRFVGHKSDVMSVDIDKKASMIISGSRDKTIKV 133

Query: 327 WDLFTGKLIRRLSGHSDGVKTLYF--------DDRKLITGSLDKTIRVWNYITGECISTY 378
           W +  G+ +  L GH+D V  +          D   +I+   DK ++ WN    +  + +
Sbjct: 134 WTI-KGQCLATLLGHNDWVSQVRVVPNEKADDDSVTIISAGNDKMVKAWNLNQFQIEADF 192

Query: 379 RGHSDSV--LSVDSYQKVIVSGSADKTVKVWHVESRTC-YTLRGHTEWVNCVKLHPKSFS 435
            GH+ ++  L+      +I S   D  + +W++ ++   YTL    E V  +   P  + 
Sbjct: 193 IGHNSNINTLTASPDGTLIASAGKDGEIMLWNLAAKKAMYTLSAQDE-VFSLAFSPNRY- 250

Query: 436 CFSCSDDTTIRMWDI 450
             + +  T I+++ +
Sbjct: 251 WLAAATATGIKVFSL 265

 Score = 38.1 bits (87), Expect = 0.016,   Method: Compositional matrix adjust.
 Identities = 28/91 (30%), Positives = 42/91 (46%), Gaps = 7/91 (7%)

Query: 509 NEQETVLDENIPYPTHLLSCGLDNTIKLW-----DVKTGKCIRTQFGHVEGVWD--IAAD 561
           N   T L  +   P  LLS   D T+  W     D K G  +R+  GH   V D  + AD
Sbjct: 17  NGWVTSLATSAGQPNLLLSASRDKTLISWKLTGDDQKFGVPVRSFKGHSHIVQDCTLTAD 76

Query: 562 NFRIISGSHDGSIKVWDLQSGKCMHTFNGRR 592
               +S S D ++++WD+ +G+    F G +
Sbjct: 77  GAYALSASWDKTLRLWDVATGETYQRFVGHK 107

>Sklu_2431.12 YBR198C, Contig c2431 17817-20066 reverse complement
          Length = 749

 Score = 94.4 bits (233), Expect = 7e-20,   Method: Compositional matrix adjust.
 Identities = 80/291 (27%), Positives = 122/291 (41%), Gaps = 74/291 (25%)

Query: 314 LLFTGSYDSTIGIWDLFTGKLIRRLS-------------GHSDGVKTLYF--DDRKLITG 358
           L   G  DS I +W L    L  +L              GHS  V +  F  D++ L++ 
Sbjct: 435 LAAAGFQDSYIKLWSLDGTPLDSKLPSKQREKINNTTLIGHSGTVYSTSFSPDNKYLLSA 494

Query: 359 SLDKTIRVWNYITGECISTYRGHSDSV--LSVDSYQKVIVSGSADKTVKVWHVESRTCYT 416
           S DKT+R+W+  T   + +Y+GH+  V  +S         + S D+T ++W  +    Y 
Sbjct: 495 SEDKTVRLWSMDTYSSLVSYKGHNHPVWDVSFSPLGHYFATASHDQTARLWSCDH--IYP 552

Query: 417 LR---GHTEWVNCVKLHPKSFSCFSCSDDTTIRMWDIRTNSCLKVFRGHVGQVQKIIPLT 473
           LR   GH   V+CV  HP     F+ S D T RMWDI T   +++F GH   V       
Sbjct: 553 LRIFAGHLNDVDCVSFHPNGTYVFTGSTDKTCRMWDIGTGDSVRLFLGHTAPV------- 605

Query: 474 IKDVENLATDNTSDGSSPQDDPTMTDGADESDTPSNEQETVLDENIPYPTHLLSCGL-DN 532
                 ++T  + DG                                     LS G  D 
Sbjct: 606 ------ISTAVSPDG-----------------------------------RWLSTGSEDG 624

Query: 533 TIKLWDVKTGKCIRTQFGHVE-GVWDI--AADNFRIISGSHDGSIKVWDLQ 580
            I +WD+ TGK ++   GH +  V+ +  + +   ++SG  D S++VWDL+
Sbjct: 625 IINVWDIGTGKRLKQMRGHGKNAVYSLSYSKEGTVLVSGGADHSVRVWDLK 675

 Score = 64.7 bits (156), Expect = 1e-10,   Method: Compositional matrix adjust.
 Identities = 55/220 (25%), Positives = 87/220 (39%), Gaps = 52/220 (23%)

Query: 376 STYRGHSDSVLSVD--SYQKVIVSGSADKTVKVWHVES-RTCYTLRGHTEWVNCVKLHPK 432
           +T  GHS +V S       K ++S S DKTV++W +++  +  + +GH   V  V   P 
Sbjct: 470 TTLIGHSGTVYSTSFSPDNKYLLSASEDKTVRLWSMDTYSSLVSYKGHNHPVWDVSFSPL 529

Query: 433 SFSCFSCSDDTTIRMWDIRTNSCLKVFRGHVGQVQKIIPLTIKDVENLATDNTSDGSSPQ 492
                + S D T R+W       L++F GH           + DV+ ++           
Sbjct: 530 GHYFATASHDQTARLWSCDHIYPLRIFAGH-----------LNDVDCVSFH--------- 569

Query: 493 DDPTMTDGADESDTPSNEQETVLDENIPYPTHLLSCGLDNTIKLWDVKTGKCIRTQFGHV 552
                                      P  T++ +   D T ++WD+ TG  +R   GH 
Sbjct: 570 ---------------------------PNGTYVFTGSTDKTCRMWDIGTGDSVRLFLGHT 602

Query: 553 EGVWDIAA--DNFRIISGSHDGSIKVWDLQSGKCMHTFNG 590
             V   A   D   + +GS DG I VWD+ +GK +    G
Sbjct: 603 APVISTAVSPDGRWLSTGSEDGIINVWDIGTGKRLKQMRG 642

 Score = 59.7 bits (143), Expect = 5e-09,   Method: Compositional matrix adjust.
 Identities = 44/172 (25%), Positives = 82/172 (47%), Gaps = 8/172 (4%)

Query: 292 HCRIQEFKGHMDGVLTLQFNY--RLLFTGSYDSTIGIWDLFTGKLIRRLSGHSDGVKTLY 349
           +  +  +KGH   V  + F+       T S+D T  +W       +R  +GH + V  + 
Sbjct: 508 YSSLVSYKGHNHPVWDVSFSPLGHYFATASHDQTARLWSCDHIYPLRIFAGHLNDVDCVS 567

Query: 350 F--DDRKLITGSLDKTIRVWNYITGECISTYRGHSDSVLS--VDSYQKVIVSGSADKTVK 405
           F  +   + TGS DKT R+W+  TG+ +  + GH+  V+S  V    + + +GS D  + 
Sbjct: 568 FHPNGTYVFTGSTDKTCRMWDIGTGDSVRLFLGHTAPVISTAVSPDGRWLSTGSEDGIIN 627

Query: 406 VWHVES-RTCYTLRGHTE-WVNCVKLHPKSFSCFSCSDDTTIRMWDIRTNSC 455
           VW + + +    +RGH +  V  +    +     S   D ++R+WD++ ++ 
Sbjct: 628 VWDIGTGKRLKQMRGHGKNAVYSLSYSKEGTVLVSGGADHSVRVWDLKRSTA 679

>Sklu_2442.2 YNL006W, Contig c2442 3831-4742
          Length = 303

 Score = 90.5 bits (223), Expect = 9e-20,   Method: Compositional matrix adjust.
 Identities = 75/292 (25%), Positives = 122/292 (41%), Gaps = 20/292 (6%)

Query: 314 LLFTGSYDSTIGIWDLFTGKLIRRLSGHSDGVKTLYF-DDRKLITGSLDKTIRVWNYITG 372
           +L +  YD TI  W+  TG   R +      V  L    D++ +  +    +R+++  T 
Sbjct: 4   ILASAGYDHTIRFWEALTGVCSRTIQHADSQVNRLEITSDKRFLAAAGHLHVRLYDIRTT 63

Query: 373 EC--ISTYRGHSDSVLSVDSYQ--KVIVSGSADKTVKVWHVESRTCYTLRGHTEWVNCVK 428
               ++++ GH  +V S+   Q  K +VS S D T+KVW V + +      H   VN V 
Sbjct: 64  NPNPVTSFEGHRGNVTSISFQQDNKWMVSSSEDGTIKVWDVRAPSVQRNYKHHAPVNEVV 123

Query: 429 LHPKSFSCFSCSDDTTIRMWDIRTNSCLKVFRGHVGQVQKIIPL----TIKDVENLATDN 484
           +HP      SC  D  IR+WD+  N C      H    +   PL       D   L   N
Sbjct: 124 IHPNQGELISCDQDGNIRIWDLGENQCT-----HQLTPEDDTPLQSLSIASDGSMLVAGN 178

Query: 485 TSDGSSPQDDPTMTDGADESDTPSNEQETVLDENIPYPT---HLLSCGLDNTIKLWDVKT 541
                     P  TD A+          T     +   +   HL +C  D+T ++W ++ 
Sbjct: 179 NKGNCYVWQMPNHTDAANLKPVTKFRSHTKYITRVLLSSDVKHLATCSADHTARVWSIED 238

Query: 542 GKCIRTQF-GHVEGVWDIA--ADNFRIISGSHDGSIKVWDLQSGKCMHTFNG 590
              + T   GH   VWD A  AD+  +++   D  +++WDL + + +  + G
Sbjct: 239 NFKLETTLDGHQRWVWDCAFSADSAYLVTACSDHYVRLWDLSTREIVRQYGG 290

 Score = 56.2 bits (134), Expect = 2e-08,   Method: Compositional matrix adjust.
 Identities = 45/182 (24%), Positives = 80/182 (43%), Gaps = 14/182 (7%)

Query: 295 IQEFKGHMDGVLTLQF--NYRLLFTGSYDSTIGIWDLFTGKLIRRLSGHSDGVKTLYFDD 352
           +  F+GH   V ++ F  + + + + S D TI +WD+    + R    H+   + +   +
Sbjct: 68  VTSFEGHRGNVTSISFQQDNKWMVSSSEDGTIKVWDVRAPSVQRNYKHHAPVNEVVIHPN 127

Query: 353 R-KLITGSLDKTIRVWNYITGECISTYRGHSDS---VLSVDSYQKVIVSGSADKTVKVWH 408
           + +LI+   D  IR+W+    +C        D+    LS+ S   ++V+G+      VW 
Sbjct: 128 QGELISCDQDGNIRIWDLGENQCTHQLTPEDDTPLQSLSIASDGSMLVAGNNKGNCYVWQ 187

Query: 409 VESRT-------CYTLRGHTEWVNCVKLHPKSFSCFSCSDDTTIRMWDIRTNSCLK-VFR 460
           + + T           R HT+++  V L        +CS D T R+W I  N  L+    
Sbjct: 188 MPNHTDAANLKPVTKFRSHTKYITRVLLSSDVKHLATCSADHTARVWSIEDNFKLETTLD 247

Query: 461 GH 462
           GH
Sbjct: 248 GH 249

 Score = 37.0 bits (84), Expect = 0.036,   Method: Compositional matrix adjust.
 Identities = 31/119 (26%), Positives = 45/119 (37%), Gaps = 20/119 (16%)

Query: 290 KGHCRIQEFKGHMDGV-----------------LTLQFNYRLLFTGSYDSTIGIWDLFTG 332
           KG+C + +   H D                   + L  + + L T S D T  +W +   
Sbjct: 180 KGNCYVWQMPNHTDAANLKPVTKFRSHTKYITRVLLSSDVKHLATCSADHTARVWSIEDN 239

Query: 333 -KLIRRLSGHSDGVKTLYF--DDRKLITGSLDKTIRVWNYITGECISTYRGHSDSVLSV 388
            KL   L GH   V    F  D   L+T   D  +R+W+  T E +  Y GH    + V
Sbjct: 240 FKLETTLDGHQRWVWDCAFSADSAYLVTACSDHYVRLWDLSTREIVRQYGGHHKGAVCV 298

 Score = 32.7 bits (73), Expect = 0.86,   Method: Compositional matrix adjust.
 Identities = 22/86 (25%), Positives = 35/86 (40%), Gaps = 14/86 (16%)

Query: 269 QTTRPWKVIYRERFKVESNWRKGHCRIQEFKGHMDGVLTLQF--NYRLLFTGSYDSTIGI 326
            T R W +   + FK+E+             GH   V    F  +   L T   D  + +
Sbjct: 229 HTARVWSI--EDNFKLETT----------LDGHQRWVWDCAFSADSAYLVTACSDHYVRL 276

Query: 327 WDLFTGKLIRRLSGHSDGVKTLYFDD 352
           WDL T +++R+  GH  G   +  +D
Sbjct: 277 WDLSTREIVRQYGGHHKGAVCVALND 302

>Kwal_27.12053
          Length = 755

 Score = 94.0 bits (232), Expect = 9e-20,   Method: Compositional matrix adjust.
 Identities = 85/300 (28%), Positives = 127/300 (42%), Gaps = 76/300 (25%)

Query: 307 TLQF--NYRLLFTGSYDSTIGIWDL----FTGKLIRR---------LSGHSDGVKTLYF- 350
           +L+F  + RL   G  DS I IW L       KL  +         L GHS  V +  F 
Sbjct: 432 SLEFSDDVRLAAAGFQDSIIKIWSLDGEPLKNKLPSKQGERTNNETLVGHSGTVYSTSFS 491

Query: 351 -DDRKLITGSLDKTIRVWNYITGECISTYRGHSDSV--LSVDSYQKVIVSGSADKTVKVW 407
            D+R L++ S DKT+R+W+  T   +  Y+GH+  +  ++         + S D+T ++W
Sbjct: 492 PDNRYLLSASEDKTVRLWSTDTYTSLVNYKGHNHPIWDVAFSPLGHYFATASHDQTARLW 551

Query: 408 HVESRTCYTLR---GHTEWVNCVKLHPKSFSCFSCSDDTTIRMWDIRTNSCLKVFRGHVG 464
             +    Y LR   GH   V+ V  HP     F+ S D T RMWDI +   +++F GH  
Sbjct: 552 SCDH--IYPLRIFAGHLNDVDTVSFHPNGTYVFTGSSDKTCRMWDITSGDSVRLFLGHTA 609

Query: 465 QVQKIIPLTIKDVENLATDNTSDGSSPQDDPTMTDGADESDTPSNEQETVLDENIPYPTH 524
            V                  TS   SP       DG                        
Sbjct: 610 PV------------------TSTAVSP-------DG-----------------------R 621

Query: 525 LLSCGL-DNTIKLWDVKTGKCIRTQFGHVE-GVWDI--AADNFRIISGSHDGSIKVWDLQ 580
            LS G  D  I +WD+ TGK ++   GH +  V+ +  + +   +ISG  D S++VWD++
Sbjct: 622 WLSTGSEDGVINVWDIGTGKRLKQMRGHGKNAVYSLSYSKEGHVLISGGADHSVRVWDVK 681

 Score = 79.0 bits (193), Expect = 5e-15,   Method: Compositional matrix adjust.
 Identities = 48/124 (38%), Positives = 68/124 (54%), Gaps = 7/124 (5%)

Query: 298 FKGHMDGVLTLQF--NYRLLFTGSYDSTIGIWDLFTGKLIRRLSGHSDGVKTLYF--DDR 353
           F GH++ V T+ F  N   +FTGS D T  +WD+ +G  +R   GH+  V +     D R
Sbjct: 562 FAGHLNDVDTVSFHPNGTYVFTGSSDKTCRMWDITSGDSVRLFLGHTAPVTSTAVSPDGR 621

Query: 354 KLITGSLDKTIRVWNYITGECISTYRGHSDSVLSVDSYQK---VIVSGSADKTVKVWHVE 410
            L TGS D  I VW+  TG+ +   RGH  + +   SY K   V++SG AD +V+VW V+
Sbjct: 622 WLSTGSEDGVINVWDIGTGKRLKQMRGHGKNAVYSLSYSKEGHVLISGGADHSVRVWDVK 681

Query: 411 SRTC 414
             T 
Sbjct: 682 KSTA 685

 Score = 66.2 bits (160), Expect = 5e-11,   Method: Compositional matrix adjust.
 Identities = 65/265 (24%), Positives = 99/265 (37%), Gaps = 69/265 (26%)

Query: 347 TLYFDD--RKLITGSLDKTIRVWNYITGECI--------------STYRGHSDSVLSVD- 389
           +L F D  R    G  D  I++W+ + GE +               T  GHS +V S   
Sbjct: 432 SLEFSDDVRLAAAGFQDSIIKIWS-LDGEPLKNKLPSKQGERTNNETLVGHSGTVYSTSF 490

Query: 390 -SYQKVIVSGSADKTVKVWHVESRTCYT-LRGHTEWVNCVKLHPKSFSCFSCSDDTTIRM 447
               + ++S S DKTV++W  ++ T     +GH   +  V   P      + S D T R+
Sbjct: 491 SPDNRYLLSASEDKTVRLWSTDTYTSLVNYKGHNHPIWDVAFSPLGHYFATASHDQTARL 550

Query: 448 WDIRTNSCLKVFRGHVGQVQKIIPLTIKDVENLATDNTSDGSSPQDDPTMTDGADESDTP 507
           W       L++F GH+  V                                      DT 
Sbjct: 551 WSCDHIYPLRIFAGHLNDV--------------------------------------DTV 572

Query: 508 SNEQETVLDENIPYPTHLLSCGLDNTIKLWDVKTGKCIRTQFGHVEGVWDIAA--DNFRI 565
           S           P  T++ +   D T ++WD+ +G  +R   GH   V   A   D   +
Sbjct: 573 SFH---------PNGTYVFTGSSDKTCRMWDITSGDSVRLFLGHTAPVTSTAVSPDGRWL 623

Query: 566 ISGSHDGSIKVWDLQSGKCMHTFNG 590
            +GS DG I VWD+ +GK +    G
Sbjct: 624 STGSEDGVINVWDIGTGKRLKQMRG 648

>YBR198C (TAF5) [381] chr2 complement(616084..618480) Component of
           the TAF(II) complex (TBP-associated protein complex) and
           SAGA complex (Spt-Ada-Gcn5-acetyltransferase), required
           for activated transcription by RNA polymerase II, member
           of WD (WD-40) repeat family [2397 bp, 798 aa]
          Length = 798

 Score = 93.6 bits (231), Expect = 1e-19,   Method: Compositional matrix adjust.
 Identities = 79/296 (26%), Positives = 120/296 (40%), Gaps = 78/296 (26%)

Query: 313 RLLFTGSYDSTIGIWDLFTGKLI-----------------RRLSGHSDGVKTLYF--DDR 353
           R+   G  DS I IW L    L                  + L GHS  V +  F  D++
Sbjct: 479 RIAAAGFQDSYIKIWSLDGSSLNNPNIALNNNDKDEDPTCKTLVGHSGTVYSTSFSPDNK 538

Query: 354 KLITGSLDKTIRVWNYITGECISTYRGHSDSV--LSVDSYQKVIVSGSADKTVKVWHVES 411
            L++GS DKT+R+W+  T   + +Y+GH+  V  +S         + S D+T ++W  + 
Sbjct: 539 YLLSGSEDKTVRLWSMDTHTALVSYKGHNHPVWDVSFSPLGHYFATASHDQTARLWSCDH 598

Query: 412 RTCYTLR---GHTEWVNCVKLHPKSFSCFSCSDDTTIRMWDIRTNSCLKVFRGHVGQVQK 468
              Y LR   GH   V+CV  HP     F+ S D T RMWD+ T   +++F GH      
Sbjct: 599 --IYPLRIFAGHLNDVDCVSFHPNGCYVFTGSSDKTCRMWDVSTGDSVRLFLGHTA---P 653

Query: 469 IIPLTIKDVENLATDNTSDGSSPQDDPTMTDGADESDTPSNEQETVLDENIPYPTHLLSC 528
           +I + +            DG                                     LS 
Sbjct: 654 VISIAV----------CPDG-----------------------------------RWLST 668

Query: 529 GL-DNTIKLWDVKTGKCIRTQFGHVEGV---WDIAADNFRIISGSHDGSIKVWDLQ 580
           G  D  I +WD+ TGK ++   GH +        + +   +ISG  D +++VWDL+
Sbjct: 669 GSEDGIINVWDIGTGKRLKQMRGHGKNAIYSLSYSKEGNVLISGGADHTVRVWDLK 724

 Score = 76.3 bits (186), Expect = 3e-14,   Method: Compositional matrix adjust.
 Identities = 48/123 (39%), Positives = 68/123 (55%), Gaps = 7/123 (5%)

Query: 298 FKGHMDGVLTLQF--NYRLLFTGSYDSTIGIWDLFTGKLIRRLSGHSDGVKTLYF--DDR 353
           F GH++ V  + F  N   +FTGS D T  +WD+ TG  +R   GH+  V ++    D R
Sbjct: 605 FAGHLNDVDCVSFHPNGCYVFTGSSDKTCRMWDVSTGDSVRLFLGHTAPVISIAVCPDGR 664

Query: 354 KLITGSLDKTIRVWNYITGECISTYRGHSDSVLSVDSYQK---VIVSGSADKTVKVWHVE 410
            L TGS D  I VW+  TG+ +   RGH  + +   SY K   V++SG AD TV+VW ++
Sbjct: 665 WLSTGSEDGIINVWDIGTGKRLKQMRGHGKNAIYSLSYSKEGNVLISGGADHTVRVWDLK 724

Query: 411 SRT 413
             T
Sbjct: 725 KAT 727

 Score = 68.9 bits (167), Expect = 7e-12,   Method: Compositional matrix adjust.
 Identities = 58/219 (26%), Positives = 87/219 (39%), Gaps = 52/219 (23%)

Query: 377 TYRGHSDSVLSVD--SYQKVIVSGSADKTVKVWHVESRTCY-TLRGHTEWVNCVKLHPKS 433
           T  GHS +V S       K ++SGS DKTV++W +++ T   + +GH   V  V   P  
Sbjct: 520 TLVGHSGTVYSTSFSPDNKYLLSGSEDKTVRLWSMDTHTALVSYKGHNHPVWDVSFSPLG 579

Query: 434 FSCFSCSDDTTIRMWDIRTNSCLKVFRGHVGQVQKIIPLTIKDVENLATDNTSDGSSPQD 493
               + S D T R+W       L++F GH           + DV+ ++            
Sbjct: 580 HYFATASHDQTARLWSCDHIYPLRIFAGH-----------LNDVDCVSFH---------- 618

Query: 494 DPTMTDGADESDTPSNEQETVLDENIPYPTHLLSCGLDNTIKLWDVKTGKCIRTQFGHVE 553
                                     P   ++ +   D T ++WDV TG  +R   GH  
Sbjct: 619 --------------------------PNGCYVFTGSSDKTCRMWDVSTGDSVRLFLGHTA 652

Query: 554 GVWDIAA--DNFRIISGSHDGSIKVWDLQSGKCMHTFNG 590
            V  IA   D   + +GS DG I VWD+ +GK +    G
Sbjct: 653 PVISIAVCPDGRWLSTGSEDGIINVWDIGTGKRLKQMRG 691

 Score = 50.1 bits (118), Expect = 5e-06,   Method: Compositional matrix adjust.
 Identities = 27/79 (34%), Positives = 47/79 (59%), Gaps = 5/79 (6%)

Query: 295 IQEFKGHMDGVLTLQF--NYRLLFTGSYDSTIGIWDLFTGKLIRRLSGHS-DGVKTLYF- 350
           ++ F GH   V+++    + R L TGS D  I +WD+ TGK ++++ GH  + + +L + 
Sbjct: 644 VRLFLGHTAPVISIAVCPDGRWLSTGSEDGIINVWDIGTGKRLKQMRGHGKNAIYSLSYS 703

Query: 351 -DDRKLITGSLDKTIRVWN 368
            +   LI+G  D T+RVW+
Sbjct: 704 KEGNVLISGGADHTVRVWD 722

>CAGL0G04345g 408842..410977 similar to sp|P47025 Saccharomyces
           cerevisiae YJL112w MDV1, hypothetical start
          Length = 711

 Score = 92.8 bits (229), Expect = 2e-19,   Method: Compositional matrix adjust.
 Identities = 71/262 (27%), Positives = 114/262 (43%), Gaps = 48/262 (18%)

Query: 340 GHSDGVKTLYFDDR--KLIT-GSLDKTIRVWNYITGECISTYRGHSDSV--LSVDSYQKV 394
            H D +  L FD     L T G +D  +++W+Y     I    GH  ++  + VD    +
Sbjct: 402 AHDDAITCLDFDPHFSTLCTAGYMDHIVKLWDYTKKRQIGAMEGHVATISCMQVDKNYNM 461

Query: 395 IVSGSADKTVKVWHVE-----------SRTCYTLRGHTEWVNCVKLHPKSFSCFSCSDDT 443
           + +GS D TVK+W+             S   +TL  H + V+   L+    +  + S D 
Sbjct: 462 VATGSKDATVKLWNANDVIGRYEEGNNSEALHTLDAHLDEVSS--LYIDGANLMTASQDK 519

Query: 444 TIRMWDIRTNSCLKVFRGHVGQVQKIIPLTIKDVEN---LATDNTSDGSSPQDDPTMTDG 500
           TIR WD+ +  C++VF  +   +       +K  E+   L T NT    S Q        
Sbjct: 520 TIRRWDLYSGKCIQVFDVNFPSLSAYKSSFMKSNEDSMILKTVNTPIIGSIQ-------- 571

Query: 501 ADESDTPSNEQETVLDENIPYPTHLLSCGLDNTIKLWDVKTGKCIRTQFGHVEGVWDIAA 560
                               +   L +   D  I+LWD++TG+ +R   GH++ +  +  
Sbjct: 572 -------------------SFDAALATGTKDGLIRLWDMRTGEVVRVLEGHMDAITSLKF 612

Query: 561 DNFRIISGSHDGSIKVWDLQSG 582
           D   IISGS DG+I++WDL+S 
Sbjct: 613 DATTIISGSLDGTIRLWDLRSN 634

 Score = 82.8 bits (203), Expect = 3e-16,   Method: Compositional matrix adjust.
 Identities = 52/204 (25%), Positives = 95/204 (46%), Gaps = 40/204 (19%)

Query: 294 RIQEFKGHMDGVLTLQF--NYRLLFTGSYDSTIGIWDLF----------TGKLIRRLSGH 341
           +I   +GH+  +  +Q   NY ++ TGS D+T+ +W+              + +  L  H
Sbjct: 439 QIGAMEGHVATISCMQVDKNYNMVATGSKDATVKLWNANDVIGRYEEGNNSEALHTLDAH 498

Query: 342 SDGVKTLYFDDRKLITGSLDKTIRVWNYITGECISTY---------------RGHSDSVL 386
            D V +LY D   L+T S DKTIR W+  +G+CI  +               + + DS++
Sbjct: 499 LDEVSSLYIDGANLMTASQDKTIRRWDLYSGKCIQVFDVNFPSLSAYKSSFMKSNEDSMI 558

Query: 387 ----------SVDSYQKVIVSGSADKTVKVWHVES-RTCYTLRGHTEWVNCVKLHPKSFS 435
                     S+ S+   + +G+ D  +++W + +      L GH + +  +K    + +
Sbjct: 559 LKTVNTPIIGSIQSFDAALATGTKDGLIRLWDMRTGEVVRVLEGHMDAITSLKFD--ATT 616

Query: 436 CFSCSDDTTIRMWDIRTNSCLKVF 459
             S S D TIR+WD+R+N+   + 
Sbjct: 617 IISGSLDGTIRLWDLRSNNLTDII 640

 Score = 65.1 bits (157), Expect = 9e-11,   Method: Compositional matrix adjust.
 Identities = 47/183 (25%), Positives = 78/183 (42%), Gaps = 31/183 (16%)

Query: 300 GHMDGVLTLQFNYRLLFTGSYDSTIGIWDLFTGKLIR-------RLSGHSDG-------- 344
            H+D V +L  +   L T S D TI  WDL++GK I+        LS +           
Sbjct: 497 AHLDEVSSLYIDGANLMTASQDKTIRRWDLYSGKCIQVFDVNFPSLSAYKSSFMKSNEDS 556

Query: 345 ----------VKTLYFDDRKLITGSLDKTIRVWNYITGECISTYRGHSDSVLSVDSYQKV 394
                     + ++   D  L TG+ D  IR+W+  TGE +    GH D++ S+      
Sbjct: 557 MILKTVNTPIIGSIQSFDAALATGTKDGLIRLWDMRTGEVVRVLEGHMDAITSLKFDATT 616

Query: 395 IVSGSADKTVKVWHVESRTCYTLRGHTEWVNCVKLHPKSFSCFSCSDDTTI------RMW 448
           I+SGS D T+++W + S     +  + + ++ +    K     S   +T I        W
Sbjct: 617 IISGSLDGTIRLWDLRSNNLTDIISYEKPISSLDFDAKHIVVASNEHNTHIYDRNDGNKW 676

Query: 449 DIR 451
           D++
Sbjct: 677 DLQ 679

 Score = 48.9 bits (115), Expect = 1e-05,   Method: Compositional matrix adjust.
 Identities = 47/253 (18%), Positives = 100/253 (39%), Gaps = 71/253 (28%)

Query: 369 YITGECISTY-RGHSDSVLSVD---SYQKVIVSGSADKTVKVW-HVESRTCYTLRGHTEW 423
           Y +G+ +ST  + H D++  +D    +  +  +G  D  VK+W + + R    + GH   
Sbjct: 390 YNSGKKLSTIPKAHDDAITCLDFDPHFSTLCTAGYMDHIVKLWDYTKKRQIGAMEGHVAT 449

Query: 424 VNCVKLHPKSFSCFSCSDDTTIRMWDIRTNSCLKVFR-GHVGQVQKIIPLTIKDVENLAT 482
           ++C+++        + S D T+++W+   N  +  +  G+  +    +   + +V +L  
Sbjct: 450 ISCMQVDKNYNMVATGSKDATVKLWN--ANDVIGRYEEGNNSEALHTLDAHLDEVSSL-- 505

Query: 483 DNTSDGSSPQDDPTMTDGADESDTPSNEQETVLDENIPYPTHLLSCGLDNTIKLWDVKTG 542
                           DGA                      +L++   D TI+ WD+ +G
Sbjct: 506 --------------YIDGA----------------------NLMTASQDKTIRRWDLYSG 529

Query: 543 KCIR---TQFGHVEG----------------------VWDIAADNFRIISGSHDGSIKVW 577
           KCI+     F  +                        +  I + +  + +G+ DG I++W
Sbjct: 530 KCIQVFDVNFPSLSAYKSSFMKSNEDSMILKTVNTPIIGSIQSFDAALATGTKDGLIRLW 589

Query: 578 DLQSGKCMHTFNG 590
           D+++G+ +    G
Sbjct: 590 DMRTGEVVRVLEG 602

 Score = 46.6 bits (109), Expect = 6e-05,   Method: Compositional matrix adjust.
 Identities = 29/124 (23%), Positives = 60/124 (48%), Gaps = 3/124 (2%)

Query: 287 NWRKGHCRIQEFKGHMDGVLTLQFNYRLLFTGSYDSTIGIWDLFTGKLIRRLSGHSDGVK 346
           + R G   ++  +GHMD + +L+F+   + +GS D TI +WDL +  L   +S +   + 
Sbjct: 590 DMRTGEV-VRVLEGHMDAITSLKFDATTIISGSLDGTIRLWDLRSNNLTDIIS-YEKPIS 647

Query: 347 TLYFDDRKLITGSLDKTIRVWNYITGECISTYRGHSDSV-LSVDSYQKVIVSGSADKTVK 405
           +L FD + ++  S +    +++   G          D+  L V   ++  + G ++  + 
Sbjct: 648 SLDFDAKHIVVASNEHNTHIYDRNDGNKWDLQDEEQDTTSLFVKYKERYTMEGRSNGDIG 707

Query: 406 VWHV 409
           +W V
Sbjct: 708 IWIV 711

>Kwal_0.212
          Length = 303

 Score = 89.0 bits (219), Expect = 3e-19,   Method: Compositional matrix adjust.
 Identities = 72/292 (24%), Positives = 120/292 (41%), Gaps = 20/292 (6%)

Query: 314 LLFTGSYDSTIGIWDLFTGKLIRRLSGHSDGVKTLYFD-DRKLITGSLDKTIRVWNYITG 372
           +L +  YD TI  W+  TG   R +      V  L    D++ +  +    +R+++  T 
Sbjct: 4   ILASAGYDHTIRFWEALTGVCSRTIQHSDSQVNRLEISSDKRFLAAAGHLNVRLYDIRTT 63

Query: 373 EC--ISTYRGHSDSVLSVDSYQ--KVIVSGSADKTVKVWHVESRTCYTLRGHTEWVNCVK 428
               ++++ GH  +V S+   Q  K +VS S D T+KVW V + +      H   VN V 
Sbjct: 64  NPNPVTSFEGHRGNVTSIAFQQENKWMVSSSEDGTIKVWDVRAPSVQRNYKHQAAVNEVV 123

Query: 429 LHPKSFSCFSCSDDTTIRMWDIRTNSCLKVFRGHVGQVQKIIPL----TIKDVENLATDN 484
           +HP      SC  D  +R+WD+  N C+     H    +   PL       D   L   N
Sbjct: 124 IHPNQGELISCDQDGNVRIWDLGENQCV-----HQLAPEDDTPLQSLSVASDGSMLVAGN 178

Query: 485 TSDGSSPQDDPTMTDGADESDTPSNEQETVLDENIPYPT---HLLSCGLDNTIKLWDVKT 541
                     P  TD A+                +   +   HL +C  D+T ++W +  
Sbjct: 179 NKGNCYVWQMPHQTDAANPKPVTKFRSHAKYITRVLLSSDVKHLATCSADHTARVWSIDD 238

Query: 542 GKCIRTQF-GHVEGVWDIA--ADNFRIISGSHDGSIKVWDLQSGKCMHTFNG 590
              + T    H   VWD A  AD+  +++   D  +++WDL + + +  + G
Sbjct: 239 NFQLETTLDNHQRWVWDCAFSADSAYLVTACSDHYVRLWDLSTREIVRQYGG 290

 Score = 47.8 bits (112), Expect = 1e-05,   Method: Compositional matrix adjust.
 Identities = 48/226 (21%), Positives = 87/226 (38%), Gaps = 60/226 (26%)

Query: 295 IQEFKGHMDGVLTLQFNY--RLLFTGSYDSTIGIWDLFTGKLIRRLSGHSDGVK--TLYF 350
           +  F+GH   V ++ F    + + + S D TI +WD+     ++R   H   V    ++ 
Sbjct: 68  VTSFEGHRGNVTSIAFQQENKWMVSSSEDGTIKVWDV-RAPSVQRNYKHQAAVNEVVIHP 126

Query: 351 DDRKLITGSLDKTIRVWNYITGECISTYRGHSDS---VLSVDSYQKVIVSG--------- 398
           +  +LI+   D  +R+W+    +C+       D+    LSV S   ++V+G         
Sbjct: 127 NQGELISCDQDGNVRIWDLGENQCVHQLAPEDDTPLQSLSVASDGSMLVAGNNKGNCYVW 186

Query: 399 ---------------------------------------SADKTVKVWHVES--RTCYTL 417
                                                  SAD T +VW ++   +   TL
Sbjct: 187 QMPHQTDAANPKPVTKFRSHAKYITRVLLSSDVKHLATCSADHTARVWSIDDNFQLETTL 246

Query: 418 RGHTEWV-NCVKLHPKSFSCFSCSDDTTIRMWDIRTNSCLKVFRGH 462
             H  WV +C      ++   +CSD   +R+WD+ T   ++ + GH
Sbjct: 247 DNHQRWVWDCAFSADSAYLVTACSDHY-VRLWDLSTREIVRQYGGH 291

 Score = 33.1 bits (74), Expect = 0.60,   Method: Compositional matrix adjust.
 Identities = 26/99 (26%), Positives = 42/99 (42%), Gaps = 5/99 (5%)

Query: 295 IQEFKGHMDGV--LTLQFNYRLLFTGSYDSTIGIWDLFTG-KLIRRLSGHSDGVKTLYF- 350
           + +F+ H   +  + L  + + L T S D T  +W +    +L   L  H   V    F 
Sbjct: 200 VTKFRSHAKYITRVLLSSDVKHLATCSADHTARVWSIDDNFQLETTLDNHQRWVWDCAFS 259

Query: 351 -DDRKLITGSLDKTIRVWNYITGECISTYRGHSDSVLSV 388
            D   L+T   D  +R+W+  T E +  Y GH    + V
Sbjct: 260 ADSAYLVTACSDHYVRLWDLSTREIVRQYGGHHKGAICV 298

>YJL112W (MDV1) [2803] chr10 (205222..207366) Protein involved in
           mitochondrial division and mitochondrial fission,
           contains WD (WD-40) repeats [2145 bp, 714 aa]
          Length = 714

 Score = 89.7 bits (221), Expect = 2e-18,   Method: Compositional matrix adjust.
 Identities = 79/291 (27%), Positives = 129/291 (44%), Gaps = 60/291 (20%)

Query: 301 HMDGVLTLQFN--YRLLFTGSY-DSTIGIWDLFTGKLIRRLSGHSDGVKTLYF--DDRKL 355
           H D +  L F+  +  L T  Y D T+ IWDL     I  L+GH   +  +    D   L
Sbjct: 397 HDDFLTCLDFDAPFGTLCTAGYLDHTVKIWDLSKQNKIGELAGHLATINCMQINRDYGTL 456

Query: 356 ITGSLDKTIRVWNYITGECISTYRGHSDSVLSVDSYQKVIVSGSADKTVKVWHVESRTCY 415
           +TG  D  +++WN    + +               YQ+     + + T    H++S   +
Sbjct: 457 VTGGRDAALKLWNLNLAQQL---------------YQE-----TQNLTSPTNHIDSPCVH 496

Query: 416 TLRGHTEWVNCVKLHPKSFSCFSCSDDTTIRMWDIRTNSCLKVFRGHVGQVQKIIPLTIK 475
           T   HT+ V  + L P SF   S S D TIR WD+R+  CL+            I L+  
Sbjct: 497 TFEAHTDEVTALSLDP-SF-LVSGSQDRTIRQWDLRSGKCLQT-----------IDLSFA 543

Query: 476 DVENLATDNTSDGSSP----QDDPTMTDGADESDTPSNEQETVLDENIPYPTHLLSCGLD 531
           +V  L T    D S      Q +   + GA +S                +   L +   D
Sbjct: 544 NV--LTTSTNVDLSKSTLLTQRNERPSIGALQS----------------FDAALATGTKD 585

Query: 532 NTIKLWDVKTGKCIRTQFGHVEGVWDIAADNFRIISGSHDGSIKVWDLQSG 582
             ++LWD+++GK IRT  GH + +  +  D+  +++GS+D ++++WDL++G
Sbjct: 586 GVVRLWDLRSGKVIRTLKGHTDAITSLKFDSACLVTGSYDRTVRIWDLRTG 636

 Score = 77.0 bits (188), Expect = 2e-14,   Method: Compositional matrix adjust.
 Identities = 38/97 (39%), Positives = 63/97 (64%), Gaps = 2/97 (2%)

Query: 315 LFTGSYDSTIGIWDLFTGKLIRRLSGHSDGVKTLYFDDRKLITGSLDKTIRVWNYITGEC 374
           L TG+ D  + +WDL +GK+IR L GH+D + +L FD   L+TGS D+T+R+W+  TG  
Sbjct: 579 LATGTKDGVVRLWDLRSGKVIRTLKGHTDAITSLKFDSACLVTGSYDRTVRIWDLRTG-L 637

Query: 375 ISTYRGHSDSVLSVDSYQKVIVSGSADK-TVKVWHVE 410
           ++ +  +S  VLS+D +Q+      AD+ +V+++  E
Sbjct: 638 LNKFHAYSAPVLSLDLFQENAAVVVADEPSVQIYDSE 674

 Score = 69.3 bits (168), Expect = 5e-12,   Method: Compositional matrix adjust.
 Identities = 44/179 (24%), Positives = 85/179 (47%), Gaps = 25/179 (13%)

Query: 295 IQEFKGHMDGVLTLQFNYRLLFTGSYDSTIGIWDLFTGKLIRRL----------SGHSDG 344
           +  F+ H D V  L  +   L +GS D TI  WDL +GK ++ +          S + D 
Sbjct: 495 VHTFEAHTDEVTALSLDPSFLVSGSQDRTIRQWDLRSGKCLQTIDLSFANVLTTSTNVDL 554

Query: 345 VKTLYFDDRK--------------LITGSLDKTIRVWNYITGECISTYRGHSDSVLSVDS 390
            K+     R               L TG+ D  +R+W+  +G+ I T +GH+D++ S+  
Sbjct: 555 SKSTLLTQRNERPSIGALQSFDAALATGTKDGVVRLWDLRSGKVIRTLKGHTDAITSLKF 614

Query: 391 YQKVIVSGSADKTVKVWHVESRTCYTLRGHTEWVNCVKLHPKSFSCFSCSDDTTIRMWD 449
               +V+GS D+TV++W + +        ++  V  + L  ++ +    +D+ +++++D
Sbjct: 615 DSACLVTGSYDRTVRIWDLRTGLLNKFHAYSAPVLSLDLFQEN-AAVVVADEPSVQIYD 672

 Score = 54.7 bits (130), Expect = 2e-07,   Method: Compositional matrix adjust.
 Identities = 49/222 (22%), Positives = 93/222 (41%), Gaps = 61/222 (27%)

Query: 397 SGSADKTVKVWHVESRT-CYTLRGHTEWVNCVKLHPKSFSCFSCSDDTTIRMWDIRTNSC 455
           +G  D TVK+W +  +     L GH   +NC++++    +  +   D  +++W++  N  
Sbjct: 416 AGYLDHTVKIWDLSKQNKIGELAGHLATINCMQINRDYGTLVTGGRDAALKLWNL--NLA 473

Query: 456 LKVFRGHVGQVQKIIPLTIKDVENLATDNTSDGSSPQDDP---TMTDGADESDTPSNEQE 512
            ++++                     T N +  ++  D P   T     DE    S    
Sbjct: 474 QQLYQ--------------------ETQNLTSPTNHIDSPCVHTFEAHTDEVTALS---- 509

Query: 513 TVLDENIPYPTHLLSCGLDNTIKLWDVKTGKCIRT---QFGHV----------------- 552
             LD     P+ L+S   D TI+ WD+++GKC++T    F +V                 
Sbjct: 510 --LD-----PSFLVSGSQDRTIRQWDLRSGKCLQTIDLSFANVLTTSTNVDLSKSTLLTQ 562

Query: 553 ----EGVWDIAADNFRIISGSHDGSIKVWDLQSGKCMHTFNG 590
                 +  + + +  + +G+ DG +++WDL+SGK + T  G
Sbjct: 563 RNERPSIGALQSFDAALATGTKDGVVRLWDLRSGKVIRTLKG 604

>YGL137W (SEC27) [1850] chr7 (249872..249889,250090..252741)
           Coatomer (COPI) complex beta' chain (beta'-COP) of
           secretory pathway vesicles, required for retrograde
           transport from Golgi to endoplasmic reticulum, member of
           the WD (WD-40) repeat family [2670 bp, 889 aa]
          Length = 889

 Score = 89.0 bits (219), Expect = 4e-18,   Method: Compositional matrix adjust.
 Identities = 80/287 (27%), Positives = 121/287 (42%), Gaps = 59/287 (20%)

Query: 315 LFTGSYDSTIGIWDLFTGKLIRRLSGHSDGVKTLYFDDRK--LITGSLDKTIRVWNYITG 372
           + T  Y   + +W+  T   +R +      V+   F  RK  +I GS D  IRV+NY TG
Sbjct: 28  VLTTLYSGRVELWNYETQVEVRSIQVTETPVRAGKFIARKNWIIVGSDDFRIRVFNYNTG 87

Query: 373 ECISTYRGHSDSV--LSVDSYQKVIVSGSADKTVKVWHVESRTCY--TLRGHTEWVNCVK 428
           E +  +  H D +  ++V   +  ++SGS D TVK+W+ E+      T  GH  +V CV 
Sbjct: 88  EKVVDFEAHPDYIRSIAVHPTKPYVLSGSDDLTVKLWNWENNWALEQTFEGHEHFVMCVA 147

Query: 429 LHPKSFSCFSCS-DDTTIRMWDIRTNSCLKVFRGHVGQVQKIIPLTIKDVENLATDNTSD 487
            +PK  S F+    D T+++W +             GQ      LT      +   N  D
Sbjct: 148 FNPKDPSTFASGCLDRTVKVWSL-------------GQSTPNFTLTTGQERGV---NYVD 191

Query: 488 GSSPQDDPTMTDGADESDTPSNEQETVLDENIPYPTHLLSCGLDNTIKLWDVKTGKCIRT 547
                D P M   +D                            D TIK+WD +T  C+ T
Sbjct: 192 YYPLPDKPYMITASD----------------------------DLTIKIWDYQTKSCVAT 223

Query: 548 QFGHVEGVWDIAADNFR-----IISGSHDGSIKVWDLQSGKCMHTFN 589
             GH+    +++   F      IISGS DG++K+W+  + K   T N
Sbjct: 224 LEGHMS---NVSFAVFHPTLPIIISGSEDGTLKIWNSSTYKVEKTLN 267

 Score = 63.5 bits (153), Expect = 3e-10,   Method: Compositional matrix adjust.
 Identities = 53/179 (29%), Positives = 84/179 (46%), Gaps = 14/179 (7%)

Query: 266 IQTQTTRPWKVIYRERFKVES-NWRKGHCRIQEFKGHMDGVLTLQFNYR---LLFTGSYD 321
           I    T+P+ +   +   V+  NW       Q F+GH   V+ + FN +      +G  D
Sbjct: 103 IAVHPTKPYVLSGSDDLTVKLWNWENNWALEQTFEGHEHFVMCVAFNPKDPSTFASGCLD 162

Query: 322 STIGIWDLFTGKLIRRLS-GHSDGVKTL-YF---DDRKLITGSLDKTIRVWNYITGECIS 376
            T+ +W L        L+ G   GV  + Y+   D   +IT S D TI++W+Y T  C++
Sbjct: 163 RTVKVWSLGQSTPNFTLTTGQERGVNYVDYYPLPDKPYMITASDDLTIKIWDYQTKSCVA 222

Query: 377 TYRGHSDSVLSVDSYQ---KVIVSGSADKTVKVWHVES-RTCYTLRGHTEWVNCVKLHP 431
           T  GH  +V S   +     +I+SGS D T+K+W+  + +   TL    E   C+  HP
Sbjct: 223 TLEGHMSNV-SFAVFHPTLPIIISGSEDGTLKIWNSSTYKVEKTLNVGLERSWCIATHP 280

>AAL009C [178] [Homologous to ScYNL006W (LST8) - SH]
           (325785..326696) [912 bp, 303 aa]
          Length = 303

 Score = 85.5 bits (210), Expect = 5e-18,   Method: Compositional matrix adjust.
 Identities = 75/294 (25%), Positives = 122/294 (41%), Gaps = 24/294 (8%)

Query: 314 LLFTGSYDSTIGIWDLFTGKLIRRLSGHSDGVKTLYF-DDRKLITGSLDKTIRVWNYITG 372
           +L +  YD TI  W+  TG   R +      V  L    D++ +  +    +R+++  T 
Sbjct: 4   ILASAGYDHTIRFWEALTGVCSRTIQHADSQVNRLEITSDKRYLAAAGHLHVRMYDIRTT 63

Query: 373 EC--ISTYRGHSDSVLSVDSYQ--KVIVSGSADKTVKVWHVESRTCYTLRGHTEWVNCVK 428
               ++++ GH  +V S+   Q  K +VS S D T+KVW V S +      H   VN V 
Sbjct: 64  NPNPVTSFEGHRGNVTSIAFQQDNKWMVSSSEDGTIKVWDVRSPSVQRNYKHDAPVNEVV 123

Query: 429 LHPKSFSCFSCSDDTTIRMWDIRTNSCLKVFRGHVGQVQKIIPLTIKDVENLATDNTSDG 488
           +HP      SC  D  I++WD+  N C            + + +   D   L   N    
Sbjct: 124 IHPNQGELISCDQDGNIKIWDLGENQCTNQLALEDNTALQSLSIA-SDGSMLVAGNNKGN 182

Query: 489 SSPQDDPTMTDGADESDTPSNEQETVLDENIPYPT---------HLLSCGLDNTIKLWDV 539
                 P  T      DT S +  T    +  Y T         HL +C  D+T ++W V
Sbjct: 183 CYVWKMPNHT------DTASLKPVTKFRSHSKYITRVLLSVDVKHLATCSADHTARVWSV 236

Query: 540 KTGKCIRTQF-GHVEGVWDIA--ADNFRIISGSHDGSIKVWDLQSGKCMHTFNG 590
           +    + T    H   VWD A  AD+  +++   D  +++WDL + + +  + G
Sbjct: 237 EDNFQLETTLDAHSRWVWDCAFSADSAYLVTACSDHYVRLWDLSTREIVRQYGG 290

 Score = 49.3 bits (116), Expect = 5e-06,   Method: Compositional matrix adjust.
 Identities = 51/228 (22%), Positives = 92/228 (40%), Gaps = 64/228 (28%)

Query: 295 IQEFKGHMDGVLTLQF--NYRLLFTGSYDSTIGIWDLFTGKLIRRLSGHSDGVK--TLYF 350
           +  F+GH   V ++ F  + + + + S D TI +WD+ +   ++R   H   V    ++ 
Sbjct: 68  VTSFEGHRGNVTSIAFQQDNKWMVSSSEDGTIKVWDVRSPS-VQRNYKHDAPVNEVVIHP 126

Query: 351 DDRKLITGSLDKTIRVWNYITGEC------------------------------------ 374
           +  +LI+   D  I++W+    +C                                    
Sbjct: 127 NQGELISCDQDGNIKIWDLGENQCTNQLALEDNTALQSLSIASDGSMLVAGNNKGNCYVW 186

Query: 375 -------------ISTYRGHSDSV----LSVDSYQKVIVSGSADKTVKVWHVES--RTCY 415
                        ++ +R HS  +    LSVD   K + + SAD T +VW VE   +   
Sbjct: 187 KMPNHTDTASLKPVTKFRSHSKYITRVLLSVDV--KHLATCSADHTARVWSVEDNFQLET 244

Query: 416 TLRGHTEWV-NCVKLHPKSFSCFSCSDDTTIRMWDIRTNSCLKVFRGH 462
           TL  H+ WV +C      ++   +CSD   +R+WD+ T   ++ + GH
Sbjct: 245 TLDAHSRWVWDCAFSADSAYLVTACSDHY-VRLWDLSTREIVRQYGGH 291

 Score = 34.7 bits (78), Expect = 0.20,   Method: Compositional matrix adjust.
 Identities = 27/99 (27%), Positives = 43/99 (43%), Gaps = 5/99 (5%)

Query: 295 IQEFKGHMDGV--LTLQFNYRLLFTGSYDSTIGIWDLFTG-KLIRRLSGHSDGVKTLYF- 350
           + +F+ H   +  + L  + + L T S D T  +W +    +L   L  HS  V    F 
Sbjct: 200 VTKFRSHSKYITRVLLSVDVKHLATCSADHTARVWSVEDNFQLETTLDAHSRWVWDCAFS 259

Query: 351 -DDRKLITGSLDKTIRVWNYITGECISTYRGHSDSVLSV 388
            D   L+T   D  +R+W+  T E +  Y GH    + V
Sbjct: 260 ADSAYLVTACSDHYVRLWDLSTREIVRQYGGHHKGAVCV 298

 Score = 30.0 bits (66), Expect = 5.9,   Method: Compositional matrix adjust.
 Identities = 12/38 (31%), Positives = 20/38 (52%)

Query: 315 LFTGSYDSTIGIWDLFTGKLIRRLSGHSDGVKTLYFDD 352
           L T   D  + +WDL T +++R+  GH  G   +  +D
Sbjct: 265 LVTACSDHYVRLWDLSTREIVRQYGGHHKGAVCVALND 302

>CAGL0H08932g join(871668..871685,872089..874779) highly similar to
           sp|P41811 Saccharomyces cerevisiae YGL137w SEC27
          Length = 902

 Score = 87.8 bits (216), Expect = 8e-18,   Method: Compositional matrix adjust.
 Identities = 76/287 (26%), Positives = 125/287 (43%), Gaps = 59/287 (20%)

Query: 315 LFTGSYDSTIGIWDLFTGKLIRRLSGHSDGVKTLYFDDRK--LITGSLDKTIRVWNYITG 372
           + T  Y   + IW+  T + +R +      V+   F  RK  ++ GS D  +RV+NY TG
Sbjct: 28  VLTTLYSGRVEIWNYETQQEVRSIQVTDTPVRAGKFITRKNWIVVGSDDNKVRVFNYNTG 87

Query: 373 ECISTYRGHSDSV--LSVDSYQKVIVSGSADKTVKVWHVESRTCY--TLRGHTEWVNCVK 428
           E ++ +  H D +  ++V   +  I++GS D TVK+W+ E+      T +GH  +V CV 
Sbjct: 88  EKVADFVAHPDYIRSIAVHPSKPYILTGSDDLTVKLWNWENDWSLEQTFKGHEHFVMCVA 147

Query: 429 LHPKSFSCFSCS-DDTTIRMWDIRTNSCLKVFRGHVGQVQKIIPLTIKDVENLATDNTSD 487
            +PK  + F+    D  +++W +  ++    F  H GQ + +              N  D
Sbjct: 148 FNPKDPNVFASGCLDHKVKVWSLGQST--PNFTLHTGQEKGV--------------NYVD 191

Query: 488 GSSPQDDPTMTDGADESDTPSNEQETVLDENIPYPTHLLSCGLDNTIKLWDVKTGKCIRT 547
                D P M   +D                            D T+K++D +T  C+ T
Sbjct: 192 YYPLPDKPYMITSSD----------------------------DTTVKIFDYQTKSCVAT 223

Query: 548 QFGHVEGVWDIAADNFR-----IISGSHDGSIKVWDLQSGKCMHTFN 589
             GH+  V   +   F      IISGS DG++K+W+  + K   T N
Sbjct: 224 LEGHMSNV---SFAVFHPTLPIIISGSEDGTVKLWNSSTYKLEKTLN 267

 Score = 58.2 bits (139), Expect = 2e-08,   Method: Compositional matrix adjust.
 Identities = 60/238 (25%), Positives = 102/238 (42%), Gaps = 23/238 (9%)

Query: 237 PNCGWGLPLLHMKRARIQQNSTGSSSNADIQTQT-TRPWKVIYRERFKVES--------- 286
           P+  W L  L+  R  I    T     +   T T  R  K I R+ + V           
Sbjct: 23  PSEPWVLTTLYSGRVEIWNYETQQEVRSIQVTDTPVRAGKFITRKNWIVVGSDDNKVRVF 82

Query: 287 NWRKGHCRIQEFKGHMDGV--LTLQFNYRLLFTGSYDSTIGIWDLFTG-KLIRRLSGHSD 343
           N+  G  ++ +F  H D +  + +  +   + TGS D T+ +W+      L +   GH  
Sbjct: 83  NYNTGE-KVADFVAHPDYIRSIAVHPSKPYILTGSDDLTVKLWNWENDWSLEQTFKGHEH 141

Query: 344 GVKTLYF---DDRKLITGSLDKTIRVWNY-ITGECISTYRGHSDSVLSVDSY----QKVI 395
            V  + F   D     +G LD  ++VW+   +    + + G    V  VD Y    +  +
Sbjct: 142 FVMCVAFNPKDPNVFASGCLDHKVKVWSLGQSTPNFTLHTGQEKGVNYVDYYPLPDKPYM 201

Query: 396 VSGSADKTVKVWHVESRTCY-TLRGHTEWVNCVKLHPKSFSCFSCSDDTTIRMWDIRT 452
           ++ S D TVK++  ++++C  TL GH   V+    HP      S S+D T+++W+  T
Sbjct: 202 ITSSDDTTVKIFDYQTKSCVATLEGHMSNVSFAVFHPTLPIIISGSEDGTVKLWNSST 259

>Kwal_27.12667
          Length = 721

 Score = 87.4 bits (215), Expect = 1e-17,   Method: Compositional matrix adjust.
 Identities = 75/270 (27%), Positives = 115/270 (42%), Gaps = 46/270 (17%)

Query: 340 GHSDGVKTLYFD---DRKLITGSLDKTIRVWNYITGECISTYRGHSDSVLSV---DSYQK 393
            H D +  L FD         G LD ++++WN      I    GH  SV  +   DS+  
Sbjct: 402 AHDDSITCLDFDLPFGTMCTAGKLDHSVKIWNLSKKTQIGALPGHLASVSCMQMEDSHS- 460

Query: 394 VIVSGSADKTVKVWHVESRTCYTLRGHTEWVN--CV-----------KLHPKSFSCFSCS 440
            +++G  D  +K+W +E        G TE     CV            LH +  S  S S
Sbjct: 461 -LITGGRDALLKLWDIEKAEELYNDGATEGEEELCVHTFDAHVDEITALHFEGNSLVSGS 519

Query: 441 DDTTIRMWDIRTNSCLKVFRGHVGQVQKIIPLTIKDVENLATDNTSDGSS--PQDDPTMT 498
            D TIR WD+ T  CL+                  D+ N A   TS G S    ++P  +
Sbjct: 520 QDRTIRQWDLTTGKCLQTI----------------DI-NFANRGTSGGFSKISSNNPRSS 562

Query: 499 DGADESDTPSNEQETVLDENIPYPTHLLSCGLDNTIKLWDVKTGKCIRTQFGHVEGVWDI 558
                +D P      V+     Y   + +   D  ++LWD+++G+ IRT  GH + V  +
Sbjct: 563 ILLTHNDPP------VIGALQCYDAAMATGTKDGLVRLWDLRSGQVIRTLEGHTDAVTGL 616

Query: 559 AADNFRIISGSHDGSIKVWDLQSGKCMHTF 588
             D+  +++GS D SI++WDL++G     F
Sbjct: 617 QFDSVNLVTGSLDRSIRIWDLRTGLLADAF 646

 Score = 72.8 bits (177), Expect = 3e-13,   Method: Compositional matrix adjust.
 Identities = 53/211 (25%), Positives = 88/211 (41%), Gaps = 46/211 (21%)

Query: 293 CRIQEFKGHMDGVLTLQF-NYRLLFTGSYDSTIGIWDLFTGK--------------LIRR 337
            +I    GH+  V  +Q  +   L TG  D+ + +WD+   +               +  
Sbjct: 438 TQIGALPGHLASVSCMQMEDSHSLITGGRDALLKLWDIEKAEELYNDGATEGEEELCVHT 497

Query: 338 LSGHSDGVKTLYFDDRKLITGSLDKTIRVWNYITGECISTY------RGHSDSVLSVDS- 390
              H D +  L+F+   L++GS D+TIR W+  TG+C+ T       RG S     + S 
Sbjct: 498 FDAHVDEITALHFEGNSLVSGSQDRTIRQWDLTTGKCLQTIDINFANRGTSGGFSKISSN 557

Query: 391 ---------------------YQKVIVSGSADKTVKVWHVES-RTCYTLRGHTEWVNCVK 428
                                Y   + +G+ D  V++W + S +   TL GHT+ V  ++
Sbjct: 558 NPRSSILLTHNDPPVIGALQCYDAAMATGTKDGLVRLWDLRSGQVIRTLEGHTDAVTGLQ 617

Query: 429 LHPKSFSCFSCSDDTTIRMWDIRTNSCLKVF 459
               S +  + S D +IR+WD+RT      F
Sbjct: 618 F--DSVNLVTGSLDRSIRIWDLRTGLLADAF 646

 Score = 66.6 bits (161), Expect = 3e-11,   Method: Compositional matrix adjust.
 Identities = 36/95 (37%), Positives = 59/95 (62%), Gaps = 3/95 (3%)

Query: 315 LFTGSYDSTIGIWDLFTGKLIRRLSGHSDGVKTLYFDDRKLITGSLDKTIRVWNYITGEC 374
           + TG+ D  + +WDL +G++IR L GH+D V  L FD   L+TGSLD++IR+W+  TG  
Sbjct: 583 MATGTKDGLVRLWDLRSGQVIRTLEGHTDAVTGLQFDSVNLVTGSLDRSIRIWDLRTGLL 642

Query: 375 ISTYRGHSD-SVLSVDSYQKVIVSGSADKTVKVWH 408
              +  +S  S L  D  + ++VS + +  V+V++
Sbjct: 643 ADAFAYNSPISSLQFD-LEHILVSNN-ESVVQVYN 675

 Score = 64.7 bits (156), Expect = 1e-10,   Method: Compositional matrix adjust.
 Identities = 52/234 (22%), Positives = 89/234 (38%), Gaps = 56/234 (23%)

Query: 289 RKGHCRIQEF-----------KGHMDGVLTLQFNY---RLLFTGSYDSTIGIWDLFTGKL 334
           RK +  +Q+F           K H D +  L F+     +   G  D ++ IW+L     
Sbjct: 380 RKTYPTLQQFYEPGTQISSFPKAHDDSITCLDFDLPFGTMCTAGKLDHSVKIWNLSKKTQ 439

Query: 335 IRRLSGHSDGVKTLYFDD-RKLITGSLDKTIRVWNYITGE--------------CISTYR 379
           I  L GH   V  +  +D   LITG  D  +++W+    E              C+ T+ 
Sbjct: 440 IGALPGHLASVSCMQMEDSHSLITGGRDALLKLWDIEKAEELYNDGATEGEEELCVHTFD 499

Query: 380 GHSDSVLSVDSYQKVIVSGSADKTVKVWHVESRTC-------YTLRGHTEWVNCVKLH-- 430
            H D + ++      +VSGS D+T++ W + +  C       +  RG +   + +  +  
Sbjct: 500 AHVDEITALHFEGNSLVSGSQDRTIRQWDLTTGKCLQTIDINFANRGTSGGFSKISSNNP 559

Query: 431 ----------PKSFSCFSCSD--------DTTIRMWDIRTNSCLKVFRGHVGQV 466
                     P       C D        D  +R+WD+R+   ++   GH   V
Sbjct: 560 RSSILLTHNDPPVIGALQCYDAAMATGTKDGLVRLWDLRSGQVIRTLEGHTDAV 613

 Score = 60.8 bits (146), Expect = 2e-09,   Method: Compositional matrix adjust.
 Identities = 60/255 (23%), Positives = 102/255 (40%), Gaps = 69/255 (27%)

Query: 369 YITGECISTY-RGHSDSVLSVD---SYQKVIVSGSADKTVKVWHVESRT-CYTLRGHTEW 423
           Y  G  IS++ + H DS+  +D    +  +  +G  D +VK+W++  +T    L GH   
Sbjct: 390 YEPGTQISSFPKAHDDSITCLDFDLPFGTMCTAGKLDHSVKIWNLSKKTQIGALPGHLAS 449

Query: 424 VNCVKLHPKSFSCFSCSDDTTIRMWDIRTNSCLKVFRGHVGQVQKIIPLTIKDVENLATD 483
           V+C+++   S S  +   D  +++WDI                        +  E L  D
Sbjct: 450 VSCMQME-DSHSLITGGRDALLKLWDI------------------------EKAEELYND 484

Query: 484 NTSDGSSPQDDPTMTDGADESDTPSNEQETVLDENIPYPTHLLSCGLDNTIKLWDVKTGK 543
             ++G       T     DE      E  +           L+S   D TI+ WD+ TGK
Sbjct: 485 GATEGEEELCVHTFDAHVDEITALHFEGNS-----------LVSGSQDRTIRQWDLTTGK 533

Query: 544 CIRT------QFGHVEGVWDIAADNFR----------------------IISGSHDGSIK 575
           C++T        G   G   I+++N R                      + +G+ DG ++
Sbjct: 534 CLQTIDINFANRGTSGGFSKISSNNPRSSILLTHNDPPVIGALQCYDAAMATGTKDGLVR 593

Query: 576 VWDLQSGKCMHTFNG 590
           +WDL+SG+ + T  G
Sbjct: 594 LWDLRSGQVIRTLEG 608

>Kwal_26.7570
          Length = 218

 Score = 82.4 bits (202), Expect = 1e-17,   Method: Compositional matrix adjust.
 Identities = 51/127 (40%), Positives = 68/127 (53%), Gaps = 9/127 (7%)

Query: 314 LLFTGSYDSTIGIWDLFT-----GKLIRRLSGHSDGVK--TLYFDDRKLITGSLDKTIRV 366
           LL +GS D ++  W L       G  +R   GHS  V+  T+  D    ++ S DKT+R+
Sbjct: 32  LLLSGSRDKSLITWKLTGDDQQYGVPVRSFRGHSHIVQDCTVTPDGEYALSASWDKTVRL 91

Query: 367 WNYITGECISTYRGHSDSVLSV--DSYQKVIVSGSADKTVKVWHVESRTCYTLRGHTEWV 424
           W   TG+CI  + GH   VLSV  D     IVS S DKTVKVW+       TL GH +WV
Sbjct: 92  WELATGKCIQRFVGHKSDVLSVTIDRRASQIVSASRDKTVKVWNTLGECMVTLLGHNDWV 151

Query: 425 NCVKLHP 431
           + V++ P
Sbjct: 152 SQVRVAP 158

 Score = 51.2 bits (121), Expect = 4e-07,   Method: Compositional matrix adjust.
 Identities = 28/73 (38%), Positives = 41/73 (56%), Gaps = 3/73 (4%)

Query: 520 PYPTHLLSCGLDNTIKLWDVKTGKCIRTQFGHVEGVWDIAADN--FRIISGSHDGSIKVW 577
           P   + LS   D T++LW++ TGKCI+   GH   V  +  D    +I+S S D ++KVW
Sbjct: 75  PDGEYALSASWDKTVRLWELATGKCIQRFVGHKSDVLSVTIDRRASQIVSASRDKTVKVW 134

Query: 578 DLQSGKCMHTFNG 590
           +   G+CM T  G
Sbjct: 135 NTL-GECMVTLLG 146

 Score = 43.9 bits (102), Expect = 1e-04,   Method: Compositional matrix adjust.
 Identities = 28/102 (27%), Positives = 47/102 (46%), Gaps = 9/102 (8%)

Query: 377 TYRGHSDSVLSV---DSYQKVIVSGSADKTVKVWHVESR------TCYTLRGHTEWVNCV 427
           T  GH+  V S+    +   +++SGS DK++  W +            + RGH+  V   
Sbjct: 12  TLEGHNGWVTSLATSPAQPNLLLSGSRDKSLITWKLTGDDQQYGVPVRSFRGHSHIVQDC 71

Query: 428 KLHPKSFSCFSCSDDTTIRMWDIRTNSCLKVFRGHVGQVQKI 469
            + P      S S D T+R+W++ T  C++ F GH   V  +
Sbjct: 72  TVTPDGEYALSASWDKTVRLWELATGKCIQRFVGHKSDVLSV 113

 Score = 39.3 bits (90), Expect = 0.005,   Method: Compositional matrix adjust.
 Identities = 27/91 (29%), Positives = 43/91 (47%), Gaps = 7/91 (7%)

Query: 509 NEQETVLDENIPYPTHLLSCGLDNTIKLW-----DVKTGKCIRTQFGHVEGVWD--IAAD 561
           N   T L  +   P  LLS   D ++  W     D + G  +R+  GH   V D  +  D
Sbjct: 17  NGWVTSLATSPAQPNLLLSGSRDKSLITWKLTGDDQQYGVPVRSFRGHSHIVQDCTVTPD 76

Query: 562 NFRIISGSHDGSIKVWDLQSGKCMHTFNGRR 592
               +S S D ++++W+L +GKC+  F G +
Sbjct: 77  GEYALSASWDKTVRLWELATGKCIQRFVGHK 107

>AEL314W [2191] [Homologous to ScYJL112W (MDV1) - SH; ScYKR036C
           (CAF4) - SH] complement(52978..55125) [2148 bp, 715 aa]
          Length = 715

 Score = 87.0 bits (214), Expect = 1e-17,   Method: Compositional matrix adjust.
 Identities = 67/269 (24%), Positives = 116/269 (43%), Gaps = 50/269 (18%)

Query: 339 SGHSDGVKTLYFD---DRKLITGSLDKTIRVWNYITGECISTYRGHSDSV--LSVDSYQK 393
           S H D V  L F+         G LD TI+VWN    + +++  GH  +V  + +D Y  
Sbjct: 408 SAHEDNVTCLDFNLPFGTLCSAGKLDPTIKVWNLSKNKHVASITGHLATVSCMQMDQYN- 466

Query: 394 VIVSGSADKTVKVWHVES----------RTC-YTLRGHTEWVNCVKLHPKSFSCFSCSDD 442
            +++G  D  +K+W ++             C YT   H + +  +     +    S S D
Sbjct: 467 TLITGGRDALLKMWDIQKAIDNDSIPSDEVCIYTFDSHIDEITALSFEANNL--VSGSQD 524

Query: 443 TTIRMWDIRTNSCLKVFRGHVGQVQKIIPLTIKDVENLATDNTSDG--SSPQDDPTMTDG 500
            TIR WD+    C++            + +      NL+      G  ++  D P +  G
Sbjct: 525 RTIRQWDLNNGKCVQT-----------LDINFATGGNLSRSMIGSGFLNTNNDHPII--G 571

Query: 501 ADESDTPSNEQETVLDENIPYPTHLLSCGLDNTIKLWDVKTGKCIRTQFGHVEGVWDIAA 560
           A +                 Y   L +   D  ++LWD+++G+ +RT  GH + V  +  
Sbjct: 572 AIQC----------------YDAALATGTKDGIVRLWDLRSGRVVRTLEGHSDAVTSLQF 615

Query: 561 DNFRIISGSHDGSIKVWDLQSGKCMHTFN 589
           D+  +++GS D SI++WDL++G    TF+
Sbjct: 616 DSLNLVTGSLDNSIRIWDLRTGTLADTFS 644

 Score = 77.0 bits (188), Expect = 2e-14,   Method: Compositional matrix adjust.
 Identities = 72/319 (22%), Positives = 126/319 (39%), Gaps = 85/319 (26%)

Query: 300 GHMDGVLTLQFNY---RLLFTGSYDSTIGIWDLFTGKLIRRLSGHSDGVKTLYFDD-RKL 355
            H D V  L FN     L   G  D TI +W+L   K +  ++GH   V  +  D    L
Sbjct: 409 AHEDNVTCLDFNLPFGTLCSAGKLDPTIKVWNLSKNKHVASITGHLATVSCMQMDQYNTL 468

Query: 356 ITGSLDKTIRVWNYITG----------ECISTYRGHSDSVLSVDSYQKVIVSGSADKTVK 405
           ITG  D  +++W+               CI T+  H D + ++      +VSGS D+T++
Sbjct: 469 ITGGRDALLKMWDIQKAIDNDSIPSDEVCIYTFDSHIDEITALSFEANNLVSGSQDRTIR 528

Query: 406 VWHVESRTC-------YTLRGH-------TEWVNCVKLHP--KSFSCFSCS-----DDTT 444
            W + +  C       +   G+       + ++N    HP   +  C+  +      D  
Sbjct: 529 QWDLNNGKCVQTLDINFATGGNLSRSMIGSGFLNTNNDHPIIGAIQCYDAALATGTKDGI 588

Query: 445 IRMWDIRTNSCLKVFRGHVGQVQKIIPLTIKDVENLATDNTSDGSSPQDDPTMTDGADES 504
           +R+WD+R+   ++   GH                                         S
Sbjct: 589 VRLWDLRSGRVVRTLEGH-----------------------------------------S 607

Query: 505 DTPSNEQETVLDENIPYPTHLLSCGLDNTIKLWDVKTGKCIRTQFGHVEGVWDIAADNFR 564
           D  ++ Q   L+        L++  LDN+I++WD++TG    T F +   V  +  D  +
Sbjct: 608 DAVTSLQFDSLN--------LVTGSLDNSIRIWDLRTGTLADT-FSYEHPVTCLQFDLNK 658

Query: 565 IISGSHDGSIKVWDLQSGK 583
           I+  + +G++KV++ Q  K
Sbjct: 659 IVVANQEGTVKVYNRQEKK 677

 Score = 74.7 bits (182), Expect = 1e-13,   Method: Compositional matrix adjust.
 Identities = 42/115 (36%), Positives = 67/115 (58%), Gaps = 3/115 (2%)

Query: 315 LFTGSYDSTIGIWDLFTGKLIRRLSGHSDGVKTLYFDDRKLITGSLDKTIRVWNYITGEC 374
           L TG+ D  + +WDL +G+++R L GHSD V +L FD   L+TGSLD +IR+W+  TG  
Sbjct: 580 LATGTKDGIVRLWDLRSGRVVRTLEGHSDAVTSLQFDSLNLVTGSLDNSIRIWDLRTGTL 639

Query: 375 ISTYR-GHSDSVLSVDSYQKVIVSGSADKTVKVWHVESRTCYTLRGHTEWVNCVK 428
             T+   H  + L  D   K++V+ + + TVKV++ + +  +   G     N V+
Sbjct: 640 ADTFSYEHPVTCLQFD-LNKIVVA-NQEGTVKVYNRQEKKHWFCGGDEHSENAVE 692

 Score = 65.1 bits (157), Expect = 9e-11,   Method: Compositional matrix adjust.
 Identities = 43/157 (27%), Positives = 70/157 (44%), Gaps = 22/157 (14%)

Query: 295 IQEFKGHMDGVLTLQFNYRLLFTGSYDSTIGIWDLFTGKLIRRL---------------- 338
           I  F  H+D +  L F    L +GS D TI  WDL  GK ++ L                
Sbjct: 498 IYTFDSHIDEITALSFEANNLVSGSQDRTIRQWDLNNGKCVQTLDINFATGGNLSRSMIG 557

Query: 339 SGHSDG------VKTLYFDDRKLITGSLDKTIRVWNYITGECISTYRGHSDSVLSVDSYQ 392
           SG  +       +  +   D  L TG+ D  +R+W+  +G  + T  GHSD+V S+    
Sbjct: 558 SGFLNTNNDHPIIGAIQCYDAALATGTKDGIVRLWDLRSGRVVRTLEGHSDAVTSLQFDS 617

Query: 393 KVIVSGSADKTVKVWHVESRTCYTLRGHTEWVNCVKL 429
             +V+GS D ++++W + + T      +   V C++ 
Sbjct: 618 LNLVTGSLDNSIRIWDLRTGTLADTFSYEHPVTCLQF 654

 Score = 48.1 bits (113), Expect = 2e-05,   Method: Compositional matrix adjust.
 Identities = 56/252 (22%), Positives = 99/252 (39%), Gaps = 73/252 (28%)

Query: 369 YITGECISTY-RGHSDSVLSVD---SYQKVIVSGSADKTVKVWHV-ESRTCYTLRGHTEW 423
           Y  G  I ++   H D+V  +D    +  +  +G  D T+KVW++ +++   ++ GH   
Sbjct: 397 YEPGANILSFDSAHEDNVTCLDFNLPFGTLCSAGKLDPTIKVWNLSKNKHVASITGHLAT 456

Query: 424 VNCVKLHPKSFSCFSCSDDTTIRMWDIRTNSCLKVFRGHVGQVQKIIPLTIKDVENLATD 483
           V+C+++   + +  +   D  ++MWDI+                             A D
Sbjct: 457 VSCMQMDQYN-TLITGGRDALLKMWDIQK----------------------------AID 487

Query: 484 NTSDGSSPQDDP---TMTDGADESDTPSNEQETVLDENIPYPTHLLSCGLDNTIKLWDVK 540
           N    S P D+    T     DE    S E             +L+S   D TI+ WD+ 
Sbjct: 488 N---DSIPSDEVCIYTFDSHIDEITALSFE-----------ANNLVSGSQDRTIRQWDLN 533

Query: 541 TGKCIRT-QFGHVEG---------------------VWDIAADNFRIISGSHDGSIKVWD 578
            GKC++T       G                     +  I   +  + +G+ DG +++WD
Sbjct: 534 NGKCVQTLDINFATGGNLSRSMIGSGFLNTNNDHPIIGAIQCYDAALATGTKDGIVRLWD 593

Query: 579 LQSGKCMHTFNG 590
           L+SG+ + T  G
Sbjct: 594 LRSGRVVRTLEG 605

>AFL118W [3077] [Homologous to ScYGL137W (SEC27) - SH]
           complement(216252..216269,216423..218903) [2499 bp, 832
           aa]
          Length = 832

 Score = 87.4 bits (215), Expect = 1e-17,   Method: Compositional matrix adjust.
 Identities = 77/279 (27%), Positives = 118/279 (42%), Gaps = 53/279 (18%)

Query: 320 YDSTIGIWDLFTGKLIRRLSGHSDGVKTLYFDDRK--LITGSLDKTIRVWNYITGECIST 377
           Y     IW+  T   +R +S     V+   F  RK  +I GS D  IRV+NY TGE +  
Sbjct: 33  YSGRAEIWNYETQTEVRSISVCEAPVRAGKFIPRKSWIIVGSDDFKIRVFNYNTGEKVVD 92

Query: 378 YRGHSDSV--LSVDSYQKVIVSGSADKTVKVWHVESRTCY--TLRGHTEWVNCVKLHPKS 433
           +  H D +  L+V   +  ++S S D TVK+W+ E       T  GH  +V  V  +PK 
Sbjct: 93  FEAHPDYIRALAVHPTRSYVLSASDDLTVKLWNWEKNWALEQTFEGHEHFVMSVTFNPKD 152

Query: 434 FSCFSCS-DDTTIRMWDIRTNSCLKVFRGHVGQVQKIIPLTIKDVENLATDNTSDGSSPQ 492
            + F+ +  D T+++W +   +     R H+   +K +             N  D    Q
Sbjct: 153 PNTFATACLDHTVKIWSLGQETSNFTLRAHL---EKGV-------------NFVDYYPFQ 196

Query: 493 DDPTMTDGADESDTPSNEQETVLDENIPYPTHLLSCGLDNTIKLWDVKTGKCIRTQFGHV 552
           D P                            +L++   D T+K+WD +T  C+ T  GH+
Sbjct: 197 DKP----------------------------YLITSSDDRTVKVWDYQTKSCVATLEGHL 228

Query: 553 EGVWDIAADNFR--IISGSHDGSIKVWDLQSGKCMHTFN 589
             V           IISGS DG++K+W+  + K   T N
Sbjct: 229 SNVSYAVYHPMLPIIISGSEDGTVKIWNSNTYKLERTLN 267

 Score = 72.4 bits (176), Expect = 5e-13,   Method: Compositional matrix adjust.
 Identities = 52/181 (28%), Positives = 88/181 (48%), Gaps = 17/181 (9%)

Query: 315 LFTGSYDSTIGIWDLFTGKLIRRLSGHSDGVKTLYFDDRK--LITGSLDKTIRVWNYITG 372
           +  GS D  I +++  TG+ +     H D ++ L     +  +++ S D T+++WN+   
Sbjct: 70  IIVGSDDFKIRVFNYNTGEKVVDFEAHPDYIRALAVHPTRSYVLSASDDLTVKLWNWEKN 129

Query: 373 ECIS-TYRGHSDSVLSVDSYQK---VIVSGSADKTVKVWHVESRTC-YTLRGHTE-WVNC 426
             +  T+ GH   V+SV    K      +   D TVK+W +   T  +TLR H E  VN 
Sbjct: 130 WALEQTFEGHEHFVMSVTFNPKDPNTFATACLDHTVKIWSLGQETSNFTLRAHLEKGVNF 189

Query: 427 VKLHP---KSFSCFSCSDDTTIRMWDIRTNSCLKVFRGHVGQV-----QKIIPLTIKDVE 478
           V  +P   K +   + SDD T+++WD +T SC+    GH+  V       ++P+ I   E
Sbjct: 190 VDYYPFQDKPY-LITSSDDRTVKVWDYQTKSCVATLEGHLSNVSYAVYHPMLPIIISGSE 248

Query: 479 N 479
           +
Sbjct: 249 D 249

 Score = 69.3 bits (168), Expect = 5e-12,   Method: Compositional matrix adjust.
 Identities = 56/159 (35%), Positives = 77/159 (48%), Gaps = 17/159 (10%)

Query: 287 NWRKGHCRIQEFKGHMDGVLTLQFNYR---LLFTGSYDSTIGIWDL------FTGKLIRR 337
           NW K     Q F+GH   V+++ FN +      T   D T+ IW L      FT  L   
Sbjct: 125 NWEKNWALEQTFEGHEHFVMSVTFNPKDPNTFATACLDHTVKIWSLGQETSNFT--LRAH 182

Query: 338 LSGHSDGVKTLYFDDRK-LITGSLDKTIRVWNYITGECISTYRGHSDSVLSVDSYQ---K 393
           L    + V    F D+  LIT S D+T++VW+Y T  C++T  GH  +V S   Y     
Sbjct: 183 LEKGVNFVDYYPFQDKPYLITSSDDRTVKVWDYQTKSCVATLEGHLSNV-SYAVYHPMLP 241

Query: 394 VIVSGSADKTVKVWHVES-RTCYTLRGHTEWVNCVKLHP 431
           +I+SGS D TVK+W+  + +   TL    E   CV  HP
Sbjct: 242 IIISGSEDGTVKIWNSNTYKLERTLNLGLERSWCVAAHP 280

>CAGL0M02277g complement(271836..273119) highly similar to sp|Q12417
           Saccharomyces cerevisiae YPL151c PRP46 Pre-mRNA splicing
           factor PRP46, hypothetical start
          Length = 427

 Score = 85.5 bits (210), Expect = 2e-17,   Method: Compositional matrix adjust.
 Identities = 55/158 (34%), Positives = 77/158 (48%), Gaps = 5/158 (3%)

Query: 317 TGSYDSTIGIWDLFTGKLIRRLSGHSDGVKTLYFDDRK--LITGSLDKTIRVWNYITGEC 374
           TGS D TI IW+L +GKL   L  H   V+ L   +R   + + S DKT++ W+      
Sbjct: 133 TGSNDKTIKIWNLASGKLKVTLKAHDMTVRDLAISNRHPYMFSVSEDKTVKCWDLEKNTA 192

Query: 375 ISTYRGHSDSVLSVDSYQ--KVIVSGSADKTVKVWHVESR-TCYTLRGHTEWVNCVKLHP 431
           I  Y GH   V +VD +    V+V+   D  VKVW + +R    TL GH   +  V+  P
Sbjct: 193 IRNYHGHLSGVHTVDIHPTVDVVVTAGRDSVVKVWDIRTRLPVMTLPGHKGPITKVRCLP 252

Query: 432 KSFSCFSCSDDTTIRMWDIRTNSCLKVFRGHVGQVQKI 469
                 S S D +IR+WD+     +KV   H   V+ I
Sbjct: 253 VDPQVISSSVDASIRLWDLVAGKSMKVLTHHQRTVRDI 290

 Score = 82.8 bits (203), Expect = 1e-16,   Method: Compositional matrix adjust.
 Identities = 67/268 (25%), Positives = 107/268 (39%), Gaps = 56/268 (20%)

Query: 334 LIRRLSGHSDGVKTLYFD---DRKLITGSLDKTIRVWNYITGECISTYRGHSDSV--LSV 388
           L R + GH   V+ +  D   +    TGS DKTI++WN  +G+   T + H  +V  L++
Sbjct: 107 LTRVIHGHHGWVRCIAMDKVDNEWFATGSNDKTIKIWNLASGKLKVTLKAHDMTVRDLAI 166

Query: 389 DSYQKVIVSGSADKTVKVWHVESRTCY-TLRGHTEWVNCVKLHPKSFSCFSCSDDTTIRM 447
            +    + S S DKTVK W +E  T      GH   V+ V +HP      +   D+ +++
Sbjct: 167 SNRHPYMFSVSEDKTVKCWDLEKNTAIRNYHGHLSGVHTVDIHPTVDVVVTAGRDSVVKV 226

Query: 448 WDIRTNSCLKVFRGHVGQVQKIIPLTIKDVENLATDNTSDGSSPQDDPTMTDGADESDTP 507
           WDIRT   +    GH G + K+                                      
Sbjct: 227 WDIRTRLPVMTLPGHKGPITKV-------------------------------------- 248

Query: 508 SNEQETVLDENIPYPTHLLSCGLDNTIKLWDVKTGKCIRTQFGHVEGVWDIAA--DNFRI 565
                      +P    ++S  +D +I+LWD+  GK ++    H   V DI+     F  
Sbjct: 249 ---------RCLPVDPQVISSSVDASIRLWDLVAGKSMKVLTHHQRTVRDISVHPSEFSF 299

Query: 566 ISGSHDGSIKVWDLQSGKCMHTFNGRRL 593
            S   +  I+ W L  G+ +  F  + L
Sbjct: 300 ASACTN-DIRSWLLPKGELLTNFVSQDL 326

 Score = 62.4 bits (150), Expect = 4e-10,   Method: Compositional matrix adjust.
 Identities = 50/187 (26%), Positives = 79/187 (42%), Gaps = 8/187 (4%)

Query: 306 LTLQFNYRLLFTGSYDSTIGIWDLFTGKLIRRLSGHSDGVKTLYFDDR--KLITGSLDKT 363
           L +   +  +F+ S D T+  WDL     IR   GH  GV T+        ++T   D  
Sbjct: 164 LAISNRHPYMFSVSEDKTVKCWDLEKNTAIRNYHGHLSGVHTVDIHPTVDVVVTAGRDSV 223

Query: 364 IRVWNYITGECISTYRGHSDSVLSVD--SYQKVIVSGSADKTVKVWH-VESRTCYTLRGH 420
           ++VW+  T   + T  GH   +  V        ++S S D ++++W  V  ++   L  H
Sbjct: 224 VKVWDIRTRLPVMTLPGHKGPITKVRCLPVDPQVISSSVDASIRLWDLVAGKSMKVLTHH 283

Query: 421 TEWVNCVKLHPKSFSCFS-CSDDTTIRMWDIRTNSCLKVFRGHVGQVQKIIPLTIKDVEN 479
              V  + +HP  FS  S C++D  IR W +     L  F      V   + +   DV  
Sbjct: 284 QRTVRDISVHPSEFSFASACTND--IRSWLLPKGELLTNFVSQDLDVINTVSINQDDVLF 341

Query: 480 LATDNTS 486
             +DN S
Sbjct: 342 AGSDNGS 348

 Score = 52.8 bits (125), Expect = 5e-07,   Method: Compositional matrix adjust.
 Identities = 47/188 (25%), Positives = 81/188 (43%), Gaps = 20/188 (10%)

Query: 407 WHVESRTCYTLRGHTEWVNCVKLHPKSFSCFSC-SDDTTIRMWDIRTNSCLKVFRGHVGQ 465
           WH        + GH  WV C+ +       F+  S+D TI++W++ +       + H   
Sbjct: 101 WHAPWHLTRVIHGHHGWVRCIAMDKVDNEWFATGSNDKTIKIWNLASGKLKVTLKAH--- 157

Query: 466 VQKIIPLTIKDVENLATDNTSDGS-SPQDDPTMTDGADESDTPSNEQETVLDENIPYPTH 524
                 +T++D   LA  N      S  +D T+     E +T        L        H
Sbjct: 158 -----DMTVRD---LAISNRHPYMFSVSEDKTVKCWDLEKNTAIRNYHGHLSGVHTVDIH 209

Query: 525 -----LLSCGLDNTIKLWDVKTGKCIRTQFGHVEGVWDI--AADNFRIISGSHDGSIKVW 577
                +++ G D+ +K+WD++T   + T  GH   +  +     + ++IS S D SI++W
Sbjct: 210 PTVDVVVTAGRDSVVKVWDIRTRLPVMTLPGHKGPITKVRCLPVDPQVISSSVDASIRLW 269

Query: 578 DLQSGKCM 585
           DL +GK M
Sbjct: 270 DLVAGKSM 277

>KLLA0E12287g join(1086778..1087329,1087730..1088158) similar to
           sp|P38011 Saccharomyces cerevisiae YMR116c ASC1 40S
           small subunit ribosomal protein, start by similarity
          Length = 326

 Score = 84.0 bits (206), Expect = 2e-17,   Method: Compositional matrix adjust.
 Identities = 58/179 (32%), Positives = 85/179 (47%), Gaps = 21/179 (11%)

Query: 314 LLFTGSYDSTIGIWDLFT-----GKLIRRLSGHSDGVKTLYF--DDRKLITGSLDKTIRV 366
           LL +GS D T+  W L       G  +R   GHS  V+ +    D    ++ S DKT+R+
Sbjct: 33  LLVSGSRDKTLISWRLTENEQQFGVPVRSYKGHSHIVQDVVVSADGNYAVSASWDKTLRL 92

Query: 367 WNYITGECISTYRGHSDSVLSV--DSYQKVIVSGSADKTVKVWHVESRTCYTLRGHTEWV 424
           WN  TG   + + GH+  VLSV  D+    I+S S DKT++VW+      Y L GHT+WV
Sbjct: 93  WNLATGNSEARFVGHTGDVLSVAIDANSSKIISASRDKTIRVWNTVGDCAYVLLGHTDWV 152

Query: 425 NCVKLHPKSF----------SCFSCSDDTTIRMWDIRTNS--CLKVFRGHVGQVQKIIP 471
             V++ PK+           +  S   D  +R W +  +S      F GH   +  + P
Sbjct: 153 TKVRVAPKNLEDGEVDDGRITFVSAGMDKIVRSWSLNEDSYRIEADFIGHNNYINVVQP 211

 Score = 45.1 bits (105), Expect = 1e-04,   Method: Compositional matrix adjust.
 Identities = 61/246 (24%), Positives = 94/246 (38%), Gaps = 45/246 (18%)

Query: 377 TYRGHSDSV--LSVDSYQ-KVIVSGSADKTVKVWHVESRT------CYTLRGHTEWVNCV 427
           T  GH+  V  LS  + Q  ++VSGS DKT+  W +            + +GH+  V  V
Sbjct: 13  TLEGHNGWVTSLSTSAAQPNLLVSGSRDKTLISWRLTENEQQFGVPVRSYKGHSHIVQDV 72

Query: 428 KLHPKSFSCFSCSDDTTIRMWDIRTNSCLKVFRGHVGQVQKIIPLTIKDVENLATD-NTS 486
            +        S S D T+R+W++ T +    F GH G           DV ++A D N+S
Sbjct: 73  VVSADGNYAVSASWDKTLRLWNLATGNSEARFVGHTG-----------DVLSVAIDANSS 121

Query: 487 DGSSPQDDPTMTDGADESD-----------------TPSNEQETVLDENIPYPTHLLSCG 529
              S   D T+       D                  P N ++  +D+        +S G
Sbjct: 122 KIISASRDKTIRVWNTVGDCAYVLLGHTDWVTKVRVAPKNLEDGEVDDG---RITFVSAG 178

Query: 530 LDNTIKLWDVKTGKC-IRTQF-GHVE--GVWDIAADNFRIISGSHDGSIKVWDLQSGKCM 585
           +D  ++ W +      I   F GH     V   + D     S   DG I VW+L+     
Sbjct: 179 MDKIVRSWSLNEDSYRIEADFIGHNNYINVVQPSPDGSLAASAGKDGQIYVWNLKHKSAF 238

Query: 586 HTFNGR 591
             F+ +
Sbjct: 239 MNFDAK 244

>Kwal_56.24526
          Length = 1210

 Score = 86.7 bits (213), Expect = 2e-17,   Method: Compositional matrix adjust.
 Identities = 89/391 (22%), Positives = 154/391 (39%), Gaps = 93/391 (23%)

Query: 271 TRPWKVIYRERFKVES-NWRKGHCRIQEFKGHMDGVLTLQFN--YRLLFTGSYDSTIGIW 327
           +RPW ++      ++  ++R G   + +F+ H   V  + F+    L  +   D TI +W
Sbjct: 22  SRPWVLVALFSSSIQLWDYRMGTL-LHKFEDHEGPVRGIDFHPTQPLFVSAGDDYTIKVW 80

Query: 328 DLFTGKLIRRLSGHSDGVKTLYFDDRKL---ITGSLDKTIRVWNYITGECISTYRGHSDS 384
            L T K +  L+GH D V+T++F  R+L   I+ S D+TIR+WN+   + I+   GH+  
Sbjct: 81  SLDTKKCLFTLNGHLDYVRTVFF-HRELPWIISASDDQTIRIWNWQNRKEIACLTGHNHF 139

Query: 385 VLSVDSY--QKVIVSGSADKTVKVWHV-------ESRTCYT------------------- 416
           V+  D +  + ++VS S D+TV+VW +        + + YT                   
Sbjct: 140 VMCADFHPTEDLVVSASLDETVRVWDISGLRKRHSAPSTYTLEDQIAAQQNLLDGGFGDC 199

Query: 417 -----LRGHTEWVNCVKLHPKSFSCFSCSDDTTIRMWDIRTNSCLKV--FRGHVGQVQKI 469
                L GH+  VN    HP      S  DD  +++W + +    +V   RGH   V  +
Sbjct: 200 VVKFILEGHSRGVNWASFHPTLPLIVSGGDDRQVKLWRMSSTKAWEVDTCRGHTNNVDSV 259

Query: 470 IPLTIKDVENLATDNTSDGSSPQDDPTMTDGADESDTPSNEQETVLDENIPYPTHLLSCG 529
           I                                                 P+   ++S G
Sbjct: 260 I-----------------------------------------------FHPHQNLIISVG 272

Query: 530 LDNTIKLWDVKTGKCIRTQFGHVEGVWDIAA-DNFRIISGSHDGSIKVWDLQSGKCMHTF 588
            D T+++WD+     ++      +  W + A  N  +   +HD  I V+ L   +     
Sbjct: 273 EDKTVRVWDLDKRTPVKQFKRENDRFWLVRAHPNINLFGAAHDSGIMVFKLDRERPCSVI 332

Query: 589 NGRRLQRETQHTQTQSL--GDKVAPIACVCI 617
           N  +L    +  Q QS     K+A +  V +
Sbjct: 333 NQNQLIFVNKEKQVQSFDYNKKIASLPYVSL 363

 Score = 68.6 bits (166), Expect = 1e-11,   Method: Compositional matrix adjust.
 Identities = 38/135 (28%), Positives = 66/135 (48%), Gaps = 5/135 (3%)

Query: 333 KLIRRLSGHSDGVKTLYFDDRK--LITGSLDKTIRVWNYITGECISTYRGHSDSVLSVDS 390
           K++ +    S   K L F   +  ++      +I++W+Y  G  +  +  H   V  +D 
Sbjct: 2   KMLTKFESKSTRAKGLAFHPSRPWVLVALFSSSIQLWDYRMGTLLHKFEDHEGPVRGIDF 61

Query: 391 Y--QKVIVSGSADKTVKVWHVESRTC-YTLRGHTEWVNCVKLHPKSFSCFSCSDDTTIRM 447
           +  Q + VS   D T+KVW ++++ C +TL GH ++V  V  H +     S SDD TIR+
Sbjct: 62  HPTQPLFVSAGDDYTIKVWSLDTKKCLFTLNGHLDYVRTVFFHRELPWIISASDDQTIRI 121

Query: 448 WDIRTNSCLKVFRGH 462
           W+ +    +    GH
Sbjct: 122 WNWQNRKEIACLTGH 136

>Scas_711.11
          Length = 695

 Score = 85.5 bits (210), Expect = 4e-17,   Method: Compositional matrix adjust.
 Identities = 73/289 (25%), Positives = 122/289 (42%), Gaps = 53/289 (18%)

Query: 299 KGHMDGVLTLQFNY---RLLFTGSYDSTIGIWDLFTGKLIRRLSGHSDGVKTLYFDDRKL 355
           K H D +  L F+     L   G  D  I IWDL   K I R++GH   V  +   +  L
Sbjct: 369 KAHDDNITCLDFDLPFGTLCTAGHLDHVIKIWDLSRSKQIGRMTGHVATVNCMQITNNML 428

Query: 356 ITGSLDKTIRVWNYITGECISTYRGHSDSVLSVDSYQKVIVSGSADKTVKVWHVESRTC- 414
           ++G  D  +++WN   G  + ++R    +VL  ++     +S SA            +C 
Sbjct: 429 VSGGKDALLKLWNLNVG--VQSFR----NVLPTNNSNLEPISSSA------------SCI 470

Query: 415 YTLRGHTEWVNCVKLHPKSFSCFSCSDDTTIRMWDIRTNSCLKVFR-GHVGQVQKIIPLT 473
           +T   H + +  V +  ++    S S D TIR WDI +  CL+      V      I +T
Sbjct: 471 HTFDSHVDEITSVTVAGENL--ISGSQDRTIRQWDIPSGKCLQTIDLSFVAIASPPIQVT 528

Query: 474 IKDVENLATDNTSDGSSPQDDPTMTDGADESDTPSNEQETVLDENIPYPTHLLSCGLDNT 533
                              D P +T         + +   ++     +   L +   D  
Sbjct: 529 -------------------DSPFLT---------TTKATAIIGALQCFDAALATGTRDGI 560

Query: 534 IKLWDVKTGKCIRTQFGHVEGVWDIAADNFRIISGSHDGSIKVWDLQSG 582
           ++LWD++ GK +R   GH   +  +  DN  I++GS D ++++WDL+SG
Sbjct: 561 VRLWDLRAGKVVRALEGHSGSITCLKFDNKNIVTGSIDKTVRIWDLRSG 609

 Score = 72.4 bits (176), Expect = 5e-13,   Method: Compositional matrix adjust.
 Identities = 36/93 (38%), Positives = 56/93 (60%), Gaps = 1/93 (1%)

Query: 315 LFTGSYDSTIGIWDLFTGKLIRRLSGHSDGVKTLYFDDRKLITGSLDKTIRVWNYITGEC 374
           L TG+ D  + +WDL  GK++R L GHS  +  L FD++ ++TGS+DKT+R+W+  +G  
Sbjct: 552 LATGTRDGIVRLWDLRAGKVVRALEGHSGSITCLKFDNKNIVTGSIDKTVRIWDLRSG-I 610

Query: 375 ISTYRGHSDSVLSVDSYQKVIVSGSADKTVKVW 407
           +S        VLSVD  +  I   + D+  KV+
Sbjct: 611 LSDMLTFEKPVLSVDFDKNKIAIATHDEACKVY 643

 Score = 61.6 bits (148), Expect = 1e-09,   Method: Compositional matrix adjust.
 Identities = 46/204 (22%), Positives = 84/204 (41%), Gaps = 47/204 (23%)

Query: 294 RIQEFKGHMDGVLTLQFNYRLLFTGSYDSTIGIWDLFTG--------------------- 332
           +I    GH+  V  +Q    +L +G  D+ + +W+L  G                     
Sbjct: 407 QIGRMTGHVATVNCMQITNNMLVSGGKDALLKLWNLNVGVQSFRNVLPTNNSNLEPISSS 466

Query: 333 -KLIRRLSGHSDGVKTLYFDDRKLITGSLDKTIRVWNYITGECISTYRGHSDSVLS---- 387
              I     H D + ++      LI+GS D+TIR W+  +G+C+ T      ++ S    
Sbjct: 467 ASCIHTFDSHVDEITSVTVAGENLISGSQDRTIRQWDIPSGKCLQTIDLSFVAIASPPIQ 526

Query: 388 -VDS-----------------YQKVIVSGSADKTVKVWHVES-RTCYTLRGHTEWVNCVK 428
             DS                 +   + +G+ D  V++W + + +    L GH+  + C+K
Sbjct: 527 VTDSPFLTTTKATAIIGALQCFDAALATGTRDGIVRLWDLRAGKVVRALEGHSGSITCLK 586

Query: 429 LHPKSFSCFSCSDDTTIRMWDIRT 452
              K+    + S D T+R+WD+R+
Sbjct: 587 FDNKNI--VTGSIDKTVRIWDLRS 608

 Score = 51.2 bits (121), Expect = 2e-06,   Method: Compositional matrix adjust.
 Identities = 54/246 (21%), Positives = 103/246 (41%), Gaps = 56/246 (22%)

Query: 372 GECISTY-RGHSDSVLSVD---SYQKVIVSGSADKTVKVWHVE-SRTCYTLRGHTEWVNC 426
           G  I+T  + H D++  +D    +  +  +G  D  +K+W +  S+    + GH   VNC
Sbjct: 361 GSMINTIQKAHDDNITCLDFDLPFGTLCTAGHLDHVIKIWDLSRSKQIGRMTGHVATVNC 420

Query: 427 VKLHPKSFSCFSCSDDTTIRMWDIRTNSCLKVFRGHVGQVQKIIPLTIKDVENLATDNTS 486
           +++        S   D  +++W++  N  ++ FR        ++P    ++E ++     
Sbjct: 421 MQITNNML--VSGGKDALLKLWNL--NVGVQSFR-------NVLPTNNSNLEPIS----- 464

Query: 487 DGSSPQDDPTMTDGADESDTPSNEQETVLDENIPYPTHLLSCGLDNTIKLWDVKTGKCIR 546
             SS     T     DE  +      TV  EN      L+S   D TI+ WD+ +GKC++
Sbjct: 465 --SSASCIHTFDSHVDEITSV-----TVAGEN------LISGSQDRTIRQWDIPSGKCLQ 511

Query: 547 T---QFGHVEG-------------------VWDIAADNFRIISGSHDGSIKVWDLQSGKC 584
           T    F  +                     +  +   +  + +G+ DG +++WDL++GK 
Sbjct: 512 TIDLSFVAIASPPIQVTDSPFLTTTKATAIIGALQCFDAALATGTRDGIVRLWDLRAGKV 571

Query: 585 MHTFNG 590
           +    G
Sbjct: 572 VRALEG 577

 Score = 46.6 bits (109), Expect = 5e-05,   Method: Compositional matrix adjust.
 Identities = 32/121 (26%), Positives = 48/121 (39%), Gaps = 22/121 (18%)

Query: 525 LLSCGLDNTIKLWDVKTG----------------------KCIRTQFGHVEGVWDIAADN 562
           L+S G D  +KLW++  G                       CI T   HV+ +  +    
Sbjct: 428 LVSGGKDALLKLWNLNVGVQSFRNVLPTNNSNLEPISSSASCIHTFDSHVDEITSVTVAG 487

Query: 563 FRIISGSHDGSIKVWDLQSGKCMHTFNGRRLQRETQHTQTQSLGDKVAPIACVCIGDSEC 622
             +ISGS D +I+ WD+ SGKC+ T +   +   +   Q           A   IG  +C
Sbjct: 488 ENLISGSQDRTIRQWDIPSGKCLQTIDLSFVAIASPPIQVTDSPFLTTTKATAIIGALQC 547

Query: 623 F 623
           F
Sbjct: 548 F 548

 Score = 46.6 bits (109), Expect = 6e-05,   Method: Compositional matrix adjust.
 Identities = 39/133 (29%), Positives = 63/133 (47%), Gaps = 12/133 (9%)

Query: 287 NWRKGHCRIQEFKGHMDGVLTLQFNYRLLFTGSYDSTIGIWDLFTGKLIRRLSGHSDGVK 346
           + R G   ++  +GH   +  L+F+ + + TGS D T+ IWDL +G L   L+     V 
Sbjct: 565 DLRAGKV-VRALEGHSGSITCLKFDNKNIVTGSIDKTVRIWDLRSGILSDMLT-FEKPVL 622

Query: 347 TLYFDDRKLITGSLDKTIRVWNYITGE---CISTYRGH-SDSVLSVD-----SYQK-VIV 396
           ++ FD  K+   + D+  +V++        C ST     SD  + V      SYQ   +V
Sbjct: 623 SVDFDKNKIAIATHDEACKVYDRQLNNLQTCTSTDEASTSDPTIPVSTVETMSYQNGYLV 682

Query: 397 SGSADKTVKVWHV 409
            G +D T+  W V
Sbjct: 683 EGRSDGTINSWAV 695

>Scas_630.6
          Length = 621

 Score = 85.1 bits (209), Expect = 4e-17,   Method: Compositional matrix adjust.
 Identities = 70/252 (27%), Positives = 109/252 (43%), Gaps = 50/252 (19%)

Query: 351 DDRKLITGSLDKTIRVWNYITGECISTYRGHSDSVLSVDSYQ--KVIVSGSADKTVKVWH 408
           D   L TG+ DK IR+WN    + +   +GH   + S+D +   + +VSGS D+++++W 
Sbjct: 352 DGEFLATGAEDKLIRIWNIKERKIVMVLKGHEQDIYSLDYFPDGQKLVSGSGDRSIRIWD 411

Query: 409 VESRTCYTLRGHTEWVNCVKLHPKSFSCFSC-SDDTTIRMWDIRTNSCLKVFRGHVGQVQ 467
           +++  C       + V  V + P      +  S D ++R+WD  T               
Sbjct: 412 LKTGQCSLTLSIEDGVTTVAVSPNEGKLIAAGSLDRSVRIWDSSTGFL------------ 459

Query: 468 KIIPLTIKDVENLATDNTSDGSSPQDDPTMTDGADESDTPSNEQETVLDENIPYPTHLLS 527
                    VE L +DN S G+  QD  ++   A   D                  H++S
Sbjct: 460 ---------VERLDSDNES-GNGHQD--SVYSVAFTKDG----------------QHVVS 491

Query: 528 CGLDNTIKLWDV-----KTGKCIRTQFGHVEGVWDIAA--DNFRIISGSHDGSIKVWDLQ 580
             LD T+KLW++      TGKC  T  GH + V  +A   D+  I SGS D  + +WD  
Sbjct: 492 GSLDRTVKLWNLGDTQSGTGKCEVTYIGHKDFVLSVATSNDDKYIFSGSKDRGVIIWDKD 551

Query: 581 SGKCMHTFNGRR 592
           SG  +    G R
Sbjct: 552 SGNPILMLQGHR 563

 Score = 73.2 bits (178), Expect = 3e-13,   Method: Compositional matrix adjust.
 Identities = 51/170 (30%), Positives = 86/170 (50%), Gaps = 23/170 (13%)

Query: 313 RLLFTGSYDSTIGIWDLFTGKLIRRLSGHSDGVKTL-YF-DDRKLITGSLDKTIRVWNYI 370
             L TG+ D  I IW++   K++  L GH   + +L YF D +KL++GS D++IR+W+  
Sbjct: 354 EFLATGAEDKLIRIWNIKERKIVMVLKGHEQDIYSLDYFPDGQKLVSGSGDRSIRIWDLK 413

Query: 371 TGEC---ISTYRGHSDSVLSVDSYQKVIVSGSADKTVKVWHVESRTCYTLR--------- 418
           TG+C   +S   G +   +S +   K+I +GS D++V++W  +S T + +          
Sbjct: 414 TGQCSLTLSIEDGVTTVAVSPNE-GKLIAAGSLDRSVRIW--DSSTGFLVERLDSDNESG 470

Query: 419 -GHTEWVNCVKLHPKSFSCFSCSDDTTIRMWDI-----RTNSCLKVFRGH 462
            GH + V  V          S S D T+++W++      T  C   + GH
Sbjct: 471 NGHQDSVYSVAFTKDGQHVVSGSLDRTVKLWNLGDTQSGTGKCEVTYIGH 520

 Score = 53.9 bits (128), Expect = 3e-07,   Method: Compositional matrix adjust.
 Identities = 37/126 (29%), Positives = 63/126 (50%), Gaps = 18/126 (14%)

Query: 300 GHMDGVLTLQF--NYRLLFTGSYDSTIGIWDLF-----TGKLIRRLSGHSDGVKTLYF-- 350
           GH D V ++ F  + + + +GS D T+ +W+L      TGK      GH D V ++    
Sbjct: 472 GHQDSVYSVAFTKDGQHVVSGSLDRTVKLWNLGDTQSGTGKCEVTYIGHKDFVLSVATSN 531

Query: 351 DDRKLITGSLDKTIRVWNYITGECISTYRGHSDSVLSVDSYQ---------KVIVSGSAD 401
           DD+ + +GS D+ + +W+  +G  I   +GH  SV+SV +           K+  +GS D
Sbjct: 532 DDKYIFSGSKDRGVIIWDKDSGNPILMLQGHRKSVISVATVNSNVDDGKNYKLFATGSGD 591

Query: 402 KTVKVW 407
              ++W
Sbjct: 592 CKARIW 597

>ADR077C [1818] [Homologous to ScYDL145C (COP1) - SH]
           (843171..846785) [3615 bp, 1204 aa]
          Length = 1204

 Score = 85.5 bits (210), Expect = 6e-17,   Method: Compositional matrix adjust.
 Identities = 84/379 (22%), Positives = 142/379 (37%), Gaps = 89/379 (23%)

Query: 266 IQTQTTRPWKVIYRERFKVES-NWRKGHC--RIQEFKGHMDGVLTLQFNYRLLFTGSYDS 322
           I    +RPW ++      ++  ++R G    R +E +G + GV        L  +   D 
Sbjct: 17  IAFHPSRPWVLVALFSSTIQLWDYRMGVLLHRFEEHEGPVRGV-DFHPTQPLFVSAGDDY 75

Query: 323 TIGIWDLFTGKLIRRLSGHSDGVKTLYFDDRK--LITGSLDKTIRVWNYITGECISTYRG 380
           +I +W L T K +  L+GH D V+T++F      +I+ S D+TIR+WN+     I+   G
Sbjct: 76  SIKVWSLSTHKCLFTLNGHLDYVRTVFFHTELPWIISASDDQTIRIWNWQNRREIACLTG 135

Query: 381 HSDSVLSVDSY--QKVIVSGSADKTVKVWHVESR-------------------------- 412
           H+  V+    +  + ++VS S D+TV++W +                             
Sbjct: 136 HNHFVMCAQFHPTEDLVVSASLDETVRIWDISGLRKRHSAPGSQSFEEQMITQQNLFDGG 195

Query: 413 -----TCYTLRGHTEWVNCVKLHPKSFSCFSCSDDTTIRMWDIRTNSCLKV--FRGHVGQ 465
                  + L GHT  VN    HP      S SDD  +++W + +    +V   RGH   
Sbjct: 196 FGDCVVKFILEGHTRGVNWASFHPTLPLIVSGSDDRQVKLWRMSSTKAWEVDTCRGHTNN 255

Query: 466 VQKIIPLTIKDVENLATDNTSDGSSPQDDPTMTDGADESDTPSNEQETVLDENIPYPTHL 525
           V  +I                                                 P+   +
Sbjct: 256 VDSVI-----------------------------------------------FHPFQNLI 268

Query: 526 LSCGLDNTIKLWDVKTGKCIRTQFGHVEGVWDIAA-DNFRIISGSHDGSIKVWDLQSGKC 584
           +S G D+TI++WD+     ++      +  W I A  N  +   +HD  I V+ L   + 
Sbjct: 269 ISVGEDSTIRVWDLDKRTPVKQFKREQDRFWSIRAHPNVNLFGAAHDSGIMVFKLDRERP 328

Query: 585 MHTFNGRRLQRETQHTQTQ 603
               N  +L    +  Q Q
Sbjct: 329 PVAVNQNQLYFVNKEKQVQ 347

 Score = 69.7 bits (169), Expect = 5e-12,   Method: Compositional matrix adjust.
 Identities = 68/293 (23%), Positives = 114/293 (38%), Gaps = 58/293 (19%)

Query: 333 KLIRRLSGHSDGVKTLYFDDRK--LITGSLDKTIRVWNYITGECISTYRGHSDSVLSVDS 390
           K++ +    S   K + F   +  ++      TI++W+Y  G  +  +  H   V  VD 
Sbjct: 2   KMLTKFESKSTRAKAIAFHPSRPWVLVALFSSTIQLWDYRMGVLLHRFEEHEGPVRGVDF 61

Query: 391 Y--QKVIVSGSADKTVKVWHVESRTC-YTLRGHTEWVNCVKLHPKSFSCFSCSDDTTIRM 447
           +  Q + VS   D ++KVW + +  C +TL GH ++V  V  H +     S SDD TIR+
Sbjct: 62  HPTQPLFVSAGDDYSIKVWSLSTHKCLFTLNGHLDYVRTVFFHTELPWIISASDDQTIRI 121

Query: 448 WDIRTNSCLKVFRGH-----VGQVQKIIPLTIK----------DVENLATDNTSDGSSPQ 492
           W+ +    +    GH       Q      L +           D+  L   +++ GS   
Sbjct: 122 WNWQNRREIACLTGHNHFVMCAQFHPTEDLVVSASLDETVRIWDISGLRKRHSAPGSQSF 181

Query: 493 DDPTMTDGADESDTPSNEQETVLDENI----------------------PYPTHLLSCGL 530
           ++  +T            Q+ + D                         P    ++S   
Sbjct: 182 EEQMIT------------QQNLFDGGFGDCVVKFILEGHTRGVNWASFHPTLPLIVSGSD 229

Query: 531 DNTIKLWDVKTGKC--IRTQFGHVEGVWDIAADNFR--IISGSHDGSIKVWDL 579
           D  +KLW + + K   + T  GH   V  +    F+  IIS   D +I+VWDL
Sbjct: 230 DRQVKLWRMSSTKAWEVDTCRGHTNNVDSVIFHPFQNLIISVGEDSTIRVWDL 282

 Score = 38.9 bits (89), Expect = 0.014,   Method: Compositional matrix adjust.
 Identities = 42/208 (20%), Positives = 75/208 (36%), Gaps = 51/208 (24%)

Query: 403 TVKVW-HVESRTCYTLRGHTEWVNCVKLHPKSFSCFSCSDDTTIRMWDIRTNSCLKVFRG 461
           T+++W +      +    H   V  V  HP      S  DD +I++W + T+ CL    G
Sbjct: 34  TIQLWDYRMGVLLHRFEEHEGPVRGVDFHPTQPLFVSAGDDYSIKVWSLSTHKCLFTLNG 93

Query: 462 HVGQVQKIIPLTIKDVENLATDNTSDGSSPQDDPTMTDGADESDTPSNEQETVLDENIPY 521
           H+  V+ +   T                                             +P+
Sbjct: 94  HLDYVRTVFFHT--------------------------------------------ELPW 109

Query: 522 PTHLLSCGLDNTIKLWDVKTGKCIRTQFGHVEGVW--DIAADNFRIISGSHDGSIKVWDL 579
              ++S   D TI++W+ +  + I    GH   V           ++S S D ++++WD+
Sbjct: 110 ---IISASDDQTIRIWNWQNRREIACLTGHNHFVMCAQFHPTEDLVVSASLDETVRIWDI 166

Query: 580 QSGKCMHTFNGRRLQRETQHTQTQSLGD 607
              +  H+  G +   E   TQ Q+L D
Sbjct: 167 SGLRKRHSAPGSQSFEEQMITQ-QNLFD 193

>CAGL0I03718g complement(317565..321170) highly similar to sp|P53622
           Saccharomyces cerevisiae YDL145c RET1 Coatomer alpha
           subunit, start by similarity
          Length = 1201

 Score = 85.5 bits (210), Expect = 6e-17,   Method: Compositional matrix adjust.
 Identities = 85/338 (25%), Positives = 147/338 (43%), Gaps = 45/338 (13%)

Query: 320 YDSTIGIWDLFTGKLIRRLSGHSDGVKTLYFDDRK--LITGSLDKTIRVWNYITGECIST 377
           + STI +WD   G L+ R  GH   V+ + F   +   ++   D +I+VW+  T  C+ T
Sbjct: 31  FSSTIQLWDYRMGTLLHRFEGHEGPVRAVDFHPTQPIFVSAGDDASIKVWSLETNRCLYT 90

Query: 378 YRGHSDSVLSVDSYQKV--IVSGSADKTVKVWHVESRTCYT-LRGHTEWVNCVKLHPKSF 434
             GH D V +V  + ++  ++S S D+TV++W+ ++R     L GH  +V C + H    
Sbjct: 91  LTGHLDYVRTVFFHSELPWVISASDDQTVRIWNWQNRKELACLTGHNHFVMCAQFHQTED 150

Query: 435 SCFSCSDDTTIRMWDI----RTNSCLKV--FRGHVGQVQKIIPLTIKD--VENLATDNTS 486
              S S D T+R+WDI    + +S   V  +   +   Q ++     D  V+ +   +T 
Sbjct: 151 LVVSASLDETVRVWDISGLRKKHSAPGVTSYEDSLASQQNLLDGAFGDCKVKFILEGHTR 210

Query: 487 DGSSPQDDPTM----TDGAD--------------ESDT---PSNEQETVL---DENIPYP 522
             +     PT+    T G D              E DT    +N  + V+   D+N+   
Sbjct: 211 GVNWASFHPTLPLIVTGGDDRQVKLWRMSSNKAWEVDTCRGHTNNVDCVVFHPDQNL--- 267

Query: 523 THLLSCGLDNTIKLWDVKTGKCIRTQFGHVEGVWDIAA-DNFRIISGSHDGSIKVWDLQS 581
             +LS   D T+++WD+     ++      +  W I +  N  +   +HD  I ++ L  
Sbjct: 268 --ILSVAEDKTLRIWDLDKRTPVKQFKRENDRFWLIRSHPNMSLFGAAHDSGIMIFKLDR 325

Query: 582 GKCMHTFNGRRLQRETQHTQTQSL--GDKVAPIACVCI 617
            +   T    +L    +  Q QS   G KV  +  V +
Sbjct: 326 ERPAATTYQNQLFFVNKEKQLQSFDYGKKVTSLPYVTL 363

 Score = 77.4 bits (189), Expect = 2e-14,   Method: Compositional matrix adjust.
 Identities = 70/285 (24%), Positives = 122/285 (42%), Gaps = 42/285 (14%)

Query: 333 KLIRRLSGHSDGVKTLYFDDRK--LITGSLDKTIRVWNYITGECISTYRGHSDSVLSVDS 390
           KL+ +    S   K + F   +   +      TI++W+Y  G  +  + GH   V +VD 
Sbjct: 2   KLLTKFESKSTRAKGIAFHPSRPWALVALFSSTIQLWDYRMGTLLHRFEGHEGPVRAVDF 61

Query: 391 Y--QKVIVSGSADKTVKVWHVESRTC-YTLRGHTEWVNCVKLHPKSFSCFSCSDDTTIRM 447
           +  Q + VS   D ++KVW +E+  C YTL GH ++V  V  H +     S SDD T+R+
Sbjct: 62  HPTQPIFVSAGDDASIKVWSLETNRCLYTLTGHLDYVRTVFFHSELPWVISASDDQTVRI 121

Query: 448 WDIRTNSCLKVFRGH-----VGQVQKIIPLTIK----------DVENLATDNTSDGSSPQ 492
           W+ +    L    GH       Q  +   L +           D+  L   +++ G +  
Sbjct: 122 WNWQNRKELACLTGHNHFVMCAQFHQTEDLVVSASLDETVRVWDISGLRKKHSAPGVTSY 181

Query: 493 DDP-----TMTDGADESDTPSNEQETVLDENI---------PYPTHLLSCGLDNTIKLWD 538
           +D       + DGA        + + +L+ +          P    +++ G D  +KLW 
Sbjct: 182 EDSLASQQNLLDGA----FGDCKVKFILEGHTRGVNWASFHPTLPLIVTGGDDRQVKLWR 237

Query: 539 VKTGKC--IRTQFGHVEGVWDIA--ADNFRIISGSHDGSIKVWDL 579
           + + K   + T  GH   V  +    D   I+S + D ++++WDL
Sbjct: 238 MSSNKAWEVDTCRGHTNNVDCVVFHPDQNLILSVAEDKTLRIWDL 282

 Score = 76.3 bits (186), Expect = 4e-14,   Method: Compositional matrix adjust.
 Identities = 57/200 (28%), Positives = 92/200 (46%), Gaps = 39/200 (19%)

Query: 300 GHMDGVLTLQFNYRL--LFTGSYDSTIGIWDLFTGKLIRRLSGHSDGVKTLYFDDRK--L 355
           GH+D V T+ F+  L  + + S D T+ IW+    K +  L+GH+  V    F   +  +
Sbjct: 93  GHLDYVRTVFFHSELPWVISASDDQTVRIWNWQNRKELACLTGHNHFVMCAQFHQTEDLV 152

Query: 356 ITGSLDKTIRVWNY----------------------------ITGECISTY--RGHSDSV 385
           ++ SLD+T+RVW+                               G+C   +   GH+  V
Sbjct: 153 VSASLDETVRVWDISGLRKKHSAPGVTSYEDSLASQQNLLDGAFGDCKVKFILEGHTRGV 212

Query: 386 --LSVDSYQKVIVSGSADKTVKVWHVESRTCY---TLRGHTEWVNCVKLHPKSFSCFSCS 440
              S      +IV+G  D+ VK+W + S   +   T RGHT  V+CV  HP      S +
Sbjct: 213 NWASFHPTLPLIVTGGDDRQVKLWRMSSNKAWEVDTCRGHTNNVDCVVFHPDQNLILSVA 272

Query: 441 DDTTIRMWDIRTNSCLKVFR 460
           +D T+R+WD+   + +K F+
Sbjct: 273 EDKTLRIWDLDKRTPVKQFK 292

 Score = 37.0 bits (84), Expect = 0.049,   Method: Compositional matrix adjust.
 Identities = 27/117 (23%), Positives = 57/117 (48%), Gaps = 7/117 (5%)

Query: 291 GHCRIQE-FKGHMDGVLTLQFN--YRLLFTGSYDSTIGIWDLFTGKL--IRRLSGHSDGV 345
           G C+++   +GH  GV    F+    L+ TG  D  + +W + + K   +    GH++ V
Sbjct: 197 GDCKVKFILEGHTRGVNWASFHPTLPLIVTGGDDRQVKLWRMSSNKAWEVDTCRGHTNNV 256

Query: 346 KTLYF--DDRKLITGSLDKTIRVWNYITGECISTYRGHSDSVLSVDSYQKVIVSGSA 400
             + F  D   +++ + DKT+R+W+      +  ++  +D    + S+  + + G+A
Sbjct: 257 DCVVFHPDQNLILSVAEDKTLRIWDLDKRTPVKQFKRENDRFWLIRSHPNMSLFGAA 313

>CAGL0C02937g 290289..291692 similar to sp|P39946 Saccharomyces
           cerevisiae YOR269w PAC1, hypothetical start
          Length = 467

 Score = 83.6 bits (205), Expect = 1e-16,   Method: Compositional matrix adjust.
 Identities = 61/213 (28%), Positives = 98/213 (46%), Gaps = 51/213 (23%)

Query: 295 IQEFKGHMDGVLTLQFNYR-----LLFTGSYDSTIGIWDLFTGKLIRRLSGHSDGVKTLY 349
           I+ F  H D  ++ Q  ++     LL + S D+T+ +W +   + ++  S HS+ VK++ 
Sbjct: 214 IRSFNAH-DSTVSSQKTWQKDNDVLLASSSRDATVKVWRVNDSRCLQSFSPHSEWVKSID 272

Query: 350 FDDRKLITGSLDKTIRVWNYITGECISTYRGH------------SDSVLSVDSYQ----- 392
             D  +++GSLD T+R+ ++ +G  +S   GH            SDS +    Y+     
Sbjct: 273 VLDEYILSGSLDSTLRLTHWPSGNGLSVGTGHEFPIERVLIIPFSDSKICTSPYRDQNEH 332

Query: 393 --------KVIVSGSADKTVKVWHVE------------------SRTCYTLRGHTEWVNC 426
                   K   S + D T+K+W V                    +   TLRGHT WV  
Sbjct: 333 SAFAPLRFKYCASAARDNTIKIWEVPLPQLKPNSAPVPSTTNTTFKCVMTLRGHTSWVKD 392

Query: 427 VKLHPKSFSCFSCSDDTTIRMWDIRTNSCLKVF 459
           +KL       FSCSDD TI+ WD+ T +C+K +
Sbjct: 393 LKLRGDHL--FSCSDDETIKCWDLNTGNCVKTW 423

 Score = 73.2 bits (178), Expect = 2e-13,   Method: Compositional matrix adjust.
 Identities = 74/269 (27%), Positives = 115/269 (42%), Gaps = 53/269 (19%)

Query: 349 YFDDRKLI-TGSLDKTIRVWNYI--TGEC--ISTYRGHSDSVLSVDSYQK----VIVSGS 399
           + D   L+ T S D  I V+++   TGE   I ++  H  +V S  ++QK    ++ S S
Sbjct: 183 FIDSTTLVSTTSKDAQINVYDHSSNTGELKLIRSFNAHDSTVSSQKTWQKDNDVLLASSS 242

Query: 400 ADKTVKVWHV-ESRTCYTLRGHTEWVNCVKLHPKSFSCFSCSDDTTIRMWDIRTNSCLKV 458
            D TVKVW V +SR   +   H+EWV  + +  +     S S D+T+R+    + + L V
Sbjct: 243 RDATVKVWRVNDSRCLQSFSPHSEWVKSIDVLDEYI--LSGSLDSTLRLTHWPSGNGLSV 300

Query: 459 FRGHVGQVQKIIPLTIKDVENLATDNTSDGSSPQDDPTMTDGADESDTPSNEQETVLDEN 518
             GH   +++++ +   D        +   +SP  D              NE        
Sbjct: 301 GTGHEFPIERVLIIPFSD--------SKICTSPYRD-------------QNEHSAFAPLR 339

Query: 519 IPYPTHLLSCGLDNTIKLWDVK-----------------TGKCIRTQFGHVEGVWDIAAD 561
             Y     S   DNTIK+W+V                  T KC+ T  GH   V D+   
Sbjct: 340 FKY---CASAARDNTIKIWEVPLPQLKPNSAPVPSTTNTTFKCVMTLRGHTSWVKDLKLR 396

Query: 562 NFRIISGSHDGSIKVWDLQSGKCMHTFNG 590
              + S S D +IK WDL +G C+ T++ 
Sbjct: 397 GDHLFSCSDDETIKCWDLNTGNCVKTWSS 425

 Score = 40.4 bits (93), Expect = 0.004,   Method: Compositional matrix adjust.
 Identities = 36/130 (27%), Positives = 58/130 (44%), Gaps = 33/130 (25%)

Query: 308 LQFNYRLLFTGSYDSTIGIWDL-----------------FTGKLIRRLSGHSDGVKTLYF 350
           L+F Y    + + D+TI IW++                  T K +  L GH+  VK L  
Sbjct: 338 LRFKY--CASAARDNTIKIWEVPLPQLKPNSAPVPSTTNTTFKCVMTLRGHTSWVKDLKL 395

Query: 351 DDRKLITGSLDKTIRVWNYITGECISTYRG-HSDSVLSVD------------SYQK-VIV 396
               L + S D+TI+ W+  TG C+ T+   H++ +  +D            S Q+ ++V
Sbjct: 396 RGDHLFSCSDDETIKCWDLNTGNCVKTWSSIHNNFINCIDIDREATIEQFSPSLQREILV 455

Query: 397 SGSADKTVKV 406
           SG  D  VK+
Sbjct: 456 SGDMDNKVKI 465

 Score = 38.9 bits (89), Expect = 0.012,   Method: Compositional matrix adjust.
 Identities = 43/187 (22%), Positives = 72/187 (38%), Gaps = 17/187 (9%)

Query: 424 VNCVKLHPKSFSCFSCSDDTTIRMWDIRTNSC-LKVFRGHVGQVQKIIPLTIKDVENL-- 480
           V  +KLHP     +  +D   +  +DI   +  L V   H   +  I  +   + E    
Sbjct: 126 VTAIKLHPSLAIVYVGTDTGRLIAYDILNYTIPLAVTTAHSKAITSIEVIEAHNFEEFID 185

Query: 481 -----------ATDNTSDGSSPQDDPTMTDGADESDTPSNEQETVLDENIPYPTHLLSCG 529
                      A  N  D SS   +  +    +  D+  + Q+T   +N      L S  
Sbjct: 186 STTLVSTTSKDAQINVYDHSSNTGELKLIRSFNAHDSTVSSQKTWQKDN---DVLLASSS 242

Query: 530 LDNTIKLWDVKTGKCIRTQFGHVEGVWDIAADNFRIISGSHDGSIKVWDLQSGKCMHTFN 589
            D T+K+W V   +C+++   H E V  I   +  I+SGS D ++++    SG  +    
Sbjct: 243 RDATVKVWRVNDSRCLQSFSPHSEWVKSIDVLDEYILSGSLDSTLRLTHWPSGNGLSVGT 302

Query: 590 GRRLQRE 596
           G     E
Sbjct: 303 GHEFPIE 309

 Score = 31.6 bits (70), Expect = 2.4,   Method: Compositional matrix adjust.
 Identities = 21/86 (24%), Positives = 37/86 (43%), Gaps = 14/86 (16%)

Query: 295 IQEFKGHMDGVLTLQFNYRLLFTGSYDSTIGIWDLFTGKLIRRLSG-HSDGVKTLYFDDR 353
           +   +GH   V  L+     LF+ S D TI  WDL TG  ++  S  H++ +  +  D  
Sbjct: 380 VMTLRGHTSWVKDLKLRGDHLFSCSDDETIKCWDLNTGNCVKTWSSIHNNFINCIDIDRE 439

Query: 354 K-------------LITGSLDKTIRV 366
                         L++G +D  +++
Sbjct: 440 ATIEQFSPSLQREILVSGDMDNKVKI 465

>Scas_624.11
          Length = 1205

 Score = 84.3 bits (207), Expect = 1e-16,   Method: Compositional matrix adjust.
 Identities = 88/397 (22%), Positives = 150/397 (37%), Gaps = 93/397 (23%)

Query: 266 IQTQTTRPWKVIYRERFKVES-NWRKGHCRIQEFKGHMDGVLTLQFN--YRLLFTGSYDS 322
           I    +RPW ++      ++  ++R G   +  F+ H   V ++ F+    +  +G  D 
Sbjct: 17  IAFHPSRPWVLVALFSSTIQLWDYRMGTL-LHRFEDHEGPVRSVDFHPTQPIFVSGGDDY 75

Query: 323 TIGIWDLFTGKLIRRLSGHSDGVKTLYFDDRK--LITGSLDKTIRVWNYITGECISTYRG 380
           TI +W L T K +  L+GH D ++T++F      +I+ S D+TIR+WN+   + I+   G
Sbjct: 76  TIKVWSLETNKCLYTLNGHLDYIRTVFFHKELPWIISASDDQTIRIWNWQNRKEIACLTG 135

Query: 381 HSDSVLSVDSY--QKVIVSGSADKTVKVWHVESR-------------------------- 412
           H+  V+    +    ++VS S D+T++VW +                             
Sbjct: 136 HNHFVMCAQFHPTDDLVVSASLDETIRVWDISGLRKKHSAPGTSTFDDQMAAQQNLLDGG 195

Query: 413 -----TCYTLRGHTEWVNCVKLHPKSFSCFSCSDDTTIRMWDIRTNSCLKV--FRGHVGQ 465
                  + L GHT  VN    HP      S SDD  +++W   +    +V   RGH   
Sbjct: 196 FGDCVVKFILEGHTRGVNWASFHPTLPMIVSGSDDRQVKLWKYNSTKAWEVDTCRGHTNN 255

Query: 466 VQKIIPLTIKDVENLATDNTSDGSSPQDDPTMTDGADESDTPSNEQETVLDENIPYPTHL 525
           V  +I                                                 P    +
Sbjct: 256 VDCVI-----------------------------------------------FHPTQKFI 268

Query: 526 LSCGLDNTIKLWDVKTGKCIRTQFGHVEGVWDIAA-DNFRIISGSHDGSIKVWDLQSGKC 584
           LS G D T+++WD+     ++      +  W IA+  N  +   +HD  I V+ L   + 
Sbjct: 269 LSVGEDKTLRIWDLDKRIPVKQFKRENDRFWLIASHPNINLFGAAHDAGIMVFKLDRERP 328

Query: 585 MHTFNGRRL--QRETQHTQTQSLGDKVA--PIACVCI 617
            +     +L    + +H Q      KVA  P A + I
Sbjct: 329 CNVIYQNQLIFVNKEKHVQMFDFQKKVASLPFASLKI 365

>CAGL0D02090g join(214357..214893,215564..215860) highly similar to
           sp|P38011 Saccharomyces cerevisiae YMR116c ASC1
          Length = 277

 Score = 79.7 bits (195), Expect = 3e-16,   Method: Compositional matrix adjust.
 Identities = 58/178 (32%), Positives = 89/178 (50%), Gaps = 20/178 (11%)

Query: 298 FKGHMDGVLTLQFNY---RLLFTGSYDSTIGIWDLFT-----GKLIRRLSGHSDGVK--T 347
            +GH   V +L  +     LL + S D T+  W L       G  ++   GHS  V+  T
Sbjct: 13  LEGHNGWVTSLATSAGQPNLLLSASRDKTLISWKLTGDDQKFGVPVKSFKGHSHIVQDCT 72

Query: 348 LYFDDRKLITGSLDKTIRVWNYITGECISTYRGHSDSVLSV--DSYQKVIVSGSADKTVK 405
           L  +    ++GS DKT+R+W+  TGE   T+ GH   V+SV  D    +I+SGS DK++K
Sbjct: 73  LTENGAYALSGSWDKTLRLWDVATGETFQTFVGHKGDVMSVAIDKKASMIISGSRDKSIK 132

Query: 406 VWHVESRTCYTLRGHTEWVNCVKLHPKS-----FSCFSCSDDTTIRMWDIRTNSCLKV 458
           VW ++     TL GH +WV+ V++   S      +  S  +D  ++   +  NS  KV
Sbjct: 133 VWSIKGDCLATLIGHNDWVSQVRIANSSDDDDKVTVISAGNDKMVK---VLWNSAAKV 187

 Score = 55.8 bits (133), Expect = 2e-08,   Method: Compositional matrix adjust.
 Identities = 36/82 (43%), Positives = 45/82 (54%), Gaps = 6/82 (7%)

Query: 511 QETVLDENIPYPTHLLSCGLDNTIKLWDVKTGKCIRTQFGHVEGVWDIAADN--FRIISG 568
           Q+  L EN  Y    LS   D T++LWDV TG+  +T  GH   V  +A D     IISG
Sbjct: 69  QDCTLTENGAYA---LSGSWDKTLRLWDVATGETFQTFVGHKGDVMSVAIDKKASMIISG 125

Query: 569 SHDGSIKVWDLQSGKCMHTFNG 590
           S D SIKVW ++ G C+ T  G
Sbjct: 126 SRDKSIKVWSIK-GDCLATLIG 146

 Score = 44.7 bits (104), Expect = 1e-04,   Method: Compositional matrix adjust.
 Identities = 52/231 (22%), Positives = 86/231 (37%), Gaps = 65/231 (28%)

Query: 377 TYRGHSDSVLSVDSYQ---KVIVSGSADKTVKVWHVESR------TCYTLRGHTEWVNCV 427
           T  GH+  V S+ +      +++S S DKT+  W +            + +GH+  V   
Sbjct: 12  TLEGHNGWVTSLATSAGQPNLLLSASRDKTLISWKLTGDDQKFGVPVKSFKGHSHIVQDC 71

Query: 428 KLHPKSFSCFSCSDDTTIRMWDIRTNSCLKVFRGHVGQVQKIIPLTIKDVENLATDNTSD 487
            L        S S D T+R+WD+ T    + F GH G           DV ++A D  + 
Sbjct: 72  TLTENGAYALSGSWDKTLRLWDVATGETFQTFVGHKG-----------DVMSVAIDKKA- 119

Query: 488 GSSPQDDPTMTDGADESDTPSNEQETVLDENIPYPTHLLSCGLDNTIKLWDVKTGKCIRT 547
                                              + ++S   D +IK+W +K G C+ T
Sbjct: 120 -----------------------------------SMIISGSRDKSIKVWSIK-GDCLAT 143

Query: 548 QFGHVEGVWDIAA-------DNFRIISGSHDGSIKV-WDLQSGKCMHTFNG 590
             GH + V  +         D   +IS  +D  +KV W+  +   M+T + 
Sbjct: 144 LIGHNDWVSQVRIANSSDDDDKVTVISAGNDKMVKVLWNSAAKVPMYTLSA 194

 Score = 37.7 bits (86), Expect = 0.017,   Method: Compositional matrix adjust.
 Identities = 27/91 (29%), Positives = 43/91 (47%), Gaps = 7/91 (7%)

Query: 509 NEQETVLDENIPYPTHLLSCGLDNTIKLW-----DVKTGKCIRTQFGHVEGVWD--IAAD 561
           N   T L  +   P  LLS   D T+  W     D K G  +++  GH   V D  +  +
Sbjct: 17  NGWVTSLATSAGQPNLLLSASRDKTLISWKLTGDDQKFGVPVKSFKGHSHIVQDCTLTEN 76

Query: 562 NFRIISGSHDGSIKVWDLQSGKCMHTFNGRR 592
               +SGS D ++++WD+ +G+   TF G +
Sbjct: 77  GAYALSGSWDKTLRLWDVATGETFQTFVGHK 107

>KLLA0F10263g 949926..951974 gi|2494900|sp|P56094|TUP1_KLULA
           Kluyveromyces lactis Transcriptional repressor TUP1,
           start by similarity
          Length = 682

 Score = 81.6 bits (200), Expect = 7e-16,   Method: Compositional matrix adjust.
 Identities = 64/196 (32%), Positives = 92/196 (46%), Gaps = 27/196 (13%)

Query: 295 IQEFKGHMDGVLTLQF--NYRLLFTGSYDSTIGIWDLFTGKLIRRLSGHSDGVKTLYF-- 350
           +   KGH   + +L +  +   L +GS D T+ IWDL TG     LS   DGV T+    
Sbjct: 441 VMTLKGHEQDIYSLDYFPSGNKLVSGSGDRTVRIWDLTTGTCSLTLS-IEDGVTTVAVSP 499

Query: 351 -DDRKLITGSLDKTIRVWNYITGECISTY-------RGHSDSVLSVDSYQ--KVIVSGSA 400
            + + +  GSLD+T+RVW+  TG  +           GH DSV SV   +  K +VSGS 
Sbjct: 500 GEGKFIAAGSLDRTVRVWDSDTGFLVERLDSENELGTGHRDSVYSVVFTRDGKGVVSGSL 559

Query: 401 DKTVKVW----------HVESRTCYTLRGHTEWVNCVKLHPKSFSCFSCSDDTTIRMWDI 450
           D++VK+W          H E    YT  GH ++V  V          S S D  +  WD 
Sbjct: 560 DRSVKLWNLNGLSGQKSHAECEVTYT--GHKDFVLSVATTQNDEYILSGSKDRGVLFWDT 617

Query: 451 RTNSCLKVFRGHVGQV 466
           ++ + L + +GH   V
Sbjct: 618 KSGNPLLMLQGHRNSV 633

 Score = 73.9 bits (180), Expect = 2e-13,   Method: Compositional matrix adjust.
 Identities = 65/261 (24%), Positives = 106/261 (40%), Gaps = 66/261 (25%)

Query: 351 DDRKLITGSLDKTIRVWNYITGECISTYRGHSDSVLSVDSYQ--KVIVSGSADKTVKVWH 408
           D + L TG+ DK IR+W+  T + + T +GH   + S+D +     +VSGS D+TV++W 
Sbjct: 417 DGKFLATGAEDKLIRIWDLETKKIVMTLKGHEQDIYSLDYFPSGNKLVSGSGDRTVRIWD 476

Query: 409 VESRTCYTLRGHTEWVNCVKLHPKSFSCFSC-SDDTTIRMWDI-------RTNSCLKVFR 460
           + + TC       + V  V + P      +  S D T+R+WD        R +S  ++  
Sbjct: 477 LTTGTCSLTLSIEDGVTTVAVSPGEGKFIAAGSLDRTVRVWDSDTGFLVERLDSENELGT 536

Query: 461 GHVGQVQKIIPLTIKDVENLATDNTSDGSSPQDDPTMTDGADESDTPSNEQETVLDENIP 520
           GH   V  ++              T DG                                
Sbjct: 537 GHRDSVYSVV-------------FTRDGKG------------------------------ 553

Query: 521 YPTHLLSCGLDNTIKLWDVKT-------GKCIRTQFGHVEGVWDIAA--DNFRIISGSHD 571
               ++S  LD ++KLW++          +C  T  GH + V  +A   ++  I+SGS D
Sbjct: 554 ----VVSGSLDRSVKLWNLNGLSGQKSHAECEVTYTGHKDFVLSVATTQNDEYILSGSKD 609

Query: 572 GSIKVWDLQSGKCMHTFNGRR 592
             +  WD +SG  +    G R
Sbjct: 610 RGVLFWDTKSGNPLLMLQGHR 630

 Score = 48.1 bits (113), Expect = 2e-05,   Method: Compositional matrix adjust.
 Identities = 44/174 (25%), Positives = 69/174 (39%), Gaps = 69/174 (39%)

Query: 303 DGVLTLQFNY---RLLFTGSYDSTIGIWDLFTGKLIRRL-------SGHSDGVKTLYF-- 350
           DGV T+  +    + +  GS D T+ +WD  TG L+ RL       +GH D V ++ F  
Sbjct: 490 DGVTTVAVSPGEGKFIAAGSLDRTVRVWDSDTGFLVERLDSENELGTGHRDSVYSVVFTR 549

Query: 351 DDRKLITGSLDKTIRVWNY--ITG-----ECISTYRGHSD-------------------- 383
           D + +++GSLD+++++WN   ++G     EC  TY GH D                    
Sbjct: 550 DGKGVVSGSLDRSVKLWNLNGLSGQKSHAECEVTYTGHKDFVLSVATTQNDEYILSGSKD 609

Query: 384 ----------------------SVLSVDSYQ--------KVIVSGSADKTVKVW 407
                                 SV+SV             V  +GS D   ++W
Sbjct: 610 RGVLFWDTKSGNPLLMLQGHRNSVISVTVANGHPLGPEYGVFATGSGDCKARIW 663

>KLLA0B01958g join(170646..170663,170896..173550) similar to
           sp|P41811 Saccharomyces cerevisiae YGL137w SEC27
           coatomer complex beta chain (beta -cop) of secretory
           pathway vesicles, hypothetical start
          Length = 890

 Score = 81.6 bits (200), Expect = 8e-16,   Method: Compositional matrix adjust.
 Identities = 77/279 (27%), Positives = 120/279 (43%), Gaps = 53/279 (18%)

Query: 320 YDSTIGIWDLFTGKLIRRLSGHSDGVKTLYFDDRK--LITGSLDKTIRVWNYITGECIST 377
           Y   I IW+  T   +R +      V+   F  RK  ++ GS D  +RV+NY TGE ++ 
Sbjct: 33  YSGRIEIWNYETQTQVRSIPLCDAPVRAGRFIARKNWVVVGSDDFKLRVYNYNTGEKVTE 92

Query: 378 YRGHSDSV--LSVDSYQKVIVSGSADKTVKVWHVESR-TC-YTLRGHTEWVNCVKLHPKS 433
           +  H D +  ++V   +  +++GS D T+K+W+ E    C  T  GH  +V  V  +PK 
Sbjct: 93  FEAHPDYIRSIAVHPTKPFVLTGSDDLTIKLWNWEKNWGCQQTFTGHEHFVMSVAFNPKD 152

Query: 434 FSCFSCS-DDTTIRMWDIRTNSCLKVFRGHVGQVQKIIPLTIKDVENLATDNTSDGSSPQ 492
            + F+    D TI++W I                Q +   T+K  E     N  D    Q
Sbjct: 153 PNQFASGCLDHTIKVWSIG---------------QDVPNFTLKAHETKGV-NYVDYYPLQ 196

Query: 493 DDPTMTDGADESDTPSNEQETVLDENIPYPTHLLSCGLDNTIKLWDVKTGKCIRTQFGHV 552
           D P                            +L++   D TIK+WD +T   + T  GH+
Sbjct: 197 DKP----------------------------YLITTSDDGTIKVWDYQTKSNVATLEGHM 228

Query: 553 EGV-WDIAADNFR-IISGSHDGSIKVWDLQSGKCMHTFN 589
             V + +       IISGS DG++K+W+  + K   T N
Sbjct: 229 ANVSYAVFHPTLPIIISGSEDGTLKIWNANTYKLEKTLN 267

 Score = 73.9 bits (180), Expect = 2e-13,   Method: Compositional matrix adjust.
 Identities = 51/166 (30%), Positives = 84/166 (50%), Gaps = 10/166 (6%)

Query: 315 LFTGSYDSTIGIWDLFTGKLIRRLSGHSDGVKTLYFDDRK--LITGSLDKTIRVWNYITG 372
           +  GS D  + +++  TG+ +     H D ++++     K  ++TGS D TI++WN+   
Sbjct: 70  VVVGSDDFKLRVYNYNTGEKVTEFEAHPDYIRSIAVHPTKPFVLTGSDDLTIKLWNWEKN 129

Query: 373 -ECISTYRGHSDSVLSVDSYQK---VIVSGSADKTVKVWHV-ESRTCYTLRGH-TEWVNC 426
             C  T+ GH   V+SV    K      SG  D T+KVW + +    +TL+ H T+ VN 
Sbjct: 130 WGCQQTFTGHEHFVMSVAFNPKDPNQFASGCLDHTIKVWSIGQDVPNFTLKAHETKGVNY 189

Query: 427 VKLHPKSFSCF--SCSDDTTIRMWDIRTNSCLKVFRGHVGQVQKII 470
           V  +P     +  + SDD TI++WD +T S +    GH+  V   +
Sbjct: 190 VDYYPLQDKPYLITTSDDGTIKVWDYQTKSNVATLEGHMANVSYAV 235

 Score = 60.8 bits (146), Expect = 2e-09,   Method: Compositional matrix adjust.
 Identities = 58/205 (28%), Positives = 88/205 (42%), Gaps = 32/205 (15%)

Query: 266 IQTQTTRPWKVIYRERFKVES-NWRKGHCRIQEFKGHMDGVLTLQFNYR---LLFTGSYD 321
           I    T+P+ +   +   ++  NW K     Q F GH   V+++ FN +      +G  D
Sbjct: 103 IAVHPTKPFVLTGSDDLTIKLWNWEKNWGCQQTFTGHEHFVMSVAFNPKDPNQFASGCLD 162

Query: 322 STIGIWDLFTGKLIRRLSGH-SDGVKTLYF----DDRKLITGSLDKTIRVWNYITGECIS 376
            TI +W +        L  H + GV  + +    D   LIT S D TI+VW+Y T   ++
Sbjct: 163 HTIKVWSIGQDVPNFTLKAHETKGVNYVDYYPLQDKPYLITTSDDGTIKVWDYQTKSNVA 222

Query: 377 TYRGHSDSVLSVDSYQ------KVIVSGSADKTVKVWHVES-RTCYTLRGHTEWVNCVKL 429
           T  GH  +V    SY        +I+SGS D T+K+W+  + +   TL    E   C+  
Sbjct: 223 TLEGHMANV----SYAVFHPTLPIIISGSEDGTLKIWNANTYKLEKTLNIGLERSWCIAT 278

Query: 430 HP------------KSFSCFSCSDD 442
           HP              F+  S  DD
Sbjct: 279 HPSGKRNYIASGFDNGFTVLSLGDD 303

>YDL145C (COP1) [723] chr4 complement(194572..198177) Coatomer
           (COPI) complex alpha chain (alpha-COP) of secretory
           pathway vesicles required for retrograde Golgi to
           endoplasmic reticulum transport, member of WD (WD-40)
           repeat family [3606 bp, 1201 aa]
          Length = 1201

 Score = 81.3 bits (199), Expect = 1e-15,   Method: Compositional matrix adjust.
 Identities = 81/356 (22%), Positives = 136/356 (38%), Gaps = 91/356 (25%)

Query: 266 IQTQTTRPWKVIYRERFKVES-NWRKGHCRIQEFKGHMDGVLTLQFN--YRLLFTGSYDS 322
           I    +RPW ++      ++  ++R G   +  F+ H   V  L F+    +  +   D 
Sbjct: 17  IAFHPSRPWVLVALFSSTIQLWDYRMGTL-LHRFEDHEGPVRGLDFHPTQPIFVSAGDDY 75

Query: 323 TIGIWDLFTGKLIRRLSGHSDGVKTLYFDDRKL---ITGSLDKTIRVWNYITGECISTYR 379
           TI +W L T K +  L+GH D V+T++F  R+L   I+ S D+TIR+WN+   + I+   
Sbjct: 76  TIKVWSLDTNKCLYTLTGHLDYVRTVFF-HRELPWIISASDDQTIRIWNWQNRKEIACLT 134

Query: 380 GHSDSVLSVDSY--QKVIVSGSADKTVKVWHVESR------------------------- 412
           GH+  V+    +    +IVS S D+T+++W +                            
Sbjct: 135 GHNHFVMCAQFHPTDDLIVSASLDETIRIWDISGLRKRHSAPGTSSFEEQMSAQQNLLDG 194

Query: 413 ------TCYTLRGHTEWVNCVKLHPKSFSCFSCSDDTTIRMWDIRTNSCLKV--FRGHVG 464
                   + L GHT  VN    HP      S SDD  +++W +      +V   RGH  
Sbjct: 195 SLGDCVVKFILEGHTRGVNWASFHPTLPLIVSGSDDRQVKLWRMSATKAWEVDTCRGHTN 254

Query: 465 QVQKIIPLTIKDVENLATDNTSDGSSPQDDPTMTDGADESDTPSNEQETVLDENIPYPTH 524
            V  +I                                                 P+   
Sbjct: 255 NVDSVI-----------------------------------------------FHPHQNL 267

Query: 525 LLSCGLDNTIKLWDVKTGKCIRTQFGHVEGVWDIAA-DNFRIISGSHDGSIKVWDL 579
           ++S G D T+++WD+     ++      +  W IAA  +  +   +HD  I V+ L
Sbjct: 268 IISVGEDKTLRVWDLDKRTPVKQFKRENDRFWLIAAHPHINLFGAAHDSGIMVFKL 323

 Score = 69.3 bits (168), Expect = 6e-12,   Method: Compositional matrix adjust.
 Identities = 39/135 (28%), Positives = 65/135 (48%), Gaps = 5/135 (3%)

Query: 333 KLIRRLSGHSDGVKTLYFDDRK--LITGSLDKTIRVWNYITGECISTYRGHSDSVLSVDS 390
           K++ +    S   K + F   +  ++      TI++W+Y  G  +  +  H   V  +D 
Sbjct: 2   KMLTKFESKSTRAKGIAFHPSRPWVLVALFSSTIQLWDYRMGTLLHRFEDHEGPVRGLDF 61

Query: 391 Y--QKVIVSGSADKTVKVWHVESRTC-YTLRGHTEWVNCVKLHPKSFSCFSCSDDTTIRM 447
           +  Q + VS   D T+KVW +++  C YTL GH ++V  V  H +     S SDD TIR+
Sbjct: 62  HPTQPIFVSAGDDYTIKVWSLDTNKCLYTLTGHLDYVRTVFFHRELPWIISASDDQTIRI 121

Query: 448 WDIRTNSCLKVFRGH 462
           W+ +    +    GH
Sbjct: 122 WNWQNRKEIACLTGH 136

 Score = 42.7 bits (99), Expect = 0.001,   Method: Compositional matrix adjust.
 Identities = 26/74 (35%), Positives = 40/74 (54%), Gaps = 4/74 (5%)

Query: 521 YPTH--LLSCGLDNTIKLWDVKTGKCIRTQFGHVEGVWDIAADNFR--IISGSHDGSIKV 576
           +PT    +S G D TIK+W + T KC+ T  GH++ V  +        IIS S D +I++
Sbjct: 62  HPTQPIFVSAGDDYTIKVWSLDTNKCLYTLTGHLDYVRTVFFHRELPWIISASDDQTIRI 121

Query: 577 WDLQSGKCMHTFNG 590
           W+ Q+ K +    G
Sbjct: 122 WNWQNRKEIACLTG 135

 Score = 38.5 bits (88), Expect = 0.016,   Method: Compositional matrix adjust.
 Identities = 22/69 (31%), Positives = 33/69 (47%), Gaps = 4/69 (5%)

Query: 525 LLSCGLDNTIKLWDVKTGKCI---RTQFGHVEGVWDIAADNFRIISGSHDGSIKVWDLQS 581
           +L     +TI+LWD + G  +       G V G+ D        +S   D +IKVW L +
Sbjct: 26  VLVALFSSTIQLWDYRMGTLLHRFEDHEGPVRGL-DFHPTQPIFVSAGDDYTIKVWSLDT 84

Query: 582 GKCMHTFNG 590
            KC++T  G
Sbjct: 85  NKCLYTLTG 93

 Score = 36.6 bits (83), Expect = 0.066,   Method: Compositional matrix adjust.
 Identities = 45/191 (23%), Positives = 73/191 (38%), Gaps = 19/191 (9%)

Query: 427 VKLHPKSFSCFSCSDDTTIRMWDIRTNSCLKVFRGHVGQVQKIIPLTIKDVENLATDNTS 486
           +  HP           +TI++WD R  + L  F  H G V+ +     + +   A D+ +
Sbjct: 17  IAFHPSRPWVLVALFSSTIQLWDYRMGTLLHRFEDHEGPVRGLDFHPTQPIFVSAGDDYT 76

Query: 487 DGSSPQDDP----TMTDGADESDTPSNEQETVLDENIPYPTHLLSCGLDNTIKLWDVKTG 542
                 D      T+T   D   T            +P+   ++S   D TI++W+ +  
Sbjct: 77  IKVWSLDTNKCLYTLTGHLDYVRT------VFFHRELPW---IISASDDQTIRIWNWQNR 127

Query: 543 KCIRTQFGHVEGVW--DIAADNFRIISGSHDGSIKVWDLQSGKCMHTFNGRRLQRETQHT 600
           K I    GH   V        +  I+S S D +I++WD+   +  H+  G     E    
Sbjct: 128 KEIACLTGHNHFVMCAQFHPTDDLIVSASLDETIRIWDISGLRKRHSAPGTSSFEEQMSA 187

Query: 601 QTQ----SLGD 607
           Q      SLGD
Sbjct: 188 QQNLLDGSLGD 198

 Score = 35.4 bits (80), Expect = 0.17,   Method: Compositional matrix adjust.
 Identities = 31/133 (23%), Positives = 64/133 (48%), Gaps = 9/133 (6%)

Query: 291 GHCRIQE-FKGHMDGVLTLQFN--YRLLFTGSYDSTIGIWDLFTGKL--IRRLSGHSDGV 345
           G C ++   +GH  GV    F+    L+ +GS D  + +W +   K   +    GH++ V
Sbjct: 197 GDCVVKFILEGHTRGVNWASFHPTLPLIVSGSDDRQVKLWRMSATKAWEVDTCRGHTNNV 256

Query: 346 KTLYFDDRK--LITGSLDKTIRVWNYITGECISTYRGHSDSVLSVDSYQKVIVSGSA-DK 402
            ++ F   +  +I+   DKT+RVW+      +  ++  +D    + ++  + + G+A D 
Sbjct: 257 DSVIFHPHQNLIISVGEDKTLRVWDLDKRTPVKQFKRENDRFWLIAAHPHINLFGAAHDS 316

Query: 403 TVKVWHVE-SRTC 414
            + V+ ++  R C
Sbjct: 317 GIMVFKLDRERPC 329

>KLLA0F04884g complement(478044..481682) similar to sp|P53622
           Saccharomyces cerevisiae YDL145c RET1 coatomer complex
           alpha chain of secretory pathway vesicles, start by
           similarity
          Length = 1212

 Score = 81.3 bits (199), Expect = 1e-15,   Method: Compositional matrix adjust.
 Identities = 84/379 (22%), Positives = 143/379 (37%), Gaps = 89/379 (23%)

Query: 266 IQTQTTRPWKVIYRERFKVES-NWRKGHCRIQEFKGHMDGVLTLQFN--YRLLFTGSYDS 322
           I    +RPW ++      ++  ++R G   +  F+ H   V  + F+    L  +   D 
Sbjct: 17  IAFHPSRPWVLVALFSSTIQLWDYRMG-VLLHRFEDHEGPVRGIDFHPTQPLFVSAGDDY 75

Query: 323 TIGIWDLFTGKLIRRLSGHSDGVKTLYFDDRK--LITGSLDKTIRVWNYITGECISTYRG 380
           TI +W L + K +  L GH D V+T++F      +I+ S D+TIR+WN+   + I+   G
Sbjct: 76  TIKVWSLESNKCLFTLDGHLDYVRTVFFHHELPWIISSSDDQTIRIWNWQNRKEIACLTG 135

Query: 381 HSDSVLSVDSY--QKVIVSGSADKTVKVWHVESR-------------------------- 412
           H+  V+    +  + ++VS S D+TV+VW +                             
Sbjct: 136 HNHFVMCAQFHPVEDLVVSASLDETVRVWDISGLRKRHSAPGTQSFEEQMRQQQNLLDGG 195

Query: 413 -----TCYTLRGHTEWVNCVKLHPKSFSCFSCSDDTTIRMWDIRTNSCLKV--FRGHVGQ 465
                  + L GHT  VN    HP      S SDD  +++W +      +V   RGH   
Sbjct: 196 FGDCVVKFILEGHTRGVNWASFHPTLPLIVSGSDDRQVKLWRMSATKAWEVDTCRGHTNN 255

Query: 466 VQKIIPLTIKDVENLATDNTSDGSSPQDDPTMTDGADESDTPSNEQETVLDENIPYPTHL 525
           V  +I                    PQ                        +N+     +
Sbjct: 256 VDSVI------------------FHPQ------------------------QNL-----I 268

Query: 526 LSCGLDNTIKLWDVKTGKCIRTQFGHVEGVWDIAA-DNFRIISGSHDGSIKVWDLQSGKC 584
           +S G D T+++WD+     I+      +  W + A  N  +   +HD  I ++ L   + 
Sbjct: 269 ISVGEDKTVRVWDLDKRTPIKQFKRENDRFWLVRAHPNLNLFGAAHDSGIMIFKLDRERP 328

Query: 585 MHTFNGRRLQRETQHTQTQ 603
               N  +L    +  Q Q
Sbjct: 329 PTAINQNQLFFINREKQVQ 347

 Score = 69.3 bits (168), Expect = 6e-12,   Method: Compositional matrix adjust.
 Identities = 67/262 (25%), Positives = 109/262 (41%), Gaps = 30/262 (11%)

Query: 333 KLIRRLSGHSDGVKTLYFDDRK--LITGSLDKTIRVWNYITGECISTYRGHSDSVLSVDS 390
           K++ +    S   K + F   +  ++      TI++W+Y  G  +  +  H   V  +D 
Sbjct: 2   KMLTKFESKSTRAKGIAFHPSRPWVLVALFSSTIQLWDYRMGVLLHRFEDHEGPVRGIDF 61

Query: 391 Y--QKVIVSGSADKTVKVWHVESRTC-YTLRGHTEWVNCVKLHPKSFSCFSCSDDTTIRM 447
           +  Q + VS   D T+KVW +ES  C +TL GH ++V  V  H +     S SDD TIR+
Sbjct: 62  HPTQPLFVSAGDDYTIKVWSLESNKCLFTLDGHLDYVRTVFFHHELPWIISSSDDQTIRI 121

Query: 448 WDIRTNSCLKVFRGHVGQVQKIIPLTIKDVENLATDNTSDGSSPQDDPTMTDGADESDTP 507
           W+ +    +    GH      ++      VE+L    + D +    D     G  +  + 
Sbjct: 122 WNWQNRKEIACLTGH---NHFVMCAQFHPVEDLVVSASLDETVRVWD---ISGLRKRHSA 175

Query: 508 SNEQETVLDENIPYPTHLLSCGLDNTIKLWDVKTGKCIRTQF---GHVEGV-WDIAADNF 563
              Q    +E +    +LL  G            G C+  +F   GH  GV W       
Sbjct: 176 PGTQS--FEEQMRQQQNLLDGGF-----------GDCV-VKFILEGHTRGVNWASFHPTL 221

Query: 564 -RIISGSHDGSIKVWDLQSGKC 584
             I+SGS D  +K+W + + K 
Sbjct: 222 PLIVSGSDDRQVKLWRMSATKA 243

 Score = 42.4 bits (98), Expect = 0.001,   Method: Compositional matrix adjust.
 Identities = 43/208 (20%), Positives = 74/208 (35%), Gaps = 51/208 (24%)

Query: 403 TVKVW-HVESRTCYTLRGHTEWVNCVKLHPKSFSCFSCSDDTTIRMWDIRTNSCLKVFRG 461
           T+++W +      +    H   V  +  HP      S  DD TI++W + +N CL    G
Sbjct: 34  TIQLWDYRMGVLLHRFEDHEGPVRGIDFHPTQPLFVSAGDDYTIKVWSLESNKCLFTLDG 93

Query: 462 HVGQVQKIIPLTIKDVENLATDNTSDGSSPQDDPTMTDGADESDTPSNEQETVLDENIPY 521
           H+  V+ +                                                 +P+
Sbjct: 94  HLDYVRTVF--------------------------------------------FHHELPW 109

Query: 522 PTHLLSCGLDNTIKLWDVKTGKCIRTQFGHVEGVW--DIAADNFRIISGSHDGSIKVWDL 579
              ++S   D TI++W+ +  K I    GH   V           ++S S D +++VWD+
Sbjct: 110 ---IISSSDDQTIRIWNWQNRKEIACLTGHNHFVMCAQFHPVEDLVVSASLDETVRVWDI 166

Query: 580 QSGKCMHTFNGRRLQRETQHTQTQSLGD 607
              +  H+  G +   E Q  Q Q+L D
Sbjct: 167 SGLRKRHSAPGTQ-SFEEQMRQQQNLLD 193

>YKR036C (CAF4) [3289] chr11 complement(508344..510323) Protein that
           associates with Ccr4p, contains WD (WD-40) repeats [1980
           bp, 659 aa]
          Length = 659

 Score = 79.7 bits (195), Expect = 3e-15,   Method: Compositional matrix adjust.
 Identities = 64/240 (26%), Positives = 99/240 (41%), Gaps = 57/240 (23%)

Query: 273 PWKVI----YRERFKVESNWRKGH-CRIQEFKGHMDGVLTLQF---NYRLLFTGSYDSTI 324
           PW  +    Y++R  +   W   H  ++ E  GH+  V  +Q    NY +L TGS D+T+
Sbjct: 346 PWGTLCSSSYQDR--IVKVWDLNHGIQVGELPGHLATVNCMQIDKKNYNMLITGSKDATL 403

Query: 325 GIWDLFTGK-------------------LIRRLSGHSDGVKTLYFDDRKLITGSLDKTIR 365
            +WDL   +                    I     H D +  L FD   L++GS DK I 
Sbjct: 404 KLWDLNLSREIYLDHSPLKEKTEEIVTPCIHNFELHKDEITALSFDSEALVSGSRDKKIF 463

Query: 366 VWNYITGECISTYR-----GHSDSVLSVDS--------------------YQKVIVSGSA 400
            W+  TG+CI          HSD  +   S                    Y   + +G+ 
Sbjct: 464 HWDLTTGKCIQQLDLIFTPTHSDIKMPARSLNNGACLLGTEAPMIGALQCYNSALATGTK 523

Query: 401 DKTVKVWHVE-SRTCYTLRGHTEWVNCVKLHPKSFSCFSCSDDTTIRMWDIRTNSCLKVF 459
           D  V++W +   +    L GHT+ +  +K    S    + S D ++R+WD+RT+S L V 
Sbjct: 524 DGIVRLWDLRVGKPVRLLEGHTDGITSLKF--DSEKLVTGSMDNSVRIWDLRTSSILDVI 581

 Score = 73.2 bits (178), Expect = 3e-13,   Method: Compositional matrix adjust.
 Identities = 36/96 (37%), Positives = 58/96 (60%), Gaps = 1/96 (1%)

Query: 315 LFTGSYDSTIGIWDLFTGKLIRRLSGHSDGVKTLYFDDRKLITGSLDKTIRVWNYITGEC 374
           L TG+ D  + +WDL  GK +R L GH+DG+ +L FD  KL+TGS+D ++R+W+  T   
Sbjct: 518 LATGTKDGIVRLWDLRVGKPVRLLEGHTDGITSLKFDSEKLVTGSMDNSVRIWDLRTSSI 577

Query: 375 ISTYRGHSDSVLSVDSYQKVIVSGSADKTVKVWHVE 410
           +     +   V S+D   K+I  G+ +  V V+++E
Sbjct: 578 LDVI-AYDLPVSSLDFDGKLITVGANEGGVNVFNME 612

 Score = 67.8 bits (164), Expect = 2e-11,   Method: Compositional matrix adjust.
 Identities = 58/246 (23%), Positives = 111/246 (45%), Gaps = 45/246 (18%)

Query: 361 DKTIRVWNYITGECISTYRGHSDSV--LSVDSYQ-KVIVSGSADKTVKVWHVE-SRTCYT 416
           D+ ++VW+   G  +    GH  +V  + +D     ++++GS D T+K+W +  SR  Y 
Sbjct: 357 DRIVKVWDLNHGIQVGELPGHLATVNCMQIDKKNYNMLITGSKDATLKLWDLNLSREIYL 416

Query: 417 ----LRGHTEWV--NCV---KLHPKSFSCFSC--------SDDTTIRMWDIRTNSCLKVF 459
               L+  TE +   C+   +LH    +  S         S D  I  WD+ T  C++  
Sbjct: 417 DHSPLKEKTEEIVTPCIHNFELHKDEITALSFDSEALVSGSRDKKIFHWDLTTGKCIQ-- 474

Query: 460 RGHVGQVQKIIPLTIKDVENLATDNTSDGSSPQDDPTMTDGADESDTPSNEQETVLDENI 519
                Q+  I   T  D++ +   + ++G+          GA +                
Sbjct: 475 -----QLDLIFTPTHSDIK-MPARSLNNGACLLGTEAPMIGALQC--------------- 513

Query: 520 PYPTHLLSCGLDNTIKLWDVKTGKCIRTQFGHVEGVWDIAADNFRIISGSHDGSIKVWDL 579
            Y + L +   D  ++LWD++ GK +R   GH +G+  +  D+ ++++GS D S+++WDL
Sbjct: 514 -YNSALATGTKDGIVRLWDLRVGKPVRLLEGHTDGITSLKFDSEKLVTGSMDNSVRIWDL 572

Query: 580 QSGKCM 585
           ++   +
Sbjct: 573 RTSSIL 578

 Score = 57.0 bits (136), Expect = 3e-08,   Method: Compositional matrix adjust.
 Identities = 68/350 (19%), Positives = 129/350 (36%), Gaps = 105/350 (30%)

Query: 301 HMDGVLTLQFN--YRLLFTGSY-DSTIGIWDLFTGKLIRRLSGHSDGVKTLYFDDRK--- 354
           H + +  L F+  +  L + SY D  + +WDL  G  +  L GH   V  +  D +    
Sbjct: 334 HGNSITALDFDTPWGTLCSSSYQDRIVKVWDLNHGIQVGELPGHLATVNCMQIDKKNYNM 393

Query: 355 LITGSLDKTIRVWNY-------------------ITGECISTYRGHSDSVLSVDSYQKVI 395
           LITGS D T+++W+                    I   CI  +  H D + ++    + +
Sbjct: 394 LITGSKDATLKLWDLNLSREIYLDHSPLKEKTEEIVTPCIHNFELHKDEITALSFDSEAL 453

Query: 396 VSGSADKTVKVWHVESRTCYTLRG--HTEWVNCVKLHPKSFSCFSC-------------- 439
           VSGS DK +  W + +  C        T   + +K+  +S +  +C              
Sbjct: 454 VSGSRDKKIFHWDLTTGKCIQQLDLIFTPTHSDIKMPARSLNNGACLLGTEAPMIGALQC 513

Query: 440 --------SDDTTIRMWDIRTNSCLKVFRGHVGQVQKIIPLTIKDVENLATDNTSDGSSP 491
                   + D  +R+WD+R    +++  GH                             
Sbjct: 514 YNSALATGTKDGIVRLWDLRVGKPVRLLEGH----------------------------- 544

Query: 492 QDDPTMTDGADESDTPSNEQETVLDENIPYPTHLLSCGLDNTIKLWDVKTGKCIRTQFGH 551
                 TDG       S +              L++  +DN++++WD++T   +     +
Sbjct: 545 ------TDGITSLKFDSEK--------------LVTGSMDNSVRIWDLRTSSILDV-IAY 583

Query: 552 VEGVWDIAADNFRIISGSHDGSIKVWDLQ------SGKCMHTFNGRRLQR 595
              V  +  D   I  G+++G + V++++      + +  H+ +G  L R
Sbjct: 584 DLPVSSLDFDGKLITVGANEGGVNVFNMERDEHWMTPEPPHSLDGDELSR 633

 Score = 48.5 bits (114), Expect = 1e-05,   Method: Compositional matrix adjust.
 Identities = 32/121 (26%), Positives = 62/121 (51%), Gaps = 9/121 (7%)

Query: 295 IQEFKGHMDGVLTLQFNYRLLFTGSYDSTIGIWDLFTGKLIRRLSGHSDGVKTLYFDDRK 354
           ++  +GH DG+ +L+F+   L TGS D+++ IWDL T  ++  ++ +   V +L FD + 
Sbjct: 538 VRLLEGHTDGITSLKFDSEKLVTGSMDNSVRIWDLRTSSILDVIA-YDLPVSSLDFDGKL 596

Query: 355 LITGSLDKTIRVWN------YITGECISTYRGH--SDSVLSVDSYQKVIVSGSADKTVKV 406
           +  G+ +  + V+N      ++T E   +  G   S  +  V      +++G  D  + V
Sbjct: 597 ITVGANEGGVNVFNMERDEHWMTPEPPHSLDGDELSRRIAIVKYKDGFLINGHNDGDINV 656

Query: 407 W 407
           W
Sbjct: 657 W 657

>Scas_629.12
          Length = 671

 Score = 79.0 bits (193), Expect = 4e-15,   Method: Compositional matrix adjust.
 Identities = 68/201 (33%), Positives = 91/201 (45%), Gaps = 35/201 (17%)

Query: 298 FKGHMDGVLTLQF--NYRLLFTGSYDSTIGIWDLFTGKLIRRLSGHSDGVKTLYF---DD 352
            KGH   V +L +  N   L +GS D T+ IWDL TG+    LS    GV T+     D 
Sbjct: 425 LKGHEQDVYSLDYFPNGEKLVSGSGDRTVRIWDLRTGQCSLTLSIEY-GVTTVAVSPNDG 483

Query: 353 RKLITGSLDKTIRVWNYITGECISTY-------RGHSDSVLSV----DSYQKVIVSGSAD 401
           + +  GSLD+ +RVW+  TG  +           GH DSV SV    D  +  +VSGS D
Sbjct: 484 KFIAAGSLDRAVRVWDSTTGFLVERLDSENELGTGHRDSVYSVVFTRDGNE--VVSGSLD 541

Query: 402 KTVKVWHVE---------------SRTC-YTLRGHTEWVNCVKLHPKSFSCFSCSDDTTI 445
           KTVK+W++                S TC  T  GH ++V  V          S S D  I
Sbjct: 542 KTVKLWNMRHSGNSNNESNDKGSASATCEVTYVGHKDFVLSVTTSQDDKYILSGSKDRGI 601

Query: 446 RMWDIRTNSCLKVFRGHVGQV 466
             WD  + + L + +GH   V
Sbjct: 602 LFWDKESGNPLLMLQGHRNSV 622

 Score = 73.2 bits (178), Expect = 3e-13,   Method: Compositional matrix adjust.
 Identities = 50/154 (32%), Positives = 79/154 (51%), Gaps = 18/154 (11%)

Query: 313 RLLFTGSYDSTIGIWDLFTGKLIRRLSGHSDGVKTL-YFDD-RKLITGSLDKTIRVWNYI 370
             L TG+ D  I IWD+   K++  L GH   V +L YF +  KL++GS D+T+R+W+  
Sbjct: 400 EFLATGAEDKLIRIWDIQERKIVMVLKGHEQDVYSLDYFPNGEKLVSGSGDRTVRIWDLR 459

Query: 371 TGEC---ISTYRGHSDSVLSVDSYQKVIVSGSADKTVKVWHVESRTCYTLR--------- 418
           TG+C   +S   G +   +S +   K I +GS D+ V+VW  +S T + +          
Sbjct: 460 TGQCSLTLSIEYGVTTVAVSPND-GKFIAAGSLDRAVRVW--DSTTGFLVERLDSENELG 516

Query: 419 -GHTEWVNCVKLHPKSFSCFSCSDDTTIRMWDIR 451
            GH + V  V          S S D T+++W++R
Sbjct: 517 TGHRDSVYSVVFTRDGNEVVSGSLDKTVKLWNMR 550

 Score = 65.5 bits (158), Expect = 8e-11,   Method: Compositional matrix adjust.
 Identities = 67/291 (23%), Positives = 119/291 (40%), Gaps = 54/291 (18%)

Query: 349 YFDDRKLITGSLDKTIRVWNYITGECIS-----------TYRGHSDSVLSVDSY------ 391
           + +D + +    +KT +++    GE I+           T    S S  S D Y      
Sbjct: 336 FSNDGQFLATGCNKTTQIYRVSDGELIAKLSDDSVTSPDTSSATSGSTPSTDLYIRSVCF 395

Query: 392 ---QKVIVSGSADKTVKVWHVESR-TCYTLRGHTEWVNCVKLHPKSFSCFSCSDDTTIRM 447
               + + +G+ DK +++W ++ R     L+GH + V  +   P      S S D T+R+
Sbjct: 396 SPDGEFLATGAEDKLIRIWDIQERKIVMVLKGHEQDVYSLDYFPNGEKLVSGSGDRTVRI 455

Query: 448 WDIRTNSCLKVFRGHVGQVQKIIPLTIKDVENLATDNTSDGSSPQDDPT--MTDGAD-ES 504
           WD+RT  C        G     + ++  D + +A  +        D  T  + +  D E+
Sbjct: 456 WDLRTGQCSLTLSIEYGVT--TVAVSPNDGKFIAAGSLDRAVRVWDSTTGFLVERLDSEN 513

Query: 505 DTPSNEQETVL------DENIPYPTHLLSCGLDNTIKLWDVK---------------TGK 543
           +  +  +++V       D N      ++S  LD T+KLW+++               +  
Sbjct: 514 ELGTGHRDSVYSVVFTRDGN-----EVVSGSLDKTVKLWNMRHSGNSNNESNDKGSASAT 568

Query: 544 CIRTQFGHVEGVWDI--AADNFRIISGSHDGSIKVWDLQSGKCMHTFNGRR 592
           C  T  GH + V  +  + D+  I+SGS D  I  WD +SG  +    G R
Sbjct: 569 CEVTYVGHKDFVLSVTTSQDDKYILSGSKDRGILFWDKESGNPLLMLQGHR 619

 Score = 42.4 bits (98), Expect = 0.001,   Method: Compositional matrix adjust.
 Identities = 34/135 (25%), Positives = 59/135 (43%), Gaps = 27/135 (20%)

Query: 300 GHMDGVLTLQF--NYRLLFTGSYDSTIGIWDLFTGKLIRRLS---------------GHS 342
           GH D V ++ F  +   + +GS D T+ +W++         S               GH 
Sbjct: 518 GHRDSVYSVVFTRDGNEVVSGSLDKTVKLWNMRHSGNSNNESNDKGSASATCEVTYVGHK 577

Query: 343 DGVKTLYF--DDRKLITGSLDKTIRVWNYITGECISTYRGHSDSVLSVDSYQ-------- 392
           D V ++    DD+ +++GS D+ I  W+  +G  +   +GH +SV+SV            
Sbjct: 578 DFVLSVTTSQDDKYILSGSKDRGILFWDKESGNPLLMLQGHRNSVISVAVANGSALGPKY 637

Query: 393 KVIVSGSADKTVKVW 407
            V  +GS D   ++W
Sbjct: 638 NVFATGSGDCKARIW 652

>Scas_603.5
          Length = 589

 Score = 79.0 bits (193), Expect = 4e-15,   Method: Compositional matrix adjust.
 Identities = 58/230 (25%), Positives = 110/230 (47%), Gaps = 27/230 (11%)

Query: 381 HSDSVLSVD---SYQKVIVSGSADKTVKVWHVESR-TCYTLRGHTEWVNCVKLHPKSFSC 436
           ++D+V  +D   S + +  +G  + ++KVW +E+      L  H   V C++LHP S + 
Sbjct: 293 YTDTVTCLDFDLSTKMLYTAGKYNTSIKVWDLETNDQVMDLDDHIASVTCMQLHPDSKTL 352

Query: 437 FSCSDDTTIRMWDI------------RTNSCLKVFRGHVGQVQKIIPLTIKDVENLATDN 484
            + S D T+++WD+              +SC+  F  H  ++  +      D E L +  
Sbjct: 353 ITGSKDATLKLWDLGLAPQTSLDSTSNIDSCINTFEAHTAEITSVS----YDNEYLLS-A 407

Query: 485 TSDGSSPQDDPTM------TDGADESDTPSNEQETVLDENIPYPTHLLSCGLDNTIKLWD 538
           + D S  Q D T        +     ++ +N +++ ++        L +   D  I+LWD
Sbjct: 408 SRDKSIRQWDLTTGNCVQTLEATLSHNSGTNIKDSTVEALQSVGAALATGSKDGIIRLWD 467

Query: 539 VKTGKCIRTQFGHVEGVWDIAADNFRIISGSHDGSIKVWDLQSGKCMHTF 588
           +++GK +RT   H   +  +  D+ +II+GS D +I V DL++G  + T+
Sbjct: 468 LRSGKVVRTLLKHQGPITSLQFDSTKIITGSTDANISVSDLRTGNILETY 517

 Score = 72.4 bits (176), Expect = 4e-13,   Method: Compositional matrix adjust.
 Identities = 64/267 (23%), Positives = 113/267 (42%), Gaps = 46/267 (17%)

Query: 246 LHMKRARIQQNSTGSSSNAD------------IQTQTTRPWKVIYRERFKVESNWRKGHC 293
           +H  + R +QN + + +  D            I      P +V++  +   E+N      
Sbjct: 224 VHSYKHRNEQNESAAKAEPDLTDAKLDPNIRGINNVMNDPAQVMFFHKNDKENN---EDL 280

Query: 294 RIQEFKGHMDGVLT-----LQFNY--RLLFT-GSYDSTIGIWDLFTGKLIRRLSGHSDGV 345
           +     G +D V T     L F+   ++L+T G Y+++I +WDL T   +  L  H   V
Sbjct: 281 KSGSHLGTLDSVYTDTVTCLDFDLSTKMLYTAGKYNTSIKVWDLETNDQVMDLDDHIASV 340

Query: 346 K--TLYFDDRKLITGSLDKTIRVWNYITG------------ECISTYRGHSDSVLSVDSY 391
               L+ D + LITGS D T+++W+                 CI+T+  H+  + SV   
Sbjct: 341 TCMQLHPDSKTLITGSKDATLKLWDLGLAPQTSLDSTSNIDSCINTFEAHTAEITSVSYD 400

Query: 392 QKVIVSGSADKTVKVWHVESRTCY-TLRG---HTEWVN-----CVKLHPKSFSCFSCSDD 442
            + ++S S DK+++ W + +  C  TL     H    N        L     +  + S D
Sbjct: 401 NEYLLSASRDKSIRQWDLTTGNCVQTLEATLSHNSGTNIKDSTVEALQSVGAALATGSKD 460

Query: 443 TTIRMWDIRTNSCLKVFRGHVGQVQKI 469
             IR+WD+R+   ++    H G +  +
Sbjct: 461 GIIRLWDLRSGKVVRTLLKHQGPITSL 487

 Score = 63.5 bits (153), Expect = 3e-10,   Method: Compositional matrix adjust.
 Identities = 44/191 (23%), Positives = 84/191 (43%), Gaps = 27/191 (14%)

Query: 294 RIQEFKGHMDGVLTLQF--NYRLLFTGSYDSTIGIWDLFTG------------KLIRRLS 339
           ++ +   H+  V  +Q   + + L TGS D+T+ +WDL                 I    
Sbjct: 329 QVMDLDDHIASVTCMQLHPDSKTLITGSKDATLKLWDLGLAPQTSLDSTSNIDSCINTFE 388

Query: 340 GHSDGVKTLYFDDRKLITGSLDKTIRVWNYITGECISTYRG----------HSDSVLSVD 389
            H+  + ++ +D+  L++ S DK+IR W+  TG C+ T                +V ++ 
Sbjct: 389 AHTAEITSVSYDNEYLLSASRDKSIRQWDLTTGNCVQTLEATLSHNSGTNIKDSTVEALQ 448

Query: 390 SYQKVIVSGSADKTVKVWHVES-RTCYTLRGHTEWVNCVKLHPKSFSCFSCSDDTTIRMW 448
           S    + +GS D  +++W + S +   TL  H   +  ++    S    + S D  I + 
Sbjct: 449 SVGAALATGSKDGIIRLWDLRSGKVVRTLLKHQGPITSLQF--DSTKIITGSTDANISVS 506

Query: 449 DIRTNSCLKVF 459
           D+RT + L+ +
Sbjct: 507 DLRTGNILETY 517

 Score = 58.9 bits (141), Expect = 7e-09,   Method: Compositional matrix adjust.
 Identities = 39/104 (37%), Positives = 57/104 (54%), Gaps = 5/104 (4%)

Query: 305 VLTLQFNYRLLFTGSYDSTIGIWDLFTGKLIRRLSGHSDGVKTLYFDDRKLITGSLDKTI 364
           V  LQ     L TGS D  I +WDL +GK++R L  H   + +L FD  K+ITGS D  I
Sbjct: 444 VEALQSVGAALATGSKDGIIRLWDLRSGKVVRTLLKHQGPITSLQFDSTKIITGSTDANI 503

Query: 365 RVWNYITGECISTYRGHSDSVLSVDSYQ--KVIVSGSADKTVKV 406
            V +  TG  + TY  H D+ ++   ++  K++V+    K V+V
Sbjct: 504 SVSDLRTGNILETY--HCDAPINTFDFENDKLVVAADT-KDVRV 544

>KLLA0F21406g complement(1996260..1998377) similar to sp|P47025
           Saccharomyces cerevisiae YJL112w MDV1, start by
           similarity
          Length = 705

 Score = 79.0 bits (193), Expect = 5e-15,   Method: Compositional matrix adjust.
 Identities = 56/252 (22%), Positives = 106/252 (42%), Gaps = 53/252 (21%)

Query: 357 TGSLDKTIRVWNYITGECISTYRGHSDSV--LSVDSYQKVIVSGSADKTVKVWHVESRTC 414
            GSLD +++VW+    + I+T  GH  S+  + +D Y   +++G  D  +K+W ++    
Sbjct: 415 AGSLDHSVKVWDLSKKKQIATLHGHLASISCMQIDQYS-TLITGGRDAVLKLWDIDKAMA 473

Query: 415 --------------YTLRGHTEWVNCVKLHPKSFSCFSCSDDTTIRMWDIRTNSCLKV-- 458
                         YT   H + +  +     +    S S D T+R WD+ +  C +   
Sbjct: 474 DEASNSSEDNDACLYTFDSHVDEITAISFDGDNL--VSGSQDRTVRQWDLNSGKCTQTID 531

Query: 459 --FRGHVGQVQKIIPLTIKDVENLATDNTSDGSSPQDDPTMTDGADESDTPSNEQETVLD 516
             F     + Q+ IPL  ++   L  +  + G+    D  +  G                
Sbjct: 532 ISFATGPMRSQRNIPL--RNSVLLTKEPPAIGALQCFDAALATGTK-------------- 575

Query: 517 ENIPYPTHLLSCGLDNTIKLWDVKTGKCIRTQFGHVEGVWDIAADNFRIISGSHDGSIKV 576
                         D  ++LWD+++GK +R   GH + +  +  D+  +++G+ D SI++
Sbjct: 576 --------------DGIVRLWDLRSGKVVRMLEGHTDAITSLQFDSVNLVTGAMDRSIRI 621

Query: 577 WDLQSGKCMHTF 588
           WDL++G     F
Sbjct: 622 WDLRTGILSDVF 633

 Score = 69.7 bits (169), Expect = 3e-12,   Method: Compositional matrix adjust.
 Identities = 33/94 (35%), Positives = 58/94 (61%), Gaps = 1/94 (1%)

Query: 315 LFTGSYDSTIGIWDLFTGKLIRRLSGHSDGVKTLYFDDRKLITGSLDKTIRVWNYITGEC 374
           L TG+ D  + +WDL +GK++R L GH+D + +L FD   L+TG++D++IR+W+  TG  
Sbjct: 570 LATGTKDGIVRLWDLRSGKVVRMLEGHTDAITSLQFDSVNLVTGAMDRSIRIWDLRTG-I 628

Query: 375 ISTYRGHSDSVLSVDSYQKVIVSGSADKTVKVWH 408
           +S    +   + S+      IV  + + TVK+++
Sbjct: 629 LSDVFAYEQPITSLHFDLDKIVISNNEPTVKIYN 662

 Score = 68.2 bits (165), Expect = 1e-11,   Method: Compositional matrix adjust.
 Identities = 68/344 (19%), Positives = 130/344 (37%), Gaps = 100/344 (29%)

Query: 289 RKGHCRIQEF-----------KGHMDGVLTLQFNY---RLLFTGSYDSTIGIWDLFTGKL 334
           RK +  +Q+F           K H + +  L F+     +   GS D ++ +WDL   K 
Sbjct: 373 RKTYPTLQQFYDSGSKITSLPKAHDEDITCLDFDMPFGTMCSAGSLDHSVKVWDLSKKKQ 432

Query: 335 IRRLSGHSDGVKTLYFDD-RKLITGSLDKTIRVWNYITG-------------ECISTYRG 380
           I  L GH   +  +  D    LITG  D  +++W+                  C+ T+  
Sbjct: 433 IATLHGHLASISCMQIDQYSTLITGGRDAVLKLWDIDKAMADEASNSSEDNDACLYTFDS 492

Query: 381 HSDSVLSVDSYQKVIVSGSADKTVKVWHVESRTCYTL------------RGHTEWVNCVK 428
           H D + ++      +VSGS D+TV+ W + S  C               + +    N V 
Sbjct: 493 HVDEITAISFDGDNLVSGSQDRTVRQWDLNSGKCTQTIDISFATGPMRSQRNIPLRNSVL 552

Query: 429 L--HPKSFSCFSCSD--------DTTIRMWDIRTNSCLKVFRGHVGQVQKIIPLTIKDVE 478
           L   P +     C D        D  +R+WD+R+   +++  GH   +            
Sbjct: 553 LTKEPPAIGALQCFDAALATGTKDGIVRLWDLRSGKVVRMLEGHTDAI------------ 600

Query: 479 NLATDNTSDGSSPQDDPTMTDGADESDTPSNEQETVLDENIPYPTHLLSCGLDNTIKLWD 538
                     +S Q D                             +L++  +D +I++WD
Sbjct: 601 ----------TSLQFD---------------------------SVNLVTGAMDRSIRIWD 623

Query: 539 VKTGKCIRTQFGHVEGVWDIAADNFRIISGSHDGSIKVWDLQSG 582
           ++TG  +   F + + +  +  D  +I+  +++ ++K+++ + G
Sbjct: 624 LRTG-ILSDVFAYEQPITSLHFDLDKIVISNNEPTVKIYNRKDG 666

 Score = 49.7 bits (117), Expect = 5e-06,   Method: Compositional matrix adjust.
 Identities = 53/263 (20%), Positives = 100/263 (38%), Gaps = 91/263 (34%)

Query: 369 YITGECISTY-RGHSDSVLSVD---SYQKVIVSGSADKTVKVWHV-ESRTCYTLRGHTEW 423
           Y +G  I++  + H + +  +D    +  +  +GS D +VKVW + + +   TL GH   
Sbjct: 383 YDSGSKITSLPKAHDEDITCLDFDMPFGTMCSAGSLDHSVKVWDLSKKKQIATLHGHLAS 442

Query: 424 VNCVKLHPKSFSCFSCSDDTTIRMWDIR-------------TNSCLKVFRGHVGQVQKII 470
           ++C+++   S +  +   D  +++WDI               ++CL  F  HV ++  I 
Sbjct: 443 ISCMQIDQYS-TLITGGRDAVLKLWDIDKAMADEASNSSEDNDACLYTFDSHVDEITAI- 500

Query: 471 PLTIKDVENLATDNTSDGSSPQDDPTMTDGADESDTPSNEQETVLDENIPYPTHLLSCGL 530
                         + DG                                   +L+S   
Sbjct: 501 --------------SFDGD----------------------------------NLVSGSQ 512

Query: 531 DNTIKLWDVKTGKCIRT-----QFGHVEGVWDIAADNFRIIS------------------ 567
           D T++ WD+ +GKC +T       G +    +I   N  +++                  
Sbjct: 513 DRTVRQWDLNSGKCTQTIDISFATGPMRSQRNIPLRNSVLLTKEPPAIGALQCFDAALAT 572

Query: 568 GSHDGSIKVWDLQSGKCMHTFNG 590
           G+ DG +++WDL+SGK +    G
Sbjct: 573 GTKDGIVRLWDLRSGKVVRMLEG 595

>AGL234W [4078] [Homologous to ScYCR084C (TUP1) - SH]
           complement(257969..259858) [1890 bp, 629 aa]
          Length = 629

 Score = 77.0 bits (188), Expect = 2e-14,   Method: Compositional matrix adjust.
 Identities = 85/314 (27%), Positives = 127/314 (40%), Gaps = 83/314 (26%)

Query: 313 RLLFTGSYDSTIGIWDLFTGKLIRRLSGHSDGVKTL-YFD-DRKLITGSLDKTIRVWNYI 370
           + L TG+ D  I IWDL T K++  L GH   + +L YF    KL++GS D+T+R+W+  
Sbjct: 365 KYLATGAEDKLIRIWDLTTKKILMTLQGHEQDIYSLDYFPAGDKLVSGSGDRTVRIWDLR 424

Query: 371 TGECISTYRGHSDSVLSVDSYQ---KVIVSGSADKTVKVWHVESRTCYTLR--------- 418
           TG+C  T     D V +V       K I +GS D+TV+VW  +S T + +          
Sbjct: 425 TGQCSLTLS-IEDGVTTVAVSPGDGKYIAAGSLDRTVRVW--DSETGFLVERLDSENELS 481

Query: 419 -GHTEWVNCVKLHPKSFSCFSCSDDTTIRMWDIRT-------NSCLKVFRGHVGQVQKII 470
            GH + V  V          S S D ++++WD+R         +C   + GH        
Sbjct: 482 TGHKDSVYSVVFTRDGQGVISGSLDRSVKLWDLRGLNGQKSHATCEVTYTGH-------- 533

Query: 471 PLTIKD-VENLATDNTSDGSSPQDDPTMTDGADESDTPSNEQETVLDENIPYPTHLLSCG 529
               KD V ++AT         QDD                             ++LS  
Sbjct: 534 ----KDFVLSVATT--------QDD----------------------------EYILSGS 553

Query: 530 LDNTIKLWDVKTGKCIRTQFGHVEGVWDIAADN-FRI-------ISGSHDGSIKVWDLQS 581
            D  +  WD  +G  +    GH   V  +A  N F +        +GS D   ++W   +
Sbjct: 554 KDRGVLFWDTASGNPLLMLQGHRNSVISVAVVNGFPLGPDVGVFATGSGDCKARIWKY-T 612

Query: 582 GKCMHTFNGRRLQR 595
            K   T  G +LQ 
Sbjct: 613 KKSNPTATGAKLQE 626

 Score = 76.3 bits (186), Expect = 3e-14,   Method: Compositional matrix adjust.
 Identities = 66/261 (25%), Positives = 104/261 (39%), Gaps = 66/261 (25%)

Query: 351 DDRKLITGSLDKTIRVWNYITGECISTYRGHSDSVLSVDSYQK--VIVSGSADKTVKVWH 408
           D + L TG+ DK IR+W+  T + + T +GH   + S+D +     +VSGS D+TV++W 
Sbjct: 363 DGKYLATGAEDKLIRIWDLTTKKILMTLQGHEQDIYSLDYFPAGDKLVSGSGDRTVRIWD 422

Query: 409 VESRTCYTLRGHTEWVNCVKLHPKSFSCFSC-SDDTTIRMWDIRT-------NSCLKVFR 460
           + +  C       + V  V + P      +  S D T+R+WD  T       +S  ++  
Sbjct: 423 LRTGQCSLTLSIEDGVTTVAVSPGDGKYIAAGSLDRTVRVWDSETGFLVERLDSENELST 482

Query: 461 GHVGQVQKIIPLTIKDVENLATDNTSDGSSPQDDPTMTDGADESDTPSNEQETVLDENIP 520
           GH   V  ++              T DG                                
Sbjct: 483 GHKDSVYSVV-------------FTRDGQG------------------------------ 499

Query: 521 YPTHLLSCGLDNTIKLWDVKT-------GKCIRTQFGHVEGVWDIAA--DNFRIISGSHD 571
               ++S  LD ++KLWD++          C  T  GH + V  +A   D+  I+SGS D
Sbjct: 500 ----VISGSLDRSVKLWDLRGLNGQKSHATCEVTYTGHKDFVLSVATTQDDEYILSGSKD 555

Query: 572 GSIKVWDLQSGKCMHTFNGRR 592
             +  WD  SG  +    G R
Sbjct: 556 RGVLFWDTASGNPLLMLQGHR 576

 Score = 75.5 bits (184), Expect = 5e-14,   Method: Compositional matrix adjust.
 Identities = 60/190 (31%), Positives = 90/190 (47%), Gaps = 23/190 (12%)

Query: 295 IQEFKGHMDGVLTLQF--NYRLLFTGSYDSTIGIWDLFTGKLIRRLSGHSDGVKTLYF-- 350
           +   +GH   + +L +      L +GS D T+ IWDL TG+    LS   DGV T+    
Sbjct: 387 LMTLQGHEQDIYSLDYFPAGDKLVSGSGDRTVRIWDLRTGQCSLTLS-IEDGVTTVAVSP 445

Query: 351 -DDRKLITGSLDKTIRVWNYITGECISTY-------RGHSDSVLSVDSYQ--KVIVSGSA 400
            D + +  GSLD+T+RVW+  TG  +           GH DSV SV   +  + ++SGS 
Sbjct: 446 GDGKYIAAGSLDRTVRVWDSETGFLVERLDSENELSTGHKDSVYSVVFTRDGQGVISGSL 505

Query: 401 DKTVKVWHVES-------RTC-YTLRGHTEWVNCVKLHPKSFSCFSCSDDTTIRMWDIRT 452
           D++VK+W +          TC  T  GH ++V  V          S S D  +  WD  +
Sbjct: 506 DRSVKLWDLRGLNGQKSHATCEVTYTGHKDFVLSVATTQDDEYILSGSKDRGVLFWDTAS 565

Query: 453 NSCLKVFRGH 462
            + L + +GH
Sbjct: 566 GNPLLMLQGH 575

 Score = 63.5 bits (153), Expect = 2e-10,   Method: Compositional matrix adjust.
 Identities = 66/294 (22%), Positives = 113/294 (38%), Gaps = 77/294 (26%)

Query: 321 DSTIGIWDLFTGKLIRRLSGHSDGVKTLYFDDRKLITGSLDKTIRVWNYITGECISTYRG 380
           + T  ++ + TG+L+ RLS  S               G+ D          GE  +T + 
Sbjct: 296 NKTTQVYKVSTGELLARLSDDSVAGVNNEASTGPANNGTADNG--------GENSATIQP 347

Query: 381 HSDSVLSVDSY-----QKVIVSGSADKTVKVWHVESR-TCYTLRGHTEWVNCVKLHPKSF 434
            S S L + S       K + +G+ DK +++W + ++    TL+GH + +  +   P   
Sbjct: 348 ASSSDLYIRSVCFSPDGKYLATGAEDKLIRIWDLTTKKILMTLQGHEQDIYSLDYFPAGD 407

Query: 435 SCFSCSDDTTIRMWDIRTNSCLKVFRGHVGQVQKIIPLTIKDVENLATDNTSDGSSPQDD 494
              S S D T+R+WD+RT  C              + L+I+D       +  DG      
Sbjct: 408 KLVSGSGDRTVRIWDLRTGQC-------------SLTLSIEDGVTTVAVSPGDGK----- 449

Query: 495 PTMTDGADESDTPSNEQETVLDENIPYPTHLLSCGLDNTIKLWDVKTGKCIR-------T 547
                                        ++ +  LD T+++WD +TG  +         
Sbjct: 450 -----------------------------YIAAGSLDRTVRVWDSETGFLVERLDSENEL 480

Query: 548 QFGHVEGVWDIA--ADNFRIISGSHDGSIKVWDLQS-------GKCMHTFNGRR 592
             GH + V+ +    D   +ISGS D S+K+WDL+          C  T+ G +
Sbjct: 481 STGHKDSVYSVVFTRDGQGVISGSLDRSVKLWDLRGLNGQKSHATCEVTYTGHK 534

 Score = 48.1 bits (113), Expect = 2e-05,   Method: Compositional matrix adjust.
 Identities = 36/139 (25%), Positives = 65/139 (46%), Gaps = 19/139 (13%)

Query: 300 GHMDGVLTLQF--NYRLLFTGSYDSTIGIWDL--FTGKLIRR-----LSGHSDGVKTLYF 350
           GH D V ++ F  + + + +GS D ++ +WDL    G+          +GH D V ++  
Sbjct: 483 GHKDSVYSVVFTRDGQGVISGSLDRSVKLWDLRGLNGQKSHATCEVTYTGHKDFVLSVAT 542

Query: 351 --DDRKLITGSLDKTIRVWNYITGECISTYRGHSDSVLSVDSYQ--------KVIVSGSA 400
             DD  +++GS D+ +  W+  +G  +   +GH +SV+SV             V  +GS 
Sbjct: 543 TQDDEYILSGSKDRGVLFWDTASGNPLLMLQGHRNSVISVAVVNGFPLGPDVGVFATGSG 602

Query: 401 DKTVKVWHVESRTCYTLRG 419
           D   ++W    ++  T  G
Sbjct: 603 DCKARIWKYTKKSNPTATG 621

>KLLA0C07425g complement(647673..649007) highly similar to sp|Q12024
           Saccharomyces cerevisiae YOR272w YTM1
           microtubule-interacting protein singleton, start by
           similarity
          Length = 444

 Score = 75.9 bits (185), Expect = 2e-14,   Method: Compositional matrix adjust.
 Identities = 85/335 (25%), Positives = 145/335 (43%), Gaps = 47/335 (14%)

Query: 303 DGVLTLQFNYRLLFTGSYDSTIGIWDLFTGKLIRRLSGHSDGVKTL-YFDDRKLITGSLD 361
           D V +L      +++GSYD  +  ++L +GK+ ++ SGHS  ++ + Y    +L++   D
Sbjct: 104 DWVSSLDVGSNYIYSGSYDGIVRTYNL-SGKVEKQYSGHSGPIRAVHYISSTRLVSAGND 162

Query: 362 KTIRVWNYIT-------------GECISTYRGHSDSVLSVDSYQKVIVSGSADKTVKVWH 408
           +T+R+W                 G+ ++   GH   V+S+D  +  I+S S D TV +W 
Sbjct: 163 RTLRLWKTKNDDLKSIDEEEIEDGKTLAILEGHKAPVVSIDVSKDRILSASCDNTVSLWS 222

Query: 409 VESRTCYTLRGHTEWVNCVKLHPKSFSCFSCSDDTTIRMWDIRTNSCLKVFRGHVGQVQK 468
              +    +    +    V    K     +  D +      IR  + L +F  H   V+ 
Sbjct: 223 TNYKEMTVIDPMEDLGGNVSTAAKKRRKLTLKDGS------IRRRAPLALFESHSAPVEA 276

Query: 469 IIPLTIKDVENLATDNTSDGSSPQDDPTMT---DGADESDTPSNEQETVLDENIPYPTHL 525
           +I           +D+T   S  QD    T     A   DT +     +    +P   +L
Sbjct: 277 VI--------FDKSDDTVGYSVSQDHTIKTWDLITAKCVDTKTTSYSLLSVAQLP-KLNL 327

Query: 526 LSCGLDNT-IKLWDVK---TGKCIRTQF-GHVEGV--WDIAADN-FRIISGSHDGSIKVW 577
           L+CG     I L D +   + K  + Q  GH   V   D   +N + I S SHDG++KVW
Sbjct: 328 LACGSSARHITLHDPRVNSSSKITQQQLVGHKNFVVALDTCPENEYMICSASHDGTVKVW 387

Query: 578 DLQSGKCMHTFNGRRLQRETQHTQTQSLGDKVAPI 612
           D++S   M+T     + RE ++   + + DKV  +
Sbjct: 388 DVRSNTAMYT-----ITREDKNV-VKGVNDKVFAV 416

 Score = 47.4 bits (111), Expect = 2e-05,   Method: Compositional matrix adjust.
 Identities = 54/234 (23%), Positives = 98/234 (41%), Gaps = 47/234 (20%)

Query: 269 QTTRPWKVIYRERFKVESNWRKGHCRIQEFKGHMDGVLTLQFNYRLLFTGSYDSTIGIWD 328
           +T R WK    +   ++    +    +   +GH   V+++  +   + + S D+T+ +W 
Sbjct: 163 RTLRLWKTKNDDLKSIDEEEIEDGKTLAILEGHKAPVVSIDVSKDRILSASCDNTVSLWS 222

Query: 329 ------------------------------LFTGKLIRR-----LSGHSDGVKTLYFDDR 353
                                         L  G + RR        HS  V+ + FD  
Sbjct: 223 TNYKEMTVIDPMEDLGGNVSTAAKKRRKLTLKDGSIRRRAPLALFESHSAPVEAVIFDKS 282

Query: 354 KLITG---SLDKTIRVWNYITGECISTYRGHSDSVLSVDSYQK--VIVSGSADKTVKVW- 407
               G   S D TI+ W+ IT +C+ T +  S S+LSV    K  ++  GS+ + + +  
Sbjct: 283 DDTVGYSVSQDHTIKTWDLITAKCVDT-KTTSYSLLSVAQLPKLNLLACGSSARHITLHD 341

Query: 408 -HVESRTCYT---LRGHTEWVNCVKLHPKS-FSCFSCSDDTTIRMWDIRTNSCL 456
             V S +  T   L GH  +V  +   P++ +   S S D T+++WD+R+N+ +
Sbjct: 342 PRVNSSSKITQQQLVGHKNFVVALDTCPENEYMICSASHDGTVKVWDVRSNTAM 395

>AGL196C [4116] [Homologous to ScYLR129W (DIP2) - SH]
           (328838..331645) [2808 bp, 935 aa]
          Length = 935

 Score = 76.3 bits (186), Expect = 4e-14,   Method: Compositional matrix adjust.
 Identities = 56/182 (30%), Positives = 88/182 (48%), Gaps = 21/182 (11%)

Query: 306 LTLQFNYRLLFTGSYDSTIGIWD------LFTG---KLIRRLSGHSDGVKTLYFD----- 351
           L L  + + L T S D T+  WD      L  G   K + ++    D    L  D     
Sbjct: 473 LDLTSDGKRLVTASADKTVKFWDFKVEQELVAGTLDKFVPKMKLIHDTTLDLGEDLWCVK 532

Query: 352 ----DRKLITGSLDKTIRVWNYITGECISTYRGHSDSVLSVDSYQ--KVIVSGSADKTVK 405
               DR L    LD T++V+   + +   +  GH   VLS+D     K+I++ SADK +K
Sbjct: 533 ISPEDRFLAVSLLDNTVKVFFLDSMKFFLSLYGHKLPVLSMDISHDSKLIITSSADKNIK 592

Query: 406 VWHVESRTCY-TLRGHTEWVNCVKLHPKSFSCFSCSDDTTIRMWDIRTNSCLKVFRGHVG 464
           +W ++   C+ +L  H + +  VK  P+S + FSCS D T++ WD  +  C++   GH G
Sbjct: 593 IWGLDFGDCHKSLFAHQDSIMNVKFLPESHNFFSCSKDGTVKYWDGNSFDCIQKLYGHQG 652

Query: 465 QV 466
           +V
Sbjct: 653 EV 654

 Score = 69.3 bits (168), Expect = 6e-12,   Method: Compositional matrix adjust.
 Identities = 64/274 (23%), Positives = 122/274 (44%), Gaps = 41/274 (14%)

Query: 314 LLFTGSYDSTIGIWDLFTGKLIRRLS-GHSDGVKTLYF--DDRKLITGSLDKTIRVWNYI 370
           L+  G+    + ++DL +  ++  +   H+  + +L    D ++L+T S DKT++ W++ 
Sbjct: 438 LVILGTRAGQLQLFDLASSTMLENIEEAHTAAIWSLDLTSDGKRLVTASADKTVKFWDF- 496

Query: 371 TGECISTYRGHSDSVLSVDSYQKVIVSGSADKTVKVWHVESRTCYTLRGHTEWVNCVKLH 430
                                ++ +V+G+ DK V    +   T   L G   W  CVK+ 
Sbjct: 497 -------------------KVEQELVAGTLDKFVPKMKLIHDTTLDL-GEDLW--CVKIS 534

Query: 431 PKSFSCFSCSDDTTIRMWDIRTNSCLKVFRGHVGQVQKIIPLTIKDVENLATDNTSDGSS 490
           P+         D T++++ + +        GH       +P+   D+ +   D+    +S
Sbjct: 535 PEDRFLAVSLLDNTVKVFFLDSMKFFLSLYGHK------LPVLSMDISH---DSKLIITS 585

Query: 491 PQDDPTMTDGADESDTPSN---EQETVLD-ENIPYPTHLLSCGLDNTIKLWDVKTGKCIR 546
             D      G D  D   +    Q+++++ + +P   +  SC  D T+K WD  +  CI+
Sbjct: 586 SADKNIKIWGLDFGDCHKSLFAHQDSIMNVKFLPESHNFFSCSKDGTVKYWDGNSFDCIQ 645

Query: 547 TQFGHVEGVWDIA--ADNFRIISGSHDGSIKVWD 578
             +GH   VW +A  +D   ++S SHD SI+VW+
Sbjct: 646 KLYGHQGEVWALAVSSDGQAVVSVSHDRSIRVWE 679

 Score = 58.9 bits (141), Expect = 8e-09,   Method: Compositional matrix adjust.
 Identities = 38/161 (23%), Positives = 76/161 (47%), Gaps = 16/161 (9%)

Query: 266 IQTQTTRPWKVIY----RERFKVESNWRKGHCRIQE---------FKGHMDGVLTLQFNY 312
           I T+  +P +  Y     E F +   +  G  +I +         F  H   +  L+F+ 
Sbjct: 68  IDTKAEKPAEATYLQYHEETFILAVGYADGTIKIWDMQTQTVLIVFHSHSSAITILRFDQ 127

Query: 313 R--LLFTGSYDSTIGIWDLFTGKLIRRLSGHSDGVKTLYFD-DRKLITGSLDKTIRVWNY 369
               L +GS D+TI +WDL     + +L  H D +  ++ + D  LI+ S D  I++W+ 
Sbjct: 128 TGTRLISGSRDATIILWDLVAETGLCKLRSHKDAITGIWCENDDWLISVSKDGLIKLWDM 187

Query: 370 ITGECISTYRGHSDSVLSVDSYQKVIVSGSADKTVKVWHVE 410
              +C+ T+  H+    S+     ++++ +A+  +K+W ++
Sbjct: 188 KVHQCVETHMAHTGECWSLAVKDNMVITANAESEIKLWELD 228

 Score = 58.5 bits (140), Expect = 1e-08,   Method: Compositional matrix adjust.
 Identities = 51/226 (22%), Positives = 91/226 (40%), Gaps = 34/226 (15%)

Query: 354 KLITGSLDKTIRVWNYITGECISTYRGHSDSVLSVDSYQKVIVSGSADKTVKVWHVESRT 413
           ++ITG+L++ ++ W   TGE + T R         D      +   A+K  +  +++   
Sbjct: 36  QVITGALEE-VKCWEIKTGELLKTMR---------DGLPPGAIDTKAEKPAEATYLQ--- 82

Query: 414 CYTLRGHTEWVNCVKLHPKSFSCFSCSDDTTIRMWDIRTNSCLKVFRGHVGQVQKIIPLT 473
                           H ++F       D TI++WD++T + L VF  H      I  L 
Sbjct: 83  ---------------YHEETFILAVGYADGTIKIWDMQTQTVLIVFHSHSSA---ITILR 124

Query: 474 IKDVENLATDNTSDGSSPQDDPTMTDGADESDTPSNEQETVLDENIPYPTHLLSCGLDNT 533
                      + D +    D     G  +  +  +    +  EN  +   L+S   D  
Sbjct: 125 FDQTGTRLISGSRDATIILWDLVAETGLCKLRSHKDAITGIWCENDDW---LISVSKDGL 181

Query: 534 IKLWDVKTGKCIRTQFGHVEGVWDIAADNFRIISGSHDGSIKVWDL 579
           IKLWD+K  +C+ T   H    W +A  +  +I+ + +  IK+W+L
Sbjct: 182 IKLWDMKVHQCVETHMAHTGECWSLAVKDNMVITANAESEIKLWEL 227

 Score = 53.5 bits (127), Expect = 4e-07,   Method: Compositional matrix adjust.
 Identities = 39/171 (22%), Positives = 76/171 (44%), Gaps = 25/171 (14%)

Query: 315 LFTGSYDSTIGIWDLFTGKLIRRLSGHSDGVKTLYFDDRK-----------------LIT 357
           + TG+ +  +  W++ TG+L++ +    DG+     D +                  L  
Sbjct: 37  VITGALEE-VKCWEIKTGELLKTMR---DGLPPGAIDTKAEKPAEATYLQYHEETFILAV 92

Query: 358 GSLDKTIRVWNYITGECISTYRGHSDSV--LSVDSYQKVIVSGSADKTVKVWHVESRTCY 415
           G  D TI++W+  T   +  +  HS ++  L  D     ++SGS D T+ +W + + T  
Sbjct: 93  GYADGTIKIWDMQTQTVLIVFHSHSSAITILRFDQTGTRLISGSRDATIILWDLVAETGL 152

Query: 416 -TLRGHTEWVNCVKLHPKSFSCFSCSDDTTIRMWDIRTNSCLKVFRGHVGQ 465
             LR H + +  +      +   S S D  I++WD++ + C++    H G+
Sbjct: 153 CKLRSHKDAITGIWCENDDW-LISVSKDGLIKLWDMKVHQCVETHMAHTGE 202

 Score = 48.9 bits (115), Expect = 1e-05,   Method: Compositional matrix adjust.
 Identities = 62/284 (21%), Positives = 110/284 (38%), Gaps = 30/284 (10%)

Query: 351 DDRKLITGSLDKTIRVWNYITGECISTYRGHSDSVLSVDSYQKVIVSGSADKTVKVWHVE 410
           DD+ L T S +  ++VWN  T  CI                  +++ G+    ++++ + 
Sbjct: 396 DDKLLATAS-NGNLKVWNIKTKTCIRNLDCGYALCCKFLPGGALVILGTRAGQLQLFDLA 454

Query: 411 SRTCY--TLRGHTEWVNCVKLHPKSFSCFSCSDDTTIRMWDIRTNSCLKVFRGHVGQVQK 468
           S T        HT  +  + L        + S D T++ WD +    L       G + K
Sbjct: 455 SSTMLENIEEAHTAAIWSLDLTSDGKRLVTASADKTVKFWDFKVEQELVA-----GTLDK 509

Query: 469 IIPLTIKDVENLATDNTSD----GSSPQD--------DPTMT----DGADESDTPSNEQE 512
            +P  +K + +   D   D      SP+D        D T+     D      +    + 
Sbjct: 510 FVP-KMKLIHDTTLDLGEDLWCVKISPEDRFLAVSLLDNTVKVFFLDSMKFFLSLYGHKL 568

Query: 513 TVLDENIPYPTHLL-SCGLDNTIKLWDVKTGKCIRTQFGHVEGVWDIA--ADNFRIISGS 569
            VL  +I + + L+ +   D  IK+W +  G C ++ F H + + ++    ++    S S
Sbjct: 569 PVLSMDISHDSKLIITSSADKNIKIWGLDFGDCHKSLFAHQDSIMNVKFLPESHNFFSCS 628

Query: 570 HDGSIKVWDLQSGKCMHTFNGRRLQRETQHTQTQSLGDKVAPIA 613
            DG++K WD  S  C+    G   Q E       S G  V  ++
Sbjct: 629 KDGTVKYWDGNSFDCIQKLYGH--QGEVWALAVSSDGQAVVSVS 670

 Score = 36.2 bits (82), Expect = 0.086,   Method: Compositional matrix adjust.
 Identities = 22/82 (26%), Positives = 41/82 (50%), Gaps = 15/82 (18%)

Query: 522 PTHLLSCGLDNTIKLWDVKTGKCIRT-QFGHVEGVWDIAADN-------------FRIIS 567
           P  +++  L+  +K W++KTG+ ++T + G   G  D  A+              F +  
Sbjct: 34  PGQVITGALEE-VKCWEIKTGELLKTMRDGLPPGAIDTKAEKPAEATYLQYHEETFILAV 92

Query: 568 GSHDGSIKVWDLQSGKCMHTFN 589
           G  DG+IK+WD+Q+   +  F+
Sbjct: 93  GYADGTIKIWDMQTQTVLIVFH 114

>CAGL0E00561g 49750..52260 some similarities with sp|P16649
           Saccharomyces cerevisiae YCR084c TUP1, hypothetical
           start
          Length = 836

 Score = 75.9 bits (185), Expect = 4e-14,   Method: Compositional matrix adjust.
 Identities = 63/196 (32%), Positives = 91/196 (46%), Gaps = 28/196 (14%)

Query: 298 FKGHMDGVLTLQF--NYRLLFTGSYDSTIGIWDLFTGKLIRRLSGHSDGVKTLYF---DD 352
            KGH   + +L +  +   L +GS D T+ IWDL TG+    LS   DGV T+     D 
Sbjct: 593 LKGHEQDIYSLDYFPSGDKLVSGSGDRTVRIWDLKTGQCTLTLS-IEDGVTTVAVSPGDG 651

Query: 353 RKLITGSLDKTIRVWNYITGECISTY-------RGHSDSVLSVDSYQ--KVIVSGSADKT 403
           + +  GSLD+ +RVW+  TG  +           GH DSV SV   +    +VSGS D++
Sbjct: 652 KFIAAGSLDRAVRVWDSDTGFLVERLDSENELGTGHKDSVYSVVFTRDGNGVVSGSLDRS 711

Query: 404 VKVWHVE------------SRTC-YTLRGHTEWVNCVKLHPKSFSCFSCSDDTTIRMWDI 450
           VK+W++             S TC  T  GH ++V  V          S S D  +  WD 
Sbjct: 712 VKLWNLRNVNHNNADGKPTSGTCEVTYTGHKDFVLSVATTEDDEYILSGSKDRGVLFWDK 771

Query: 451 RTNSCLKVFRGHVGQV 466
            + + L + +GH   V
Sbjct: 772 VSGNPLLMLQGHRNSV 787

 Score = 71.6 bits (174), Expect = 1e-12,   Method: Compositional matrix adjust.
 Identities = 49/154 (31%), Positives = 77/154 (50%), Gaps = 18/154 (11%)

Query: 313 RLLFTGSYDSTIGIWDLFTGKLIRRLSGHSDGVKTL-YFDD-RKLITGSLDKTIRVWNYI 370
           + L TG+ D  I IWD+   K++  L GH   + +L YF    KL++GS D+T+R+W+  
Sbjct: 568 KFLATGAEDKLIRIWDIEQKKIVMVLKGHEQDIYSLDYFPSGDKLVSGSGDRTVRIWDLK 627

Query: 371 TGECISTYRGHSDSVLSVDSYQ---KVIVSGSADKTVKVWHVESRTCYTLR--------- 418
           TG+C  T     D V +V       K I +GS D+ V+VW  +S T + +          
Sbjct: 628 TGQCTLTL-SIEDGVTTVAVSPGDGKFIAAGSLDRAVRVW--DSDTGFLVERLDSENELG 684

Query: 419 -GHTEWVNCVKLHPKSFSCFSCSDDTTIRMWDIR 451
            GH + V  V          S S D ++++W++R
Sbjct: 685 TGHKDSVYSVVFTRDGNGVVSGSLDRSVKLWNLR 718

 Score = 60.1 bits (144), Expect = 4e-09,   Method: Compositional matrix adjust.
 Identities = 67/306 (21%), Positives = 121/306 (39%), Gaps = 82/306 (26%)

Query: 349 YFDDRKLITGSLDKTIRVWNYITGECISTY---RGHSDSVLSVDSYQ------------- 392
           + +D + +    +KT +++    GE ++ +     H+D     D+ +             
Sbjct: 499 FSNDGEFLATGCNKTTQIYRVSDGELVARFSDENAHTDKADGNDNAEAETSAGATTDLYI 558

Query: 393 ---------KVIVSGSADKTVKVWHVESRT-CYTLRGHTEWVNCVKLHPKSFSCFSCSDD 442
                    K + +G+ DK +++W +E +     L+GH + +  +   P      S S D
Sbjct: 559 RSVCFSPDGKFLATGAEDKLIRIWDIEQKKIVMVLKGHEQDIYSLDYFPSGDKLVSGSGD 618

Query: 443 TTIRMWDIRTNSCLKVFRGHVGQVQKIIPLTIKDVENLATDNTSDGSSPQDDPTMTDGAD 502
            T+R+WD++T  C              + L+I+D        T+   SP D   +  G+ 
Sbjct: 619 RTVRIWDLKTGQC-------------TLTLSIED------GVTTVAVSPGDGKFIAAGSL 659

Query: 503 -------ESDT--------PSNEQETVLDENIPYPT-------HLLSCGLDNTIKLWDVK 540
                  +SDT          NE  T   +++ Y          ++S  LD ++KLW+++
Sbjct: 660 DRAVRVWDSDTGFLVERLDSENELGTGHKDSV-YSVVFTRDGNGVVSGSLDRSVKLWNLR 718

Query: 541 ------------TGKCIRTQFGHVEGVWDIAA--DNFRIISGSHDGSIKVWDLQSGKCMH 586
                       +G C  T  GH + V  +A   D+  I+SGS D  +  WD  SG  + 
Sbjct: 719 NVNHNNADGKPTSGTCEVTYTGHKDFVLSVATTEDDEYILSGSKDRGVLFWDKVSGNPLL 778

Query: 587 TFNGRR 592
              G R
Sbjct: 779 MLQGHR 784

 Score = 46.2 bits (108), Expect = 8e-05,   Method: Compositional matrix adjust.
 Identities = 33/133 (24%), Positives = 63/133 (47%), Gaps = 26/133 (19%)

Query: 300 GHMDGVLTLQF--NYRLLFTGSYDSTIGIWDL------------FTGKLIRRLSGHSDGV 345
           GH D V ++ F  +   + +GS D ++ +W+L             +G      +GH D V
Sbjct: 686 GHKDSVYSVVFTRDGNGVVSGSLDRSVKLWNLRNVNHNNADGKPTSGTCEVTYTGHKDFV 745

Query: 346 KTLYF--DDRKLITGSLDKTIRVWNYITGECISTYRGHSDSVLSV---------DSYQKV 394
            ++    DD  +++GS D+ +  W+ ++G  +   +GH +SV+SV          +Y  +
Sbjct: 746 LSVATTEDDEYILSGSKDRGVLFWDKVSGNPLLMLQGHRNSVISVAVNHGHPLGPNYH-I 804

Query: 395 IVSGSADKTVKVW 407
             +GS D   ++W
Sbjct: 805 FATGSGDCKARIW 817

 Score = 38.5 bits (88), Expect = 0.019,   Method: Compositional matrix adjust.
 Identities = 25/90 (27%), Positives = 39/90 (43%), Gaps = 11/90 (12%)

Query: 291 GHCRIQEFKGHMDGVLTLQFNY--RLLFTGSYDSTIGIWDLFTGKLIRRLSGHSDGVKTL 348
           G C +  + GH D VL++        + +GS D  +  WD  +G  +  L GH + V ++
Sbjct: 732 GTCEV-TYTGHKDFVLSVATTEDDEYILSGSKDRGVLFWDKVSGNPLLMLQGHRNSVISV 790

Query: 349 YFDDRK--------LITGSLDKTIRVWNYI 370
             +             TGS D   R+W YI
Sbjct: 791 AVNHGHPLGPNYHIFATGSGDCKARIWKYI 820

>Kwal_23.6429
          Length = 750

 Score = 75.9 bits (185), Expect = 4e-14,   Method: Compositional matrix adjust.
 Identities = 63/197 (31%), Positives = 92/197 (46%), Gaps = 32/197 (16%)

Query: 295 IQEFKGHMDGVLTLQF--NYRLLFTGSYDSTIGIWDLFTGKLIRRLSGHSDGVKTLYFD- 351
           +   +GH   + +L +  +   L +GS D T+ IWDL TG+    LS   DGV T+    
Sbjct: 505 VMTLQGHEQDIYSLDYFPSGDKLVSGSGDRTVRIWDLRTGQCSLTLS-IEDGVTTVAVSP 563

Query: 352 -DRKLIT-GSLDKTIRVWNYITGECISTY-------RGHSDSVLSV----DSYQKVIVSG 398
            D KLI  GSLD+T+R+W+  TG  +           GH DSV SV    D +   +VSG
Sbjct: 564 GDGKLIAAGSLDRTVRIWDSETGFLVERLDSENELGTGHKDSVYSVVFTRDGHG--VVSG 621

Query: 399 SADKTVKVWHVESRTC-------------YTLRGHTEWVNCVKLHPKSFSCFSCSDDTTI 445
           S D++VK+W++ S                 T  GH ++V  V          S S D  +
Sbjct: 622 SLDRSVKLWNLRSANGGTAEGKANTAASEVTYTGHKDFVLSVATTQNDEFILSGSKDRGV 681

Query: 446 RMWDIRTNSCLKVFRGH 462
             WD  + + L + +GH
Sbjct: 682 LFWDTPSGNPLLMLQGH 698

 Score = 70.9 bits (172), Expect = 2e-12,   Method: Compositional matrix adjust.
 Identities = 65/261 (24%), Positives = 104/261 (39%), Gaps = 61/261 (23%)

Query: 351 DDRKLITGSLDKTIRVWNYITGECISTYRGHSDSVLSVDSYQK--VIVSGSADKTVKVWH 408
           D + L TG+ DK IR+W+  T   + T +GH   + S+D +     +VSGS D+TV++W 
Sbjct: 481 DGKFLATGAEDKLIRIWDLATRRIVMTLQGHEQDIYSLDYFPSGDKLVSGSGDRTVRIWD 540

Query: 409 VESRTCYTLRGHTEWVNCVKLHPKSFSCFSC-SDDTTIRMWDIRTNSCLKVFRGHVGQVQ 467
           + +  C       + V  V + P      +  S D T+R+WD  T               
Sbjct: 541 LRTGQCSLTLSIEDGVTTVAVSPGDGKLIAAGSLDRTVRIWDSETGFL------------ 588

Query: 468 KIIPLTIKDVENLATDNTSDGSSPQDDPTMTDGADESDTPSNEQETVLDENIPYPTH-LL 526
                    VE L ++N                    +  +  +++V         H ++
Sbjct: 589 ---------VERLDSEN--------------------ELGTGHKDSVYSVVFTRDGHGVV 619

Query: 527 SCGLDNTIKLWDVK------------TGKCIRTQFGHVEGVWDIAA---DNFRIISGSHD 571
           S  LD ++KLW+++            T     T  GH + V  +A    D F I+SGS D
Sbjct: 620 SGSLDRSVKLWNLRSANGGTAEGKANTAASEVTYTGHKDFVLSVATTQNDEF-ILSGSKD 678

Query: 572 GSIKVWDLQSGKCMHTFNGRR 592
             +  WD  SG  +    G R
Sbjct: 679 RGVLFWDTPSGNPLLMLQGHR 699

 Score = 66.2 bits (160), Expect = 4e-11,   Method: Compositional matrix adjust.
 Identities = 69/296 (23%), Positives = 118/296 (39%), Gaps = 73/296 (24%)

Query: 301 HMDGVLTLQFNY--RLLFTGSYDSTIGIWDLFTGKLIRRLSGHSDGVKTLYFDDRKLITG 358
           H   V  ++F++    L TG  + T  ++ + TG+LI RLS           +D      
Sbjct: 399 HSSVVCCVRFSHDGEFLATGC-NKTTQVYKVSTGELIARLS-----------EDASSAPS 446

Query: 359 SLDKTIRVWNYITGECISTYRGHSDSVLSV--DSYQKVIVSGSADKTVKVWHVESR-TCY 415
             D +    N      ++T       + SV      K + +G+ DK +++W + +R    
Sbjct: 447 GADASATSENAKASPAVATSASSDLYIRSVCFSPDGKFLATGAEDKLIRIWDLATRRIVM 506

Query: 416 TLRGHTEWVNCVKLHPKSFSCFSCSDDTTIRMWDIRTNSCLKVFRGHVGQVQKIIPLTIK 475
           TL+GH + +  +   P      S S D T+R+WD+RT  C              + L+I+
Sbjct: 507 TLQGHEQDIYSLDYFPSGDKLVSGSGDRTVRIWDLRTGQC-------------SLTLSIE 553

Query: 476 DVENLATDNTSDGSSPQDDPTMTDGADESDTPSNEQETVLDENIPYPTHLLSCGLDNTIK 535
           D        T+   SP D   +  G+                            LD T++
Sbjct: 554 D------GVTTVAVSPGDGKLIAAGS----------------------------LDRTVR 579

Query: 536 LWDVKTGKCI-------RTQFGHVEGVWDIA--ADNFRIISGSHDGSIKVWDLQSG 582
           +WD +TG  +           GH + V+ +    D   ++SGS D S+K+W+L+S 
Sbjct: 580 IWDSETGFLVERLDSENELGTGHKDSVYSVVFTRDGHGVVSGSLDRSVKLWNLRSA 635

 Score = 42.4 bits (98), Expect = 0.001,   Method: Compositional matrix adjust.
 Identities = 35/139 (25%), Positives = 63/139 (45%), Gaps = 24/139 (17%)

Query: 300 GHMDGVLTLQF--NYRLLFTGSYDSTIGIWDLFT-------GKLIRRLS-----GHSDGV 345
           GH D V ++ F  +   + +GS D ++ +W+L +       GK     S     GH D V
Sbjct: 601 GHKDSVYSVVFTRDGHGVVSGSLDRSVKLWNLRSANGGTAEGKANTAASEVTYTGHKDFV 660

Query: 346 KTLYF--DDRKLITGSLDKTIRVWNYITGECISTYRGHSDSVLSVDSYQ--------KVI 395
            ++    +D  +++GS D+ +  W+  +G  +   +GH +SV+SV             V 
Sbjct: 661 LSVATTQNDEFILSGSKDRGVLFWDTPSGNPLLMLQGHRNSVISVAVANDHPLGPEYGVF 720

Query: 396 VSGSADKTVKVWHVESRTC 414
            +GS D   ++W    +T 
Sbjct: 721 ATGSGDCKARIWKYSKQTS 739

>Kwal_33.15591
          Length = 714

 Score = 74.7 bits (182), Expect = 1e-13,   Method: Compositional matrix adjust.
 Identities = 73/253 (28%), Positives = 112/253 (44%), Gaps = 45/253 (17%)

Query: 300 GHMDGVLTLQFNYRLLFTGSYDSTIGIWDLFTGKLIRRLSGHSDGVKTLYFDDRKL---- 355
           GH + V  L  +   + +GS+D+T  +W  F G L   L GH+  V    +D + L    
Sbjct: 103 GHENNVCVLNSSQGYVLSGSWDTTAKVW--FQGALKHELKGHTASV----WDVKMLPEVG 156

Query: 356 --ITGSLDKTIRVWNYITGE-CISTYRG-HSDSV--LSVDSYQKVIVSGSADKTVKVWHV 409
             +T S D TI++W    GE  + T+ G H+D +  + +D+  +   S S D TVK+  +
Sbjct: 157 FYMTASADGTIKLWE---GEKVLKTFTGLHTDVIRHIDIDASGEKFASCSNDGTVKINDM 213

Query: 410 ESRTCYTLRGHTEWVNCVKLHPKSFSCFSCSDDTTIRMWDIRTNSCLKVFRGHVGQVQKI 469
           E +T  TL GH  +V  VK  P      SC +D T+R+W            G V QV ++
Sbjct: 214 EGKTLKTLVGHESFVYSVKFAPNG-DVISCGEDRTVRIWKA---------DGTVKQVIRV 263

Query: 470 IPLTIKDVENLATDNTSDGSS---------------PQDDPTMTDGADESDTPSNEQETV 514
             ++  D++ L   +   G S               PQ +  +     E DT  N Q   
Sbjct: 264 PAVSTWDLDILPNGDILIGCSDSFARIFTCDEKRVAPQKEQELLAKMIE-DTAINSQAMG 322

Query: 515 LDENIPYPTHLLS 527
            DE+   P  +LS
Sbjct: 323 FDESKLSPKEILS 335

 Score = 51.6 bits (122), Expect = 2e-06,   Method: Compositional matrix adjust.
 Identities = 39/128 (30%), Positives = 62/128 (48%), Gaps = 7/128 (5%)

Query: 338 LSGHSDGVKTLYFDDRKLITGSLDKTIRVWNYITGECISTYRGHSDSVLSVDSYQKV--I 395
           L GH + V  L      +++GS D T +VW    G      +GH+ SV  V    +V   
Sbjct: 101 LIGHENNVCVLNSSQGYVLSGSWDTTAKVW--FQGALKHELKGHTASVWDVKMLPEVGFY 158

Query: 396 VSGSADKTVKVWHVESRTCYTLRG-HTEWVNCVKLHPKSFSCFSCSDDTTIRMWDIRTNS 454
           ++ SAD T+K+W  E +   T  G HT+ +  + +        SCS+D T+++ D+   +
Sbjct: 159 MTASADGTIKLWEGE-KVLKTFTGLHTDVIRHIDIDASGEKFASCSNDGTVKINDMEGKT 217

Query: 455 CLKVFRGH 462
            LK   GH
Sbjct: 218 -LKTLVGH 224

 Score = 50.1 bits (118), Expect = 4e-06,   Method: Compositional matrix adjust.
 Identities = 45/158 (28%), Positives = 73/158 (46%), Gaps = 9/158 (5%)

Query: 380 GHSDSVLSVDSYQKVIVSGSADKTVKVWHVESRTCYTLRGHTEWVNCVKLHPKSFSCFSC 439
           GH ++V  ++S Q  ++SGS D T KVW  +    + L+GHT  V  VK+ P+     + 
Sbjct: 103 GHENNVCVLNSSQGYVLSGSWDTTAKVWF-QGALKHELKGHTASVWDVKMLPEVGFYMTA 161

Query: 440 SDDTTIRMWDIRTNSCLKVFRGHVGQVQKIIPLTIKDVENLATDNTSDGSSPQDDPTMTD 499
           S D TI++W+      LK F G    V + I +     E  A+  ++DG+   +D     
Sbjct: 162 SADGTIKLWE--GEKVLKTFTGLHTDVIRHIDIDASG-EKFAS-CSNDGTVKINDME--- 214

Query: 500 GADESDTPSNEQETVLDENIPYPTHLLSCGLDNTIKLW 537
                 T    +  V          ++SCG D T+++W
Sbjct: 215 -GKTLKTLVGHESFVYSVKFAPNGDVISCGEDRTVRIW 251

 Score = 35.8 bits (81), Expect = 0.12,   Method: Compositional matrix adjust.
 Identities = 57/230 (24%), Positives = 96/230 (41%), Gaps = 27/230 (11%)

Query: 376 STYRGHSDSVLSVDSYQK-VIVSGSADKTVKVWHVESRTCYTLRGHTE-WVNCVKLHPKS 433
           +T  GH   V SV       + + S D +V++W          +GH   W + V      
Sbjct: 10  ATLSGHEQDVKSVAVLNNDTVATCSRDGSVRLWK---------KGHNNLWQDAVVYQSDE 60

Query: 434 FSCFSCSDDTTIRMWDIRTN---SCLKVFRGHVGQVQKIIPLTIKDVENLATDNTSDGS- 489
           F    C D+T+  ++    N   + +    G VGQ  + +   I    N+   N+S G  
Sbjct: 61  FVNSLCYDNTSGLLFCGGQNCLINSVSPLLGDVGQDSEFV--LIGHENNVCVLNSSQGYV 118

Query: 490 -SPQDDPTMT---DGADESDTPSNEQETVLDENIPYPTHLLSCGLDNTIKLWDVKTGKCI 545
            S   D T      GA + +   +       + +P     ++   D TIKLW+ +  K +
Sbjct: 119 LSGSWDTTAKVWFQGALKHELKGHTASVWDVKMLPEVGFYMTASADGTIKLWEGE--KVL 176

Query: 546 RTQFG-HVEGV--WDIAADNFRIISGSHDGSIKVWDLQSGKCMHTFNGRR 592
           +T  G H + +   DI A   +  S S+DG++K+ D++ GK + T  G  
Sbjct: 177 KTFTGLHTDVIRHIDIDASGEKFASCSNDGTVKINDME-GKTLKTLVGHE 225

>Scas_558.3
          Length = 725

 Score = 74.7 bits (182), Expect = 1e-13,   Method: Compositional matrix adjust.
 Identities = 51/165 (30%), Positives = 82/165 (49%), Gaps = 11/165 (6%)

Query: 300 GHMDGVLTLQFNY-RLLFTGSYDSTIGIWDLFTGKLIRRLSGHSDGV---KTLYFDDRKL 355
           GH   V  L + +   + +GS+D+T  +W    G L   L GH   V   K +  ++   
Sbjct: 100 GHHSNVCALSYKHMSAIISGSWDTTAKVW--INGALQWSLEGHQASVWDAKIISVEENTF 157

Query: 356 ITGSLDKTIRVWNYITGECISTYRG-HSDSV--LSVDSYQKVIVSGSADKTVKVWHVESR 412
           IT S D+T+++W     + + T+ G HSD +  + V S  K I + S D T+K+  ++  
Sbjct: 158 ITASADRTVKLWK--ENKLLKTFSGIHSDVIRNIEVLSSGKEIATCSNDGTIKISDLDGN 215

Query: 413 TCYTLRGHTEWVNCVKLHPKSFSCFSCSDDTTIRMWDIRTNSCLK 457
               L GH  +V  VKL  +     SC +D ++R+WDI  N  +K
Sbjct: 216 IKQVLSGHESFVYNVKLSKQGDKLVSCGEDRSLRIWDINNNFNIK 260

 Score = 51.6 bits (122), Expect = 1e-06,   Method: Compositional matrix adjust.
 Identities = 49/164 (29%), Positives = 79/164 (48%), Gaps = 18/164 (10%)

Query: 311 NYRLLFTGSYDSTIGIWDLFTGKLIRR-----LSGHSDGVKTL-YFDDRKLITGSLDKTI 364
           ++ LLF    +S I    L   + I +     L GH   V  L Y     +I+GS D T 
Sbjct: 66  DHELLFYSGQESLINGVSLLDIESIDKDPLYTLIGHHSNVCALSYKHMSAIISGSWDTTA 125

Query: 365 RVWNYITGECISTYRGHSDSV-----LSVDSYQKVIVSGSADKTVKVWHVESRTCYTLRG 419
           +VW  I G    +  GH  SV     +SV+  +   ++ SAD+TVK+W  E++   T  G
Sbjct: 126 KVW--INGALQWSLEGHQASVWDAKIISVE--ENTFITASADRTVKLWK-ENKLLKTFSG 180

Query: 420 -HTEWVNCVKLHPKSFSCFSCSDDTTIRMWDIRTNSCLKVFRGH 462
            H++ +  +++        +CS+D TI++ D+  N   +V  GH
Sbjct: 181 IHSDVIRNIEVLSSGKEIATCSNDGTIKISDLDGN-IKQVLSGH 223

 Score = 40.4 bits (93), Expect = 0.004,   Method: Compositional matrix adjust.
 Identities = 62/271 (22%), Positives = 105/271 (38%), Gaps = 70/271 (25%)

Query: 333 KLIRRLSGHSDGVK-TLYFDDRKLITGSLDKTIRVW-----------------NYITGEC 374
           +L   L GH+  VK  +  DD ++ + S D T+R+W                  ++   C
Sbjct: 3   QLSATLLGHTQDVKDIVVIDDSQVASVSRDGTLRLWKHNDNGTWQDIVMATSEKFLNAVC 62

Query: 375 ------ISTYRGHSD-----SVLSVDSYQK----------------------VIVSGSAD 401
                 +  Y G        S+L ++S  K                       I+SGS D
Sbjct: 63  YDKDHELLFYSGQESLINGVSLLDIESIDKDPLYTLIGHHSNVCALSYKHMSAIISGSWD 122

Query: 402 KTVKVWHVESRTCYTLRGHTEWVNCVKLHPKSFSCF-SCSDDTTIRMWDIRTNSCLKVFR 460
            T KVW +     ++L GH   V   K+     + F + S D T+++W  + N  LK F 
Sbjct: 123 TTAKVW-INGALQWSLEGHQASVWDAKIISVEENTFITASADRTVKLW--KENKLLKTFS 179

Query: 461 GHVGQVQKIIPLTIKDVENLATDN-----TSDGSSPQDDPTMTDGADESDTPSNEQETVL 515
           G    V       I+++E L++       ++DG+    D    DG  +     +E     
Sbjct: 180 GIHSDV-------IRNIEVLSSGKEIATCSNDGTIKISD---LDGNIKQVLSGHESFVYN 229

Query: 516 DENIPYPTHLLSCGLDNTIKLWDVKTGKCIR 546
            +       L+SCG D ++++WD+     I+
Sbjct: 230 VKLSKQGDKLVSCGEDRSLRIWDINNNFNIK 260

>YLR129W (DIP2) [3539] chr12 (399658..402489) Component of U3 snoRNP
           (renamed small subunit processome - SSU processome),
           which is required for 18S rRNA biogenesis [2832 bp, 943
           aa]
          Length = 943

 Score = 74.7 bits (182), Expect = 1e-13,   Method: Compositional matrix adjust.
 Identities = 57/182 (31%), Positives = 87/182 (47%), Gaps = 21/182 (11%)

Query: 306 LTLQFNYRLLFTGSYDSTIGIWD------LFTG---KLIRRLSGHSDGVKTLY------- 349
           L L  + + L TGS D T+  WD      L  G   K +  L  H D    L        
Sbjct: 479 LDLTSDGKRLVTGSADKTVKFWDFKVENSLVPGTKNKFLPVLKLHHDTTLELTDDILCVR 538

Query: 350 --FDDRKLITGSLDKTIRVWNYITGECISTYRGHSDSVLSVD-SY-QKVIVSGSADKTVK 405
              DDR L    LD T++V+   + +   +  GH   VLS+D S+  K+I++ SADK +K
Sbjct: 539 VSPDDRYLAISLLDNTVKVFFLDSMKFYLSLYGHKLPVLSIDISFDSKMIITSSADKNIK 598

Query: 406 VWHVESRTCY-TLRGHTEWVNCVKLHPKSFSCFSCSDDTTIRMWDIRTNSCLKVFRGHVG 464
           +W ++   C+ +L  H + +  VK  P+S + FSCS D  ++ WD     C++    H  
Sbjct: 599 IWGLDFGDCHKSLFAHQDSIMNVKFLPQSHNFFSCSKDAVVKYWDGEKFECIQKLYAHQS 658

Query: 465 QV 466
           +V
Sbjct: 659 EV 660

 Score = 66.2 bits (160), Expect = 5e-11,   Method: Compositional matrix adjust.
 Identities = 60/289 (20%), Positives = 108/289 (37%), Gaps = 71/289 (24%)

Query: 314 LLFTGSYDSTIGIWDLFTGKLIRRLSGHSDGV---KTLYFDDRKLITGSLDKTIRVWNY- 369
           L+  G+ +  + ++DL +  L+  +    D       L  D ++L+TGS DKT++ W++ 
Sbjct: 444 LVILGTRNGELQLFDLASSSLLDTIEDAHDAAIWSLDLTSDGKRLVTGSADKTVKFWDFK 503

Query: 370 --------ITGECISTYRGHSDSVLS---------VDSYQKVIVSGSADKTVKVWHVESR 412
                      + +   + H D+ L          V    + +     D TVKV+ ++S 
Sbjct: 504 VENSLVPGTKNKFLPVLKLHHDTTLELTDDILCVRVSPDDRYLAISLLDNTVKVFFLDSM 563

Query: 413 TCY-TLRGHTEWVNCVKLHPKSFSCFSCSDDTTIRMWDIRTNSCLKVFRGHVGQVQKIIP 471
             Y +L GH   V  + +   S    + S D  I++W +    C K    H   +  +  
Sbjct: 564 KFYLSLYGHKLPVLSIDISFDSKMIITSSADKNIKIWGLDFGDCHKSLFAHQDSIMNV-- 621

Query: 472 LTIKDVENLATDNTSDGSSPQDDPTMTDGADESDTPSNEQETVLDENIPYPTHLLSCGLD 531
                                                        + +P   +  SC  D
Sbjct: 622 ---------------------------------------------KFLPQSHNFFSCSKD 636

Query: 532 NTIKLWDVKTGKCIRTQFGHVEGVW--DIAADNFRIISGSHDGSIKVWD 578
             +K WD +  +CI+  + H   VW   +A D   ++S SHD SI++W+
Sbjct: 637 AVVKYWDGEKFECIQKLYAHQSEVWALAVATDGGFVVSSSHDHSIRIWE 685

 Score = 65.1 bits (157), Expect = 1e-10,   Method: Compositional matrix adjust.
 Identities = 43/159 (27%), Positives = 73/159 (45%), Gaps = 18/159 (11%)

Query: 324 IGIWDLFTGKLIRRLS-----GHSDG-----VKTLYFDDRK----LITGSLDKTIRVWNY 369
           + IWD+ TG L+ +LS     G SD       +  Y +  K    L  G  D  I+VW+ 
Sbjct: 49  VNIWDIKTGDLVSKLSDGLPPGASDARGAKPAECTYLEAHKDTDLLAVGYADGVIKVWDL 108

Query: 370 ITGECISTYRGHSDSV--LSVDSYQKVIVSGSADKTVKVWHVESRT-CYTLRGHTEWVNC 426
           ++   +  + GH  ++  L  D     ++SGS D  + VW +      Y LR H + +  
Sbjct: 109 MSKTVLLNFNGHKAAITLLQFDGTGTRLISGSKDSNIIVWDLVGEVGLYKLRSHKDSITG 168

Query: 427 VKLHPKSFSCFSCSDDTTIRMWDIRTNSCLKVFRGHVGQ 465
                + +   S S D  I++WD++T+ C++    H G+
Sbjct: 169 FWCQGEDW-LISTSKDGMIKLWDLKTHQCIETHIAHTGE 206

 Score = 57.8 bits (138), Expect = 2e-08,   Method: Compositional matrix adjust.
 Identities = 39/141 (27%), Positives = 65/141 (46%), Gaps = 6/141 (4%)

Query: 314 LLFTGSYDSTIGIWDLFTGKLIRRLSGHSDGVKTLYFD--DRKLITGSLDKTIRVWNYIT 371
           LL  G  D  I +WDL +  ++   +GH   +  L FD    +LI+GS D  I VW+ + 
Sbjct: 93  LLAVGYADGVIKVWDLMSKTVLLNFNGHKAAITLLQFDGTGTRLISGSKDSNIIVWDLVG 152

Query: 372 GECISTYRGHSDSVLSV-DSYQKVIVSGSADKTVKVWHVESRTCY-TLRGHTEWVNCVKL 429
              +   R H DS+       +  ++S S D  +K+W +++  C  T   HT    C  L
Sbjct: 153 EVGLYKLRSHKDSITGFWCQGEDWLISTSKDGMIKLWDLKTHQCIETHIAHTG--ECWGL 210

Query: 430 HPKSFSCFSCSDDTTIRMWDI 450
             K     +   D+ +++W +
Sbjct: 211 AVKDDLLITTGTDSQVKIWKL 231

 Score = 56.2 bits (134), Expect = 6e-08,   Method: Compositional matrix adjust.
 Identities = 42/142 (29%), Positives = 64/142 (45%), Gaps = 5/142 (3%)

Query: 313 RLLFTGSYDSTIGIWDLFTGKLIRRLSGHSDGVKTL--YFDDRKLITGSLDKTIRVWNYI 370
           R L     D+T+ ++ L + K    L GH   V ++   FD + +IT S DK I++W   
Sbjct: 544 RYLAISLLDNTVKVFFLDSMKFYLSLYGHKLPVLSIDISFDSKMIITSSADKNIKIWGLD 603

Query: 371 TGECISTYRGHSDSVLSVDSYQKV--IVSGSADKTVKVWHVESRTCY-TLRGHTEWVNCV 427
            G+C  +   H DS+++V    +     S S D  VK W  E   C   L  H   V  +
Sbjct: 604 FGDCHKSLFAHQDSIMNVKFLPQSHNFFSCSKDAVVKYWDGEKFECIQKLYAHQSEVWAL 663

Query: 428 KLHPKSFSCFSCSDDTTIRMWD 449
            +        S S D +IR+W+
Sbjct: 664 AVATDGGFVVSSSHDHSIRIWE 685

 Score = 55.5 bits (132), Expect = 9e-08,   Method: Compositional matrix adjust.
 Identities = 33/116 (28%), Positives = 56/116 (48%), Gaps = 3/116 (2%)

Query: 298 FKGHMDGVLTLQFNYR--LLFTGSYDSTIGIWDLFTGKLIRRLSGHSDGVKTLYFDDRK- 354
           F GH   +  LQF+     L +GS DS I +WDL     + +L  H D +   +      
Sbjct: 117 FNGHKAAITLLQFDGTGTRLISGSKDSNIIVWDLVGEVGLYKLRSHKDSITGFWCQGEDW 176

Query: 355 LITGSLDKTIRVWNYITGECISTYRGHSDSVLSVDSYQKVIVSGSADKTVKVWHVE 410
           LI+ S D  I++W+  T +CI T+  H+     +     ++++   D  VK+W ++
Sbjct: 177 LISTSKDGMIKLWDLKTHQCIETHIAHTGECWGLAVKDDLLITTGTDSQVKIWKLD 232

 Score = 47.4 bits (111), Expect = 3e-05,   Method: Compositional matrix adjust.
 Identities = 21/55 (38%), Positives = 30/55 (54%)

Query: 525 LLSCGLDNTIKLWDVKTGKCIRTQFGHVEGVWDIAADNFRIISGSHDGSIKVWDL 579
           L+S   D  IKLWD+KT +CI T   H    W +A  +  +I+   D  +K+W L
Sbjct: 177 LISTSKDGMIKLWDLKTHQCIETHIAHTGECWGLAVKDDLLITTGTDSQVKIWKL 231

 Score = 46.2 bits (108), Expect = 7e-05,   Method: Compositional matrix adjust.
 Identities = 57/239 (23%), Positives = 105/239 (43%), Gaps = 37/239 (15%)

Query: 351 DDRKLITGSLDKTIRVWNYITGECISTYR-GHSDSVLSVDSYQKVIVSGSADKTVKVWHV 409
           DD KL+  + + ++++WN  T +CI T+  G++ +   +     VI+ G+ +  ++++ +
Sbjct: 401 DDNKLLATASNGSLKIWNIKTHKCIRTFECGYALTCKFLPGGLLVIL-GTRNGELQLFDL 459

Query: 410 ESRTCY-TLR-GHTEWVNCVKLHPKSFSCFSCSDDTTIRMWDIRTNSCLKVFRGHVGQVQ 467
            S +   T+   H   +  + L        + S D T++ WD +  + L       G   
Sbjct: 460 ASSSLLDTIEDAHDAAIWSLDLTSDGKRLVTGSADKTVKFWDFKVENSLVP-----GTKN 514

Query: 468 KIIPLTIKDVENLATDNTSDGSSPQDDPTMTDGADESDTPSNEQETVLDENIPYPTHLLS 527
           K +P     V  L  D T +         +TD            + +     P   +L  
Sbjct: 515 KFLP-----VLKLHHDTTLE---------LTD------------DILCVRVSPDDRYLAI 548

Query: 528 CGLDNTIKLWDVKTGKCIRTQFGHVEGVW--DIAADNFRIISGSHDGSIKVWDLQSGKC 584
             LDNT+K++ + + K   + +GH   V   DI+ D+  II+ S D +IK+W L  G C
Sbjct: 549 SLLDNTVKVFFLDSMKFYLSLYGHKLPVLSIDISFDSKMIITSSADKNIKIWGLDFGDC 607

 Score = 37.4 bits (85), Expect = 0.044,   Method: Compositional matrix adjust.
 Identities = 24/69 (34%), Positives = 38/69 (55%), Gaps = 7/69 (10%)

Query: 523 THLLSCGLDNTIKLWDVKTGKC----IRTQFGHVEGVWDIAADNFRIISGSHDGSIKVWD 578
           T L+S   D+ I +WD+  G+     +R+    + G W    D   +IS S DG IK+WD
Sbjct: 134 TRLISGSKDSNIIVWDL-VGEVGLYKLRSHKDSITGFWCQGED--WLISTSKDGMIKLWD 190

Query: 579 LQSGKCMHT 587
           L++ +C+ T
Sbjct: 191 LKTHQCIET 199

 Score = 37.0 bits (84), Expect = 0.049,   Method: Compositional matrix adjust.
 Identities = 25/85 (29%), Positives = 37/85 (43%), Gaps = 15/85 (17%)

Query: 522 PTHLLSCGLDNTIKLWDVKTGKCI-RTQFGHVEGVWDIAA-------------DNFRIIS 567
           P  L++  L++ + +WD+KTG  + +   G   G  D                D   +  
Sbjct: 38  PGQLITSALED-VNIWDIKTGDLVSKLSDGLPPGASDARGAKPAECTYLEAHKDTDLLAV 96

Query: 568 GSHDGSIKVWDLQSGKCMHTFNGRR 592
           G  DG IKVWDL S   +  FNG +
Sbjct: 97  GYADGVIKVWDLMSKTVLLNFNGHK 121

 Score = 33.1 bits (74), Expect = 0.86,   Method: Compositional matrix adjust.
 Identities = 12/32 (37%), Positives = 26/32 (81%), Gaps = 1/32 (3%)

Query: 557 DIAADNFRIISGSHDGSIKVWDLQSGKCMHTF 588
           DI+ DN ++++ + +GS+K+W++++ KC+ TF
Sbjct: 398 DISDDN-KLLATASNGSLKIWNIKTHKCIRTF 428

>AER448W [2948] [Homologous to ScYKL213C (DOA1) - SH]
           complement(1497416..1499560) [2145 bp, 714 aa]
          Length = 714

 Score = 74.3 bits (181), Expect = 1e-13,   Method: Compositional matrix adjust.
 Identities = 61/198 (30%), Positives = 92/198 (46%), Gaps = 21/198 (10%)

Query: 298 FKGHMDGVLTLQFNYRLLFTGSYDSTIGIWDLFTGKLIRRLSGHSDGV-KTLYFDDRKLI 356
             GH   V  L+     L + S+D T  +W    G   R LSGH+  V   L     + +
Sbjct: 104 LAGHSGNVCALEARDGQLVSSSWDQTARVWR--EGTEERALSGHNATVWHALALGYDRFL 161

Query: 357 TGSLDKTIRVWNYITGECISTYRGHSDSV----LSVDSYQKVIVSGSADKTVKVWHVESR 412
           T S DKTI++W+      ++TY  H+D V    L+ D +     S S D +VKV  ++ +
Sbjct: 162 TASADKTIKLWD--GARDLATYNVHTDVVRHLALAPDGHH--FASCSNDGSVKVHTLDGK 217

Query: 413 TCYTLRGHTEWVNCVKLHPKSFSCFSCSDDTTIRMWDIRTNSCLKVFRGHVGQVQKIIPL 472
           T  T  GH  +V CVK  P      SC +D T+R+WD+          GHV QV ++   
Sbjct: 218 TVRTFDGHESFVYCVKYLPDG-GLVSCGEDKTVRVWDM---------SGHVRQVIRLCAT 267

Query: 473 TIKDVENLATDNTSDGSS 490
           ++  ++ L   +   G S
Sbjct: 268 SLWSLDVLPNGDIVVGGS 285

 Score = 57.4 bits (137), Expect = 2e-08,   Method: Compositional matrix adjust.
 Identities = 75/309 (24%), Positives = 116/309 (37%), Gaps = 86/309 (27%)

Query: 311 NYRLLFTGSYDSTIGIWD---LFTGKLIRRLSGHSDGVKTLYFDDRKLITGSLDKTIRVW 367
           N +L+F G  ++ IG      L        L+GHS  V  L   D +L++ S D+T RVW
Sbjct: 74  NEQLVFFGGQEAVIGAVSPLVLEVQDASYLLAGHSGNVCALEARDGQLVSSSWDQTARVW 133

Query: 368 NYITGECISTYRGHSDSV-----LSVDSYQKVIVSGSADKTVKVWHVESRTCYTLRGHTE 422
              T E      GH+ +V     L  D +    ++ SADKT+K+W   +R   T   HT+
Sbjct: 134 REGTEE--RALSGHNATVWHALALGYDRF----LTASADKTIKLWD-GARDLATYNVHTD 186

Query: 423 WVNCVKLHPKSFSCFSCSDDTTIRMWDIRTNSCLKVFRGHVGQVQ--KIIPLTIKDVENL 480
            V  + L P      SCS+D ++++  +     ++ F GH   V   K +P         
Sbjct: 187 VVRHLALAPDGHHFASCSNDGSVKVHTL-DGKTVRTFDGHESFVYCVKYLP--------- 236

Query: 481 ATDNTSDGSSPQDDPTMTDGADESDTPSNEQETVLDENIPYPTHLLSCGLDNTIKLWDVK 540
                             DG                        L+SCG D T+++WD+ 
Sbjct: 237 ------------------DGG-----------------------LVSCGEDKTVRVWDMS 255

Query: 541 TGKCIRTQFGHVEGVWDIAA---------DNFRIISGSHDGSIKVWDLQSGKCMHTFNGR 591
                    GHV  V  + A          N  I+ G  DG I ++ +   +        
Sbjct: 256 ---------GHVRQVIRLCATSLWSLDVLPNGDIVVGGSDGKILIFTVDPARVAPVEELE 306

Query: 592 RLQRETQHT 600
           +L+     T
Sbjct: 307 QLREAVAST 315

>Kwal_26.8975
          Length = 445

 Score = 73.2 bits (178), Expect = 2e-13,   Method: Compositional matrix adjust.
 Identities = 78/304 (25%), Positives = 131/304 (43%), Gaps = 48/304 (15%)

Query: 315 LFTGSYDSTIGIWDLFTGKLIRRLSGHSDGVKTL-YFDDRKLITGSLDKTIRVW------ 367
           + +GSYD  +  W+L +GK+ ++ +GHS  V+ + Y    +L++G+ D+T+R+W      
Sbjct: 115 IVSGSYDGIVRTWNL-SGKVEKQYAGHSGAVRAVKYISSTRLVSGANDRTLRLWKTKNDE 173

Query: 368 ----------NYITGECISTYRGHSDSVLSVDSYQKVIVSGSADKTVKVWHVESRTCYTL 417
                     +   G+ ++    H   V++VD     I+SGS D ++  W    +    +
Sbjct: 174 LKNNLAAEEDDVEEGKTLAILEAHKAPVVTVDVSGDRIISGSYDNSIGFWSTNHKEMTAV 233

Query: 418 RGHTEWVNCVKLHPKSFSCFSCSDDTTIRMWDIRTNSCLKVFRGHVGQVQKIIPLTIKDV 477
                  + V    K     +  D +      +R  S L +   H   V++++       
Sbjct: 234 DPMDALGSNVSSAAKKRRRLALKDGS------VRRRSPLALLESHTAPVEEVLF------ 281

Query: 478 ENLATDNTSDGSSPQDDPTMT---DGADESDTPSNEQETVLDENIPYPTHLLSCGLDNT- 533
            + A D T   S  QD    T     A   DT S     +    +P   +LL+CG     
Sbjct: 282 -DFA-DKTVGYSVSQDHTIKTWDLVTARCVDTKSTSYSLLSLAQLP-QLNLLACGSSARH 338

Query: 534 IKLWDVKTG---KCIRTQF-GHVEGVWDIAAD-----NFRIISGSHDGSIKVWDLQSGKC 584
           I L D + G   K  + Q  GH   V  +A D      + + SGSHDG++KVWD++S   
Sbjct: 339 ITLHDPRVGSSTKITQQQLNGHKNFV--VALDTCPEMEYMLCSGSHDGTVKVWDVRSSAP 396

Query: 585 MHTF 588
           M+T 
Sbjct: 397 MYTI 400

 Score = 31.2 bits (69), Expect = 3.0,   Method: Compositional matrix adjust.
 Identities = 22/83 (26%), Positives = 44/83 (53%), Gaps = 13/83 (15%)

Query: 296 QEFKGHMDGVLTL----QFNYRLLFTGSYDSTIGIWDLFTGKLIRRLSGHSDGVKTL--- 348
           Q+  GH + V+ L    +  Y +L +GS+D T+ +WD+ +   +  ++  ++ VK +   
Sbjct: 355 QQLNGHKNFVVALDTCPEMEY-MLCSGSHDGTVKVWDVRSSAPMYTITREAEVVKGINDK 413

Query: 349 YFDDR-----KLITGSLDKTIRV 366
            FD +      +I+G  DK I++
Sbjct: 414 VFDVKWAKGLGIISGGQDKKIQI 436

>CAGL0L03201g complement(366795..368534) some similarities with
           sp|P47025 Saccharomyces cerevisiae YJL112w MDV1 or
           sp|P36130 Saccharomyces cerevisiae YKR036c CAF4 CCR4,
           hypothetical start
          Length = 579

 Score = 73.6 bits (179), Expect = 2e-13,   Method: Compositional matrix adjust.
 Identities = 65/289 (22%), Positives = 124/289 (42%), Gaps = 49/289 (16%)

Query: 332 GKLIRRLSGHSDGVKTLYFDDRKLI---TGSLDKTIRVWNYITGECISTYRGHSDSVLS- 387
           G+L + L  H D + +L  + +  +   T +LD  I++W+  T +C+    GH  +V + 
Sbjct: 270 GQLGKTLKCHDDYINSLAINAQLGVLSSTANLDNEIKLWDISTTQCLGVLSGHRATVNTT 329

Query: 388 --VDSYQKVIVSGSADKTVKVWHVES----------RTCY-TLRGHTEWVNCVKLHPKSF 434
             +D   +++ S   D +VKVW V++            C  T  GH + V    L     
Sbjct: 330 RFIDD-TRLLASAGKDASVKVWDVDNIVDKDGNANDNLCLATFDGHKDSVTA--LATTGN 386

Query: 435 SCFSCSDDTTIRMWDIRTNSCLKVFRGHVGQVQKIIPLTIKDVENLATDNTSDGSSPQDD 494
           +  S S+D T+R WD+ +  C++     +    K++P ++  ++           +P  +
Sbjct: 387 AIVSGSNDKTLRHWDLGSGKCIQSIDLTIAL--KMVPQSVSKLD----------ITPSFN 434

Query: 495 PTMTDGADESDTPSNEQETVLDENIPYPTHLLSCGLDNTIKLWDVKTGKCIRTQFGHVEG 554
             +  GAD  D                   L++   D  + LWD++ G+ + +  GH   
Sbjct: 435 TPLIGGADCIDNA-----------------LVTGTKDGIVYLWDLRIGRVVGSLEGHRGP 477

Query: 555 VWDIAADNFRIISGSHDGSIKVWDLQSGKCMHTFNGRRLQRETQHTQTQ 603
           +  +      +I+GS D S ++WDL+ G      +  +     + +QTQ
Sbjct: 478 ITSLKYMGSELITGSMDKSTRIWDLRMGSVAELLSFEKEVVSVEESQTQ 526

 Score = 68.9 bits (167), Expect = 5e-12,   Method: Compositional matrix adjust.
 Identities = 57/211 (27%), Positives = 90/211 (42%), Gaps = 40/211 (18%)

Query: 296 QEFKGHMDGVLTLQFNYRLLF---TGSYDSTIGIWDLFTGKLIRRLSGHSDGVKTLYF-- 350
           +  K H D + +L  N +L     T + D+ I +WD+ T + +  LSGH   V T  F  
Sbjct: 274 KTLKCHDDYINSLAINAQLGVLSSTANLDNEIKLWDISTTQCLGVLSGHRATVNTTRFID 333

Query: 351 DDRKLITGSLDKTIRVW----------NYITGECISTYRGHSDSVLSVDSYQKVIVSGSA 400
           D R L +   D +++VW          N     C++T+ GH DSV ++ +    IVSGS 
Sbjct: 334 DTRLLASAGKDASVKVWDVDNIVDKDGNANDNLCLATFDGHKDSVTALATTGNAIVSGSN 393

Query: 401 DKTVKVWHVESRTCYTLRGHTEWVNCVKLHPKSFSCF--------------SCSD----- 441
           DKT++ W + S  C       +    +K+ P+S S                 C D     
Sbjct: 394 DKTLRHWDLGSGKCIQ---SIDLTIALKMVPQSVSKLDITPSFNTPLIGGADCIDNALVT 450

Query: 442 ---DTTIRMWDIRTNSCLKVFRGHVGQVQKI 469
              D  + +WD+R    +    GH G +  +
Sbjct: 451 GTKDGIVYLWDLRIGRVVGSLEGHRGPITSL 481

 Score = 55.8 bits (133), Expect = 7e-08,   Method: Compositional matrix adjust.
 Identities = 30/103 (29%), Positives = 55/103 (53%), Gaps = 1/103 (0%)

Query: 315 LFTGSYDSTIGIWDLFTGKLIRRLSGHSDGVKTLYFDDRKLITGSLDKTIRVWNYITGEC 374
           L TG+ D  + +WDL  G+++  L GH   + +L +   +LITGS+DK+ R+W+   G  
Sbjct: 448 LVTGTKDGIVYLWDLRIGRVVGSLEGHRGPITSLKYMGSELITGSMDKSTRIWDLRMG-S 506

Query: 375 ISTYRGHSDSVLSVDSYQKVIVSGSADKTVKVWHVESRTCYTL 417
           ++        V+SV+  Q  +++    + VK++    R   +L
Sbjct: 507 VAELLSFEKEVVSVEESQTQLINALEGEPVKIYDRGERQYNSL 549

 Score = 50.1 bits (118), Expect = 4e-06,   Method: Compositional matrix adjust.
 Identities = 38/174 (21%), Positives = 66/174 (37%), Gaps = 43/174 (24%)

Query: 295 IQEFKGHMDGVLTLQFNYRLLFTGSYDSTIGIWDLFTGKLIRR----------------- 337
           +  F GH D V  L      + +GS D T+  WDL +GK I+                  
Sbjct: 368 LATFDGHKDSVTALATTGNAIVSGSNDKTLRHWDLGSGKCIQSIDLTIALKMVPQSVSKL 427

Query: 338 ---------LSGHSDGVKTLYFDDRKLITGSLDKTIRVWNYITGECISTYRGHSDSVLSV 388
                    L G +D +      D  L+TG+ D  + +W+   G  + +  GH   + S+
Sbjct: 428 DITPSFNTPLIGGADCI------DNALVTGTKDGIVYLWDLRIGRVVGSLEGHRGPITSL 481

Query: 389 DSYQKVIVSGSADKTVKVWHV-----------ESRTCYTLRGHTEWVNCVKLHP 431
                 +++GS DK+ ++W +           E          T+ +N ++  P
Sbjct: 482 KYMGSELITGSMDKSTRIWDLRMGSVAELLSFEKEVVSVEESQTQLINALEGEP 535

>CAGL0L10890g 1163084..1164457 highly similar to sp|Q12024
           Saccharomyces cerevisiae YOR272w YTM1
           microtubule-interacting protein, start by similarity
          Length = 457

 Score = 72.8 bits (177), Expect = 2e-13,   Method: Compositional matrix adjust.
 Identities = 82/321 (25%), Positives = 141/321 (43%), Gaps = 54/321 (16%)

Query: 305 VLTLQFNYRLLFTGSYDSTIGIWDLFTGKLIRRLSGHSDGVKTL-YFDDRKLITGSLDKT 363
            L +  ++R +++GSYD  +  W++ +GK+ ++ SGH+  VK + Y  + ++++   D++
Sbjct: 108 ALDVSDDFRHIYSGSYDGVVRTWNM-SGKVEKQYSGHTGAVKAVKYISNTRIVSAGNDRS 166

Query: 364 IRVW--------------------NYITGECISTYRGHSDSVLSVD-SYQKVIVSGSADK 402
           +R+W                    N   G+ ++   GH   V+S+D +    I+S S D 
Sbjct: 167 LRLWKTKNDDGSVSNNTGDENDEENIEDGKTLAILEGHKAPVVSLDVASNSRILSASYDN 226

Query: 403 TVKVWHVESRTCYTLRGHTEWV----NCVKLHPKSFSCFSCSDDTTIRMWDIRTNSCLKV 458
           TV +W    +   T   H E +    N +    K     +  D T      IR  + L +
Sbjct: 227 TVALWSTIYKEM-TAIDHLEEIQNPNNKISTAAKKRRKLTLKDGT------IRRRAPLSL 279

Query: 459 FRGHVGQVQKIIPLTIKDVENLATDNTSDGSSPQDDPTMT---DGADESDTPSNEQETVL 515
              H G V+++I            DNT   S  QD    T     A   DT +     + 
Sbjct: 280 LESHTGPVEQVI--------FDHGDNTVGYSVSQDHTIKTWDLVTARCIDTKTTSYPLLS 331

Query: 516 DENIPYPTHLLSCGLD-NTIKLWDVK---TGKCIRTQF-GH---VEGVWDIAADNFRIIS 567
              +P   +LL+CG     I L D +   + K  + Q  GH   V G+   + + + + S
Sbjct: 332 IAQMP-TLNLLACGSSVRHITLHDPRVSSSAKITQKQLVGHKNFVVGLDTCSENEYLLCS 390

Query: 568 GSHDGSIKVWDLQSGKCMHTF 588
            SHDG++KVWD++S   M+T 
Sbjct: 391 ASHDGTVKVWDVRSTSPMYTI 411

 Score = 45.1 bits (105), Expect = 1e-04,   Method: Compositional matrix adjust.
 Identities = 52/225 (23%), Positives = 85/225 (37%), Gaps = 30/225 (13%)

Query: 384 SVLSVDSYQKVIVSGSADKTVKVWHVESRTCYTLRGHTEWVNCVKLHPKSFSCFSCSDDT 443
           S L V    + I SGS D  V+ W++  +      GHT  V  VK +  +    S  +D 
Sbjct: 107 SALDVSDDFRHIYSGSYDGVVRTWNMSGKVEKQYSGHTGAVKAVK-YISNTRIVSAGNDR 165

Query: 444 TIRMW--------------------DIRTNSCLKVFRGHVGQVQKIIPLTIKDVENLATD 483
           ++R+W                    +I     L +  GH   V  +   +   + + + D
Sbjct: 166 SLRLWKTKNDDGSVSNNTGDENDEENIEDGKTLAILEGHKAPVVSLDVASNSRILSASYD 225

Query: 484 NT-SDGSSPQDDPTMTDGADESDTPSNEQETVLDENIPYPTHLLSCGLDNTIKLWDVKTG 542
           NT +  S+   + T  D  +E   P+N+  T   +         +      + L +  TG
Sbjct: 226 NTVALWSTIYKEMTAIDHLEEIQNPNNKISTAAKKRRKLTLKDGTIRRRAPLSLLESHTG 285

Query: 543 KCIRTQFGHVEGVWDIAADNFRIISGSHDGSIKVWDLQSGKCMHT 587
              +  F H         DN    S S D +IK WDL + +C+ T
Sbjct: 286 PVEQVIFDH--------GDNTVGYSVSQDHTIKTWDLVTARCIDT 322

>Kwal_23.5351
          Length = 474

 Score = 72.8 bits (177), Expect = 3e-13,   Method: Compositional matrix adjust.
 Identities = 58/240 (24%), Positives = 103/240 (42%), Gaps = 57/240 (23%)

Query: 351 DDRKLITGSLDKTIRVWNYITGECISTYRG-HSDSVLSV--DSYQKVIVSGSADKTVKVW 407
           D   L  GS +  +++ +  + E + +  G H D +  V   S  +++ +G AD  VK+W
Sbjct: 193 DGASLAAGSWNGDVKILHPQSLEVVRSLDGAHDDKIGGVAWSSDSQLLATGGADNLVKIW 252

Query: 408 HVESRTC-----YTLRGHTEWVNCVKLHPKSFSCFSCSDDTTIRMWDIRTNSCLKVFRGH 462
           + ++++        LRGH   V+ VK HP      S S D T R+WD+   + L++  GH
Sbjct: 253 NPQAQSHSEASRVVLRGHEARVSKVKFHPSDRFVASASFDMTWRLWDVERETELQLQEGH 312

Query: 463 VGQVQKIIPLTIKDVENLATDNTSDGSSPQDDPTMTDGADESDTPSNEQETVLDENIPYP 522
             +V                D   DGS                                 
Sbjct: 313 AKEV-------------YCLDFQCDGSL-------------------------------- 327

Query: 523 THLLSCGLDNTIKLWDVKTGKCIRTQFGHVEGVWDI--AADNFRIISGSHDGSIKVWDLQ 580
             L S GLD+   +WD++TG+ +    GH + ++ +  + +   + +GS DG+++VWD++
Sbjct: 328 --LCSAGLDSVGHVWDMRTGRSLMVLEGHAKPIYGVSWSPNGHHVATGSGDGTVQVWDIR 385

 Score = 56.2 bits (134), Expect = 4e-08,   Method: Compositional matrix adjust.
 Identities = 47/175 (26%), Positives = 88/175 (50%), Gaps = 12/175 (6%)

Query: 289 RKGHCRIQEFKGHMDGVLTLQF--NYRLLFTGSYDSTIGIWDLFTGKLIRRLSGHSDGVK 346
           R+   ++QE  GH   V  L F  +  LL +   DS   +WD+ TG+ +  L GH+  + 
Sbjct: 302 RETELQLQE--GHAKEVYCLDFQCDGSLLCSAGLDSVGHVWDMRTGRSLMVLEGHAKPIY 359

Query: 347 TLYF--DDRKLITGSLDKTIRVWNYITGECISTYRGHSDSVLSVDSYQK----VIVSGSA 400
            + +  +   + TGS D T++VW+       S+   H +S++S  +++K     +VS S 
Sbjct: 360 GVSWSPNGHHVATGSGDGTVQVWDIRKANKPSSILAH-NSIVSEVNFEKENGNFLVSSSY 418

Query: 401 DKTVKVWHVESRT-CYTLRGHTEWVNCVKLHPKSFSCFSCSDDTTIRMWDIRTNS 454
           D+T+ V+   S     +L+GHT+ +  V +     + +S   D ++++W +   S
Sbjct: 419 DRTIGVFATGSWIKLASLQGHTDKILSVDISRGGANLWSSGWDRSVKIWALGVRS 473

 Score = 55.1 bits (131), Expect = 9e-08,   Method: Compositional matrix adjust.
 Identities = 44/159 (27%), Positives = 70/159 (44%), Gaps = 10/159 (6%)

Query: 315 LFTGSYDSTIGIWDLFTGKLIRRLSG-HSDGVKTLYF--DDRKLITGSLDKTIRVWN--- 368
           L  GS++  + I    + +++R L G H D +  + +  D + L TG  D  +++WN   
Sbjct: 197 LAAGSWNGDVKILHPQSLEVVRSLDGAHDDKIGGVAWSSDSQLLATGGADNLVKIWNPQA 256

Query: 369 -YITGECISTYRGHSDSVLSVDSY--QKVIVSGSADKTVKVWHVESRTCYTLR-GHTEWV 424
              +       RGH   V  V  +   + + S S D T ++W VE  T   L+ GH + V
Sbjct: 257 QSHSEASRVVLRGHEARVSKVKFHPSDRFVASASFDMTWRLWDVERETELQLQEGHAKEV 316

Query: 425 NCVKLHPKSFSCFSCSDDTTIRMWDIRTNSCLKVFRGHV 463
            C+          S   D+   +WD+RT   L V  GH 
Sbjct: 317 YCLDFQCDGSLLCSAGLDSVGHVWDMRTGRSLMVLEGHA 355

 Score = 49.7 bits (117), Expect = 5e-06,   Method: Compositional matrix adjust.
 Identities = 44/180 (24%), Positives = 80/180 (44%), Gaps = 8/180 (4%)

Query: 298 FKGHMDGVLTLQFNY--RLLFTGSYDSTIGIWDLFTGKLIRRLSGHSDGVKTLYF--DDR 353
            +GH   V  ++F+   R + + S+D T  +WD+     ++   GH+  V  L F  D  
Sbjct: 267 LRGHEARVSKVKFHPSDRFVASASFDMTWRLWDVERETELQLQEGHAKEVYCLDFQCDGS 326

Query: 354 KLITGSLDKTIRVWNYITGECISTYRGHSDSVLSV--DSYQKVIVSGSADKTVKVWHV-E 410
            L +  LD    VW+  TG  +    GH+  +  V        + +GS D TV+VW + +
Sbjct: 327 LLCSAGLDSVGHVWDMRTGRSLMVLEGHAKPIYGVSWSPNGHHVATGSGDGTVQVWDIRK 386

Query: 411 SRTCYTLRGHTEWVNCVKLHPKSFSCF-SCSDDTTIRMWDIRTNSCLKVFRGHVGQVQKI 469
           +    ++  H   V+ V    ++ +   S S D TI ++   +   L   +GH  ++  +
Sbjct: 387 ANKPSSILAHNSIVSEVNFEKENGNFLVSSSYDRTIGVFATGSWIKLASLQGHTDKILSV 446

 Score = 38.1 bits (87), Expect = 0.021,   Method: Compositional matrix adjust.
 Identities = 21/73 (28%), Positives = 34/73 (46%), Gaps = 2/73 (2%)

Query: 520 PYPTHLLSCGLDNTIKLWDVKTGKCIRTQFGHVEGVW--DIAADNFRIISGSHDGSIKVW 577
           P    + S   D T +LWDV+    ++ Q GH + V+  D   D   + S   D    VW
Sbjct: 281 PSDRFVASASFDMTWRLWDVERETELQLQEGHAKEVYCLDFQCDGSLLCSAGLDSVGHVW 340

Query: 578 DLQSGKCMHTFNG 590
           D+++G+ +    G
Sbjct: 341 DMRTGRSLMVLEG 353

>CAGL0M04279g 469040..471862 highly similar to sp|Q12220
           Saccharomyces cerevisiae YLR129w DIP2 DOM34P-interacting
           protein, start by similarity
          Length = 940

 Score = 73.2 bits (178), Expect = 3e-13,   Method: Compositional matrix adjust.
 Identities = 57/185 (30%), Positives = 91/185 (49%), Gaps = 21/185 (11%)

Query: 306 LTLQFNYRLLFTGSYDSTIGIWDLFTGKL-IRRLSGHSDGVKTLYFD------------- 351
           L L  + R L TGS D T+  W     ++ +   S  +  +  L+ D             
Sbjct: 476 LDLTSDGRKLVTGSADKTVRFWTFEVSEVPVSDESNKTMPMLQLFHDTTLELDDDILSVV 535

Query: 352 ---DRKLITGS-LDKTIRVWNYITGECISTYRGHSDSVLSVD-SY-QKVIVSGSADKTVK 405
              D K I  S LD T++V+   + +   +  GH   VLS+D SY  K+IV+ SADK +K
Sbjct: 536 ISPDDKFIAVSLLDNTVKVFFLDSMKFFLSLYGHKLPVLSMDISYDSKLIVTCSADKNIK 595

Query: 406 VWHVESRTCY-TLRGHTEWVNCVKLHPKSFSCFSCSDDTTIRMWDIRTNSCLKVFRGHVG 464
           +W ++   C+ +L  H + +  VK  P+S++ FSCS D T++ WD +   C++    H  
Sbjct: 596 IWGLDFGDCHKSLFAHQDSIMNVKFLPESYNFFSCSKDATVKYWDGQKFECIQKLAAHQS 655

Query: 465 QVQKI 469
           +V  I
Sbjct: 656 EVWSI 660

 Score = 71.6 bits (174), Expect = 1e-12,   Method: Compositional matrix adjust.
 Identities = 68/290 (23%), Positives = 111/290 (38%), Gaps = 73/290 (25%)

Query: 314 LLFTGSYDSTIGIWDLFTGKLIRRLSGHSDGV---KTLYFDDRKLITGSLDKTIRVWNYI 370
           L+  G+ +  + ++D+ +  ++    G  D       L  D RKL+TGS DKT+R W + 
Sbjct: 441 LVVVGTRNGELQLFDIASSTMLDNKEGAHDAAIWSLDLTSDGRKLVTGSADKTVRFWTFE 500

Query: 371 TGECISTYRGHS----------------DSVLSV--DSYQKVIVSGSADKTVKVWHVESR 412
             E   +   +                 D +LSV      K I     D TVKV+ ++S 
Sbjct: 501 VSEVPVSDESNKTMPMLQLFHDTTLELDDDILSVVISPDDKFIAVSLLDNTVKVFFLDSM 560

Query: 413 TCY-TLRGHTEWVNCVKLHPKSFSCFSCSDDTTIRMWDIRTNSCLKVFRGHVGQVQKIIP 471
             + +L GH   V  + +   S    +CS D  I++W +    C K    H         
Sbjct: 561 KFFLSLYGHKLPVLSMDISYDSKLIVTCSADKNIKIWGLDFGDCHKSLFAH--------- 611

Query: 472 LTIKDVENLATDNTSDGSSPQDDPTMTDGADESDTPSNEQETVLD-ENIPYPTHLLSCGL 530
                                                  Q+++++ + +P   +  SC  
Sbjct: 612 ---------------------------------------QDSIMNVKFLPESYNFFSCSK 632

Query: 531 DNTIKLWDVKTGKCIRTQFGHVEGVWDIAA--DNFRIISGSHDGSIKVWD 578
           D T+K WD +  +CI+    H   VW I+   D   +IS  HD SI+VW+
Sbjct: 633 DATVKYWDGQKFECIQKLAAHQSEVWSISVSNDGTFVISTGHDHSIRVWE 682

 Score = 63.5 bits (153), Expect = 3e-10,   Method: Compositional matrix adjust.
 Identities = 41/141 (29%), Positives = 67/141 (47%), Gaps = 6/141 (4%)

Query: 314 LLFTGSYDSTIGIWDLFTGKLIRRLSGHSDGVKTLYFD--DRKLITGSLDKTIRVWNYIT 371
           LL  G  D  I IWDL +  ++   +GH   +  L FD    +LI+ S D  I VW+ + 
Sbjct: 93  LLAAGYADGVIKIWDLISKTVLISFNGHKSAITVLAFDTTGTRLISASKDSDIIVWDLVG 152

Query: 372 GECISTYRGHSDSVLSV-DSYQKVIVSGSADKTVKVWHVESRTCY-TLRGHTEWVNCVKL 429
              +   R H D++  +    +  ++S S D  VK+W ++S+ C  T   HT    C  L
Sbjct: 153 ESGLYKLRSHKDAITGLWCEDENWLISTSKDGLVKIWDLKSQQCVETHLAHTG--ECWSL 210

Query: 430 HPKSFSCFSCSDDTTIRMWDI 450
                   +CS D+ +++W +
Sbjct: 211 GIIEDMAVTCSADSQVKLWKL 231

 Score = 61.6 bits (148), Expect = 1e-09,   Method: Compositional matrix adjust.
 Identities = 34/116 (29%), Positives = 60/116 (51%), Gaps = 3/116 (2%)

Query: 298 FKGHMDGVLTLQFNYR--LLFTGSYDSTIGIWDLFTGKLIRRLSGHSDGVKTLYFDDRK- 354
           F GH   +  L F+     L + S DS I +WDL     + +L  H D +  L+ +D   
Sbjct: 117 FNGHKSAITVLAFDTTGTRLISASKDSDIIVWDLVGESGLYKLRSHKDAITGLWCEDENW 176

Query: 355 LITGSLDKTIRVWNYITGECISTYRGHSDSVLSVDSYQKVIVSGSADKTVKVWHVE 410
           LI+ S D  +++W+  + +C+ T+  H+    S+   + + V+ SAD  VK+W ++
Sbjct: 177 LISTSKDGLVKIWDLKSQQCVETHLAHTGECWSLGIIEDMAVTCSADSQVKLWKLD 232

 Score = 53.5 bits (127), Expect = 4e-07,   Method: Compositional matrix adjust.
 Identities = 57/255 (22%), Positives = 92/255 (36%), Gaps = 68/255 (26%)

Query: 354 KLITGSLDKTIRVWNYITGECISTYR-----GHSDSVLSVDSYQ---------KVIVSGS 399
           ++I G L+  I VW+  TGE I+        G SD+ LS  +            ++ +G 
Sbjct: 40  QVIVGGLE-NILVWDIKTGEQIAQLTDGLPPGASDAKLSKPAETTFLKYHPETNLLAAGY 98

Query: 400 ADKTVKVWHVESRTCY-TLRGHTEWVNCVKLHPKSFSCFSCSDDTTIRMWDIRTNSCLKV 458
           AD  +K+W + S+T   +  GH   +  +          S S D+ I +WD+   S L  
Sbjct: 99  ADGVIKIWDLISKTVLISFNGHKSAITVLAFDTTGTRLISASKDSDIIVWDLVGESGLYK 158

Query: 459 FRGHVGQVQKIIPLTIKDVENLATDNTSDGSSPQDDPTMTDGADESDTPSNEQETVLDEN 518
            R H      I  L  +D EN     + DG                              
Sbjct: 159 LRSH---KDAITGLWCED-ENWLISTSKDG------------------------------ 184

Query: 519 IPYPTHLLSCGLDNTIKLWDVKTGKCIRTQFGHVEGVWDIAADNFRIISGSHDGSIKVWD 578
                          +K+WD+K+ +C+ T   H    W +       ++ S D  +K+W 
Sbjct: 185 --------------LVKIWDLKSQQCVETHLAHTGECWSLGIIEDMAVTCSADSQVKLWK 230

Query: 579 LQSGKCMHTFNGRRL 593
           L     +   NG +L
Sbjct: 231 LD----LQAENGSKL 241

 Score = 52.0 bits (123), Expect = 1e-06,   Method: Compositional matrix adjust.
 Identities = 50/259 (19%), Positives = 100/259 (38%), Gaps = 19/259 (7%)

Query: 351 DDRKLITGSLDKTIRVWNYITGECISTYRGHSDSVLSVDSYQKVIVSGSADKTVKVWHVE 410
           DD KL+  + + ++++WN  T  CI ++               ++V G+ +  ++++ + 
Sbjct: 398 DDNKLLATASNGSLKIWNIKTKRCIRSFECGYALTCKFLPGGALVVVGTRNGELQLFDIA 457

Query: 411 SRTCYTLR--GHTEWVNCVKLHPKSFSCFSCSDDTTIRMWDIRTNSCLKVFRGHVGQVQK 468
           S T    +   H   +  + L        + S D T+R W    +           +   
Sbjct: 458 SSTMLDNKEGAHDAAIWSLDLTSDGRKLVTGSADKTVRFWTFEVSEV--PVSDESNKTMP 515

Query: 469 IIPLTIKDVENLATDNTSDGSSPQDDPTMTDGADESD------------TPSNEQETVLD 516
           ++ L       L  D  S   SP D        D +             +    +  VL 
Sbjct: 516 MLQLFHDTTLELDDDILSVVISPDDKFIAVSLLDNTVKVFFLDSMKFFLSLYGHKLPVLS 575

Query: 517 ENIPYPTHLL-SCGLDNTIKLWDVKTGKCIRTQFGHVEGVWDIA--ADNFRIISGSHDGS 573
            +I Y + L+ +C  D  IK+W +  G C ++ F H + + ++    +++   S S D +
Sbjct: 576 MDISYDSKLIVTCSADKNIKIWGLDFGDCHKSLFAHQDSIMNVKFLPESYNFFSCSKDAT 635

Query: 574 IKVWDLQSGKCMHTFNGRR 592
           +K WD Q  +C+      +
Sbjct: 636 VKYWDGQKFECIQKLAAHQ 654

 Score = 48.9 bits (115), Expect = 1e-05,   Method: Compositional matrix adjust.
 Identities = 33/115 (28%), Positives = 53/115 (46%), Gaps = 6/115 (5%)

Query: 300 GHMDGVLTLQFNY--RLLFTGSYDSTIGIWDLFTGKLIRRLSGHSDGVKTLYF--DDRKL 355
           GH   VL++  +Y  +L+ T S D  I IW L  G   + L  H D +  + F  +    
Sbjct: 568 GHKLPVLSMDISYDSKLIVTCSADKNIKIWGLDFGDCHKSLFAHQDSIMNVKFLPESYNF 627

Query: 356 ITGSLDKTIRVWNYITGECISTYRGHSDSV--LSVDSYQKVIVSGSADKTVKVWH 408
            + S D T++ W+    ECI     H   V  +SV +    ++S   D +++VW 
Sbjct: 628 FSCSKDATVKYWDGQKFECIQKLAAHQSEVWSISVSNDGTFVISTGHDHSIRVWE 682

>YOR269W (PAC1) [5055] chr15 (826382..827866) Protein required in
           the absence of Cin8p, contains WD (WD-40) repeats [1485
           bp, 494 aa]
          Length = 494

 Score = 72.4 bits (176), Expect = 3e-13,   Method: Compositional matrix adjust.
 Identities = 60/228 (26%), Positives = 98/228 (42%), Gaps = 51/228 (22%)

Query: 288 WRKGHCRIQEFK---GH---MDGVLTLQFNYRL-LFTGSYDSTIGIWDLFTGKLIRRLSG 340
           W    C+ Q+ +   GH   +  V   Q N  + + + S D T+ IWD   G  ++    
Sbjct: 236 WVSEECKFQQIRSLLGHEHIVSAVKIWQKNNDVHIASCSRDQTVKIWDFHNGWSLKTFQP 295

Query: 341 HSDGVKTLYFDDRKLITGSLDKTIRVWNYITGECISTYRGHSDSVLSV------------ 388
           HS  V+++      +I+GS D T+R+ ++ +G  +S   GH   +  V            
Sbjct: 296 HSQWVRSIDVLGDYIISGSHDTTLRLTHWPSGNGLSVGTGHEFPIEKVKFIHFIEDSPEI 355

Query: 389 -------DSYQ----KVIVSGSADKTVKVWHV------------------ESRTCYTLRG 419
                  D Y+    +  VS S D+T+K+W +                    R   TL+G
Sbjct: 356 RFRTPSTDRYKNWGMQYCVSASRDRTIKIWEIPLPTLMAHRAPIPNPTDSNFRCVLTLKG 415

Query: 420 HTEWVNCVKLHPKSFSCFSCSDDTTIRMWDIRTNSCLKVF-RGHVGQV 466
           H  WV  + +  +    FSC+DD ++R WD+ T  CL V+ + H G V
Sbjct: 416 HLSWVRDISIRGQYL--FSCADDKSVRCWDLNTGQCLHVWEKLHTGFV 461

 Score = 68.6 bits (166), Expect = 6e-12,   Method: Compositional matrix adjust.
 Identities = 74/305 (24%), Positives = 133/305 (43%), Gaps = 34/305 (11%)

Query: 306 LTLQFNYRLLFTGSYDSTIGIWDLFTGKL-IRRLSGHSDGVKTL------YFDDRK---- 354
           + L  N  ++F  +    +  +DLF   + +  L  H+  + ++      Y +  K    
Sbjct: 161 VKLHPNLPIVFVATDHGKLYAFDLFNYTIPLASLQSHTKAITSMDVLFTNYTNSSKKNYL 220

Query: 355 -LITGSLDKTIRVWNYITGEC----ISTYRGHSDSVLSVDSYQKV----IVSGSADKTVK 405
            ++T S D  I V+ +++ EC    I +  GH   V +V  +QK     I S S D+TVK
Sbjct: 221 VIVTASKDLQIHVFKWVSEECKFQQIRSLLGHEHIVSAVKIWQKNNDVHIASCSRDQTVK 280

Query: 406 VWHVESR-TCYTLRGHTEWVNCVKLHPKSFSCFSCSDDTTIRMWDIRTNSCLKVFRGHVG 464
           +W   +  +  T + H++WV  + +        S S DTT+R+    + + L V  GH  
Sbjct: 281 IWDFHNGWSLKTFQPHSQWVRSIDVLGDYI--ISGSHDTTLRLTHWPSGNGLSVGTGHEF 338

Query: 465 QVQKIIPLTIKDVENLATDNTSDGSSPQDDPTMTDGADESDTPSNEQETVLDENIPYPTH 524
            ++K     +K +  +         +P  D     G     + S ++   + E IP PT 
Sbjct: 339 PIEK-----VKFIHFIEDSPEIRFRTPSTDRYKNWGMQYCVSASRDRTIKIWE-IPLPTL 392

Query: 525 LLS-CGLDNTIKLWDVKTGKCIRTQFGHVEGVWDIAADNFRIISGSHDGSIKVWDLQSGK 583
           +     + N          +C+ T  GH+  V DI+     + S + D S++ WDL +G+
Sbjct: 393 MAHRAPIPNPTD----SNFRCVLTLKGHLSWVRDISIRGQYLFSCADDKSVRCWDLNTGQ 448

Query: 584 CMHTF 588
           C+H +
Sbjct: 449 CLHVW 453

 Score = 42.7 bits (99), Expect = 7e-04,   Method: Compositional matrix adjust.
 Identities = 24/74 (32%), Positives = 35/74 (47%)

Query: 523 THLLSCGLDNTIKLWDVKTGKCIRTQFGHVEGVWDIAADNFRIISGSHDGSIKVWDLQSG 582
            H+ SC  D T+K+WD   G  ++T   H + V  I      IISGSHD ++++    SG
Sbjct: 268 VHIASCSRDQTVKIWDFHNGWSLKTFQPHSQWVRSIDVLGDYIISGSHDTTLRLTHWPSG 327

Query: 583 KCMHTFNGRRLQRE 596
             +    G     E
Sbjct: 328 NGLSVGTGHEFPIE 341

>CAGL0C03608g 360681..362612 similar to sp|P16649 Saccharomyces
           cerevisiae YCR084c TUP1 general transcription repressor,
           hypothetical start
          Length = 643

 Score = 72.8 bits (177), Expect = 3e-13,   Method: Compositional matrix adjust.
 Identities = 78/325 (24%), Positives = 129/325 (39%), Gaps = 93/325 (28%)

Query: 311 NYRLLFTGSYDSTIGIWDLFTGKLIRRL-----SGHSDG---------VKTLYF--DDRK 354
           N   L TG  + T  I+++ TG L+  L     +G  D          ++++ F  D + 
Sbjct: 329 NGEYLATGC-NKTTKIFEVATGNLVTELVDDTKTGTEDANSASSADLYIRSVCFSPDGKF 387

Query: 355 LITGSLDKTIRVWNYITGECISTYRGHSDSVLSVDSYQ--KVIVSGSADKTVKVWHVESR 412
           L TG+ DK IR+W+    + +   RGH   + S+D +Q    +VSGS D+T+++W + + 
Sbjct: 388 LATGAEDKLIRIWDIAQRKIVMVLRGHEQDIYSLDYFQSGNKLVSGSGDRTIRIWDLHTG 447

Query: 413 TCYTLRGHTEWVNCVKLHPKSFSCFSC-SDDTTIRMWDIRTNSCLKVFR---------GH 462
            C       + V  V + P + +  +  S D T+R+WD  +NS   V R         GH
Sbjct: 448 QCSLTLSIEDGVTTVAVSPGNGNYVAAGSLDRTVRVWD--SNSGFLVERLDSEGETGVGH 505

Query: 463 VGQVQKIIPLTIKDVENLATDNTSDGSSPQDDPTMTDGADESDTPSNEQETVLDENIPYP 522
              V  ++              T DG                                  
Sbjct: 506 KDSVYSVV-------------FTRDGK--------------------------------- 519

Query: 523 THLLSCGLDNTIKLWDVKT-------------GKCIRTQFGHVEGVWDIAA--DNFRIIS 567
            +++S  LD ++KLW+++              G C  T  GH + V  +    ++  I+S
Sbjct: 520 -NIVSGSLDRSVKLWNLRNINGASTSPQPKTEGNCEMTYIGHKDFVLSVTTTENDQYILS 578

Query: 568 GSHDGSIKVWDLQSGKCMHTFNGRR 592
           GS D  +  WD  SG  +    G R
Sbjct: 579 GSKDRGVIFWDKVSGVPLLMLQGHR 603

 Score = 35.8 bits (81), Expect = 0.11,   Method: Compositional matrix adjust.
 Identities = 25/92 (27%), Positives = 44/92 (47%), Gaps = 11/92 (11%)

Query: 290 KGHCRIQEFKGHMDGVLTLQF--NYRLLFTGSYDSTIGIWDLFTGKLIRRLSGHSDGVKT 347
           +G+C +  + GH D VL++    N + + +GS D  +  WD  +G  +  L GH + V +
Sbjct: 550 EGNCEMT-YIGHKDFVLSVTTTENDQYILSGSKDRGVIFWDKVSGVPLLMLQGHRNSVIS 608

Query: 348 LYFDDRK--------LITGSLDKTIRVWNYIT 371
           +   + K          TGS D   ++W + T
Sbjct: 609 VAVANGKPLGANYNVFATGSGDCKAKIWKFQT 640

>Scas_713.50
          Length = 983

 Score = 73.2 bits (178), Expect = 4e-13,   Method: Compositional matrix adjust.
 Identities = 55/182 (30%), Positives = 88/182 (48%), Gaps = 21/182 (11%)

Query: 306 LTLQFNYRLLFTGSYDSTIGIW------DLFTG---KLIRRLSGHSDGVKTLYFD----- 351
           L L  + + L TGS D ++  W      +L  G   K + +L  H D    L  D     
Sbjct: 517 LDLTSDGKRLITGSADKSVKFWNFQLEQELVPGTSDKFVPKLGLHHDTTLELSDDILSVR 576

Query: 352 ----DRKLITGSLDKTIRVWNYITGECISTYRGHSDSVLSVD-SY-QKVIVSGSADKTVK 405
               D+ L    LD T++V+   + +   +  GH   VLS+D S+  K+I++ SADK +K
Sbjct: 577 VSPEDKFLAVSLLDNTVKVFFLDSMKFFLSLYGHKLPVLSIDISFDSKMIITSSADKNIK 636

Query: 406 VWHVESRTCY-TLRGHTEWVNCVKLHPKSFSCFSCSDDTTIRMWDIRTNSCLKVFRGHVG 464
           +W ++   C+ +L  H + +  VK  P+S + FSCS D  I+ WD     C++    H  
Sbjct: 637 IWGLDFGDCHKSLFAHQDSIMNVKFVPESHNFFSCSKDGIIKYWDGDKFECIQKLAAHQS 696

Query: 465 QV 466
           +V
Sbjct: 697 EV 698

 Score = 67.4 bits (163), Expect = 2e-11,   Method: Compositional matrix adjust.
 Identities = 62/243 (25%), Positives = 94/243 (38%), Gaps = 56/243 (23%)

Query: 354 KLITGSLDKTIRVWNYITGECISTYR-GHSDSVLSVDSYQ---------------KVIVS 397
           ++ITG+L+  + +W+  TGE  S    G      SVD+                  ++  
Sbjct: 65  QIITGALE-NVNIWDLKTGELASFLNDGLVPPPGSVDAKSSKPAETTFLQHHKETNLLAV 123

Query: 398 GSADKTVKVWHVESRTCY-TLRGHTEWVNCVKLHPKSFSCFSCSDDTTIRMWDIRTNSCL 456
           G  D  VKVW + S+T    L GH+  +  +K         S S D+ I +WD+ +   L
Sbjct: 124 GYNDGVVKVWDLYSKTVLCNLNGHSSAITALKFDTSGTRLISGSRDSNIIVWDLVSEVGL 183

Query: 457 KVFRGHVGQVQKIIPLTIKDVENLATDNTSDGSSPQDDPTMTDGADESDTPSNEQETVLD 516
              R H   +  I         N  T+N                        N++E  LD
Sbjct: 184 YKLRSHKDAITGIWC-------NEVTNN------------------------NQEENELD 212

Query: 517 ENIPYPTHLLSCGLDNTIKLWDVKTGKCIRTQFGHVEGVWDIAADNFRIISGSHDGSIKV 576
                   L+S   D  IK+WD+K  +C+ T   H    W +A  N  +I+ S D  +K 
Sbjct: 213 -------WLISTSKDGLIKIWDLKIQQCVETHIAHTGECWSLAVRNDLVITTSSDSQVKF 265

Query: 577 WDL 579
           W L
Sbjct: 266 WQL 268

 Score = 64.3 bits (155), Expect = 2e-10,   Method: Compositional matrix adjust.
 Identities = 67/290 (23%), Positives = 112/290 (38%), Gaps = 73/290 (25%)

Query: 314 LLFTGSYDSTIGIWDLFTGKLIRRLS-GHSDGVKTLYF--DDRKLITGSLDKTIRVWNY- 369
           L+  G+    + ++DL +   I  +   H   + +L    D ++LITGS DK+++ WN+ 
Sbjct: 482 LVIIGTRAGELQLFDLASSTQIANIEEAHDAAIWSLDLTSDGKRLITGSADKSVKFWNFQ 541

Query: 370 ITGECI---------------STYRGHSDSVLSV--DSYQKVIVSGSADKTVKVWHVESR 412
           +  E +                T    SD +LSV      K +     D TVKV+ ++S 
Sbjct: 542 LEQELVPGTSDKFVPKLGLHHDTTLELSDDILSVRVSPEDKFLAVSLLDNTVKVFFLDSM 601

Query: 413 TCY-TLRGHTEWVNCVKLHPKSFSCFSCSDDTTIRMWDIRTNSCLKVFRGHVGQVQKIIP 471
             + +L GH   V  + +   S    + S D  I++W +    C K    H         
Sbjct: 602 KFFLSLYGHKLPVLSIDISFDSKMIITSSADKNIKIWGLDFGDCHKSLFAH--------- 652

Query: 472 LTIKDVENLATDNTSDGSSPQDDPTMTDGADESDTPSNEQETVLD-ENIPYPTHLLSCGL 530
                                                  Q+++++ + +P   +  SC  
Sbjct: 653 ---------------------------------------QDSIMNVKFVPESHNFFSCSK 673

Query: 531 DNTIKLWDVKTGKCIRTQFGHVEGVW--DIAADNFRIISGSHDGSIKVWD 578
           D  IK WD    +CI+    H   VW   IA D   ++S SHD SI++W+
Sbjct: 674 DGIIKYWDGDKFECIQKLAAHQSEVWALAIANDASFVVSSSHDHSIRIWE 723

 Score = 62.4 bits (150), Expect = 9e-10,   Method: Compositional matrix adjust.
 Identities = 39/151 (25%), Positives = 72/151 (47%), Gaps = 16/151 (10%)

Query: 314 LLFTGSYDSTIGIWDLFTGKLIRRLSGHSDGVKTLYFDDR--KLITGSLDKTIRVWNYIT 371
           LL  G  D  + +WDL++  ++  L+GHS  +  L FD    +LI+GS D  I VW+ ++
Sbjct: 120 LLAVGYNDGVVKVWDLYSKTVLCNLNGHSSAITALKFDTSGTRLISGSRDSNIIVWDLVS 179

Query: 372 GECISTYRGHSDSVLSV-----------DSYQKVIVSGSADKTVKVWHVESRTCY-TLRG 419
              +   R H D++  +           ++    ++S S D  +K+W ++ + C  T   
Sbjct: 180 EVGLYKLRSHKDAITGIWCNEVTNNNQEENELDWLISTSKDGLIKIWDLKIQQCVETHIA 239

Query: 420 HTEWVNCVKLHPKSFSCFSCSDDTTIRMWDI 450
           HT    C  L  ++    + S D+ ++ W +
Sbjct: 240 HTG--ECWSLAVRNDLVITTSSDSQVKFWQL 268

 Score = 57.8 bits (138), Expect = 2e-08,   Method: Compositional matrix adjust.
 Identities = 47/179 (26%), Positives = 79/179 (44%), Gaps = 29/179 (16%)

Query: 315 LFTGSYDSTIGIWDLFTGKLIRRLS-------GHSDG-----VKTLYFDDRK----LITG 358
           + TG+ ++ + IWDL TG+L   L+       G  D       +T +    K    L  G
Sbjct: 66  IITGALEN-VNIWDLKTGELASFLNDGLVPPPGSVDAKSSKPAETTFLQHHKETNLLAVG 124

Query: 359 SLDKTIRVWNYITGECISTYRGHSDSV--LSVDSYQKVIVSGSADKTVKVWHVESRT-CY 415
             D  ++VW+  +   +    GHS ++  L  D+    ++SGS D  + VW + S    Y
Sbjct: 125 YNDGVVKVWDLYSKTVLCNLNGHSSAITALKFDTSGTRLISGSRDSNIIVWDLVSEVGLY 184

Query: 416 TLRGHTE-----WVNCVKLHPKSFS----CFSCSDDTTIRMWDIRTNSCLKVFRGHVGQ 465
            LR H +     W N V  + +  +      S S D  I++WD++   C++    H G+
Sbjct: 185 KLRSHKDAITGIWCNEVTNNNQEENELDWLISTSKDGLIKIWDLKIQQCVETHIAHTGE 243

 Score = 55.5 bits (132), Expect = 1e-07,   Method: Compositional matrix adjust.
 Identities = 39/142 (27%), Positives = 65/142 (45%), Gaps = 5/142 (3%)

Query: 313 RLLFTGSYDSTIGIWDLFTGKLIRRLSGHSDGVKTL--YFDDRKLITGSLDKTIRVWNYI 370
           + L     D+T+ ++ L + K    L GH   V ++   FD + +IT S DK I++W   
Sbjct: 582 KFLAVSLLDNTVKVFFLDSMKFFLSLYGHKLPVLSIDISFDSKMIITSSADKNIKIWGLD 641

Query: 371 TGECISTYRGHSDSVLSVDSYQKV--IVSGSADKTVKVWHVESRTCY-TLRGHTEWVNCV 427
            G+C  +   H DS+++V    +     S S D  +K W  +   C   L  H   V  +
Sbjct: 642 FGDCHKSLFAHQDSIMNVKFVPESHNFFSCSKDGIIKYWDGDKFECIQKLAAHQSEVWAL 701

Query: 428 KLHPKSFSCFSCSDDTTIRMWD 449
            +   +    S S D +IR+W+
Sbjct: 702 AIANDASFVVSSSHDHSIRIWE 723

 Score = 53.5 bits (127), Expect = 4e-07,   Method: Compositional matrix adjust.
 Identities = 31/125 (24%), Positives = 59/125 (47%), Gaps = 13/125 (10%)

Query: 298 FKGHMDGVLTLQFNYR--LLFTGSYDSTIGIWDLFTGKLIRRLSGHSDGVKTLYFDDRK- 354
             GH   +  L+F+     L +GS DS I +WDL +   + +L  H D +  ++ ++   
Sbjct: 144 LNGHSSAITALKFDTSGTRLISGSRDSNIIVWDLVSEVGLYKLRSHKDAITGIWCNEVTN 203

Query: 355 ----------LITGSLDKTIRVWNYITGECISTYRGHSDSVLSVDSYQKVIVSGSADKTV 404
                     LI+ S D  I++W+    +C+ T+  H+    S+     ++++ S+D  V
Sbjct: 204 NNQEENELDWLISTSKDGLIKIWDLKIQQCVETHIAHTGECWSLAVRNDLVITTSSDSQV 263

Query: 405 KVWHV 409
           K W +
Sbjct: 264 KFWQL 268

 Score = 46.6 bits (109), Expect = 6e-05,   Method: Compositional matrix adjust.
 Identities = 54/240 (22%), Positives = 100/240 (41%), Gaps = 39/240 (16%)

Query: 351 DDRKLITGSLDKTIRVWNYITGECISTYR-GHSDSVLSVDSYQKVIVSGSADKTVKVWHV 409
           DD KL+  + + ++++WN  T  CI T+  G++ +   +     VI+ G+    ++++ +
Sbjct: 439 DDNKLLATASNGSLKIWNLKTKLCIRTFECGYALTCKFLPGGMLVII-GTRAGELQLFDL 497

Query: 410 ESRT--CYTLRGHTEWVNCVKLHPKSFSCFSCSDDTTIRMWDIRTNSCLKVFRGHVGQVQ 467
            S T        H   +  + L        + S D +++ W+ +               Q
Sbjct: 498 ASSTQIANIEEAHDAAIWSLDLTSDGKRLITGSADKSVKFWNFQLE-------------Q 544

Query: 468 KIIPLTIKDVENLATDNTSDGSSPQDDPTMTDGADESDTPSNEQETVLDENI-PYPTHLL 526
           +++P             TSD   P+            DT     + +L   + P    L 
Sbjct: 545 ELVP------------GTSDKFVPK-------LGLHHDTTLELSDDILSVRVSPEDKFLA 585

Query: 527 SCGLDNTIKLWDVKTGKCIRTQFGHVEGVW--DIAADNFRIISGSHDGSIKVWDLQSGKC 584
              LDNT+K++ + + K   + +GH   V   DI+ D+  II+ S D +IK+W L  G C
Sbjct: 586 VSLLDNTVKVFFLDSMKFFLSLYGHKLPVLSIDISFDSKMIITSSADKNIKIWGLDFGDC 645

 Score = 35.8 bits (81), Expect = 0.13,   Method: Compositional matrix adjust.
 Identities = 23/76 (30%), Positives = 40/76 (52%), Gaps = 11/76 (14%)

Query: 523 THLLSCGLDNTIKLWDVKTGKCI---RTQFGHVEGVW--DIAADNFR------IISGSHD 571
           T L+S   D+ I +WD+ +   +   R+    + G+W  ++  +N        +IS S D
Sbjct: 161 TRLISGSRDSNIIVWDLVSEVGLYKLRSHKDAITGIWCNEVTNNNQEENELDWLISTSKD 220

Query: 572 GSIKVWDLQSGKCMHT 587
           G IK+WDL+  +C+ T
Sbjct: 221 GLIKIWDLKIQQCVET 236

 Score = 32.0 bits (71), Expect = 1.8,   Method: Compositional matrix adjust.
 Identities = 12/32 (37%), Positives = 25/32 (78%), Gaps = 1/32 (3%)

Query: 557 DIAADNFRIISGSHDGSIKVWDLQSGKCMHTF 588
           DI+ DN ++++ + +GS+K+W+L++  C+ TF
Sbjct: 436 DISDDN-KLLATASNGSLKIWNLKTKLCIRTF 466

>Kwal_27.11585
          Length = 823

 Score = 72.4 bits (176), Expect = 5e-13,   Method: Compositional matrix adjust.
 Identities = 86/347 (24%), Positives = 133/347 (38%), Gaps = 81/347 (23%)

Query: 294 RIQEFKGHMDGVLTLQF--NYRLLFTGSYDSTIGIWDLFTG----KLIRRLSGHSDGVKT 347
            ++ ++GH D + +L    N   L T S D T+ +W L       K   R +GH+  V  
Sbjct: 392 EVELYEGHTDLLNSLDSSENGEWLATCSKDHTVILWKLNADSEKFKPYARFTGHAGPVTA 451

Query: 348 LYFDD-------RKLITGSLDKTIRVW-------NYITGECIS----TYRGHSDSV--LS 387
           +   +         +IT S D TI+ W       N +    I     T R H   +  LS
Sbjct: 452 VGLPNVMRNTWPEFIITASNDLTIKKWSVPKPTSNDVDMHNIKVSDYTRRAHEKDINALS 511

Query: 388 VDSYQKVIVSGSADKTVKVWHVESRTCY-TLRGHTEWVNCVKLHPKSFSCFSCSDDTTIR 446
           +     V  + S DKT K+W+V+S     TL  H   +  V          +CS D TI+
Sbjct: 512 ISPNDSVFATASYDKTCKIWNVDSGELEGTLANHKRGLWDVTFCQYDKLLATCSGDKTIK 571

Query: 447 MWDIRTNSCLKVFRGHVGQVQKIIPLTIKDVENLATDNTSDGSSPQDDPTMTDGADESDT 506
           +W + + S +K   GH   VQ+                                   S  
Sbjct: 572 VWSLESMSVVKTLEGHTNAVQRC----------------------------------SFI 597

Query: 507 PSNEQETVLDENIPYPTHLLSCGLDNTIKLWDVKTGKCIRTQFGHVEGVWDIA--ADNFR 564
             N+Q             ++S G D  IK+WD+ TG+CIRT   H   +W ++  +D   
Sbjct: 598 NRNKQ-------------IVSTGADGLIKVWDLSTGECIRTLDAHSNRIWALSVLSDGKE 644

Query: 565 IISGSHDGSIKVW-DLQSGKCMHTFNGRRLQRETQHTQTQSLGDKVA 610
            ++   DG  + W D    +       ++L  E    Q QSL + +A
Sbjct: 645 FVTADADGVFQFWKDCSEEEQKENLENQKLMVE----QEQSLQNYMA 687

 Score = 35.4 bits (80), Expect = 0.15,   Method: Compositional matrix adjust.
 Identities = 18/82 (21%), Positives = 37/82 (45%), Gaps = 6/82 (7%)

Query: 314 LLFTGSYDSTIGIWDLFTGKLIRRLSGHSDGVKTLYFDDR------KLITGSLDKTIRVW 367
           L+  G  D ++ + D+  G +     GH   + ++ F         +L +G     ++VW
Sbjct: 115 LVALGGTDGSVTVVDIENGYVTHSFKGHGATISSVKFHGEQSGSIWRLASGDTSGMVKVW 174

Query: 368 NYITGECISTYRGHSDSVLSVD 389
           + +   CI T + H+ +V  +D
Sbjct: 175 DLVRRNCIHTIQEHAAAVRGLD 196

 Score = 35.0 bits (79), Expect = 0.19,   Method: Compositional matrix adjust.
 Identities = 21/90 (23%), Positives = 43/90 (47%), Gaps = 5/90 (5%)

Query: 385 VLSVDSYQKVIVSGSADKTVKVWHVES-RTCYTLRGHTEWVNCVKLHPKSFSCF--SCSD 441
           V+  DS   ++  G  D +V V  +E+    ++ +GH   ++ VK H +         S 
Sbjct: 106 VMDCDSSSTLVALGGTDGSVTVVDIENGYVTHSFKGHGATISSVKFHGEQSGSIWRLASG 165

Query: 442 DTT--IRMWDIRTNSCLKVFRGHVGQVQKI 469
           DT+  +++WD+   +C+   + H   V+ +
Sbjct: 166 DTSGMVKVWDLVRRNCIHTIQEHAAAVRGL 195

 Score = 35.0 bits (79), Expect = 0.21,   Method: Compositional matrix adjust.
 Identities = 20/86 (23%), Positives = 37/86 (43%), Gaps = 16/86 (18%)

Query: 519 IPYPTHLLSC----------GLDNTIKLWDVKTGKCIRTQFGHVEGVWDI------AADN 562
           +  P +++ C          G D ++ + D++ G    +  GH   +  +      +   
Sbjct: 100 VSSPVYVMDCDSSSTLVALGGTDGSVTVVDIENGYVTHSFKGHGATISSVKFHGEQSGSI 159

Query: 563 FRIISGSHDGSIKVWDLQSGKCMHTF 588
           +R+ SG   G +KVWDL    C+HT 
Sbjct: 160 WRLASGDTSGMVKVWDLVRRNCIHTI 185

 Score = 30.4 bits (67), Expect = 5.3,   Method: Compositional matrix adjust.
 Identities = 20/83 (24%), Positives = 39/83 (46%), Gaps = 1/83 (1%)

Query: 509 NEQETVLDENIPYPTHLLSCGLDNTIKLWDVKTGKCIRT-QFGHVEGVWDIAADNFRIIS 567
           +EQE    +  P   +L        ++++ + + K IR+ +      V D  + +  +  
Sbjct: 59  DEQEITALKLTPNGEYLCFVSQAQLLRIYKLSSKKIIRSMKVSSPVYVMDCDSSSTLVAL 118

Query: 568 GSHDGSIKVWDLQSGKCMHTFNG 590
           G  DGS+ V D+++G   H+F G
Sbjct: 119 GGTDGSVTVVDIENGYVTHSFKG 141

>YLR222C (UTP13) [3622] chr12 complement(579320..581773) Component
           of U3 snoRNP (also called small subunit processome),
           which is required for 18S rRNA biogenesis,
           overproduction causes chromosome instability and
           increased mitotic recombination, contains WD (WD-40)
           repeats [2454 bp, 817 aa]
          Length = 817

 Score = 72.4 bits (176), Expect = 5e-13,   Method: Compositional matrix adjust.
 Identities = 40/115 (34%), Positives = 56/115 (48%), Gaps = 3/115 (2%)

Query: 351 DDRKLITGSLDKTIRVWNYITGECISTYRGHSDSVLSVD--SYQKVIVSGSADKTVKVWH 408
           +D    T S DKT ++WN   GE  +T   H   +  V    Y K++ + S DKTVK+W 
Sbjct: 502 NDSIFATASYDKTCKIWNLENGELEATLANHKRGLWDVSFCQYDKLLATSSGDKTVKIWS 561

Query: 409 VESRTCY-TLRGHTEWVNCVKLHPKSFSCFSCSDDTTIRMWDIRTNSCLKVFRGH 462
           +++ +   TL GHT  V       K     SC  D  I++WD  +  CLK   GH
Sbjct: 562 LDTFSVMKTLEGHTNAVQRCSFINKQKQLISCGADGLIKIWDCSSGECLKTLDGH 616

 Score = 66.6 bits (161), Expect = 3e-11,   Method: Compositional matrix adjust.
 Identities = 48/164 (29%), Positives = 76/164 (46%), Gaps = 9/164 (5%)

Query: 294 RIQEFKGHMD----GVLTLQFNYRLLFTGSYDSTIGIWDLFTGKLIRRLSGHSDGVKTLY 349
           ++ E+  H        L++  N  +  T SYD T  IW+L  G+L   L+ H  G+  + 
Sbjct: 481 KVSEYTRHAHEKDINALSVSPNDSIFATASYDKTCKIWNLENGELEATLANHKRGLWDVS 540

Query: 350 F--DDRKLITGSLDKTIRVWNYITGECISTYRGHSDSV--LSVDSYQKVIVSGSADKTVK 405
           F   D+ L T S DKT+++W+  T   + T  GH+++V   S  + QK ++S  AD  +K
Sbjct: 541 FCQYDKLLATSSGDKTVKIWSLDTFSVMKTLEGHTNAVQRCSFINKQKQLISCGADGLIK 600

Query: 406 VWHVESRTCY-TLRGHTEWVNCVKLHPKSFSCFSCSDDTTIRMW 448
           +W   S  C  TL GH   +  +          S   D   + W
Sbjct: 601 IWDCSSGECLKTLDGHNNRLWALSTMNDGDMIVSADADGVFQFW 644

 Score = 65.5 bits (158), Expect = 8e-11,   Method: Compositional matrix adjust.
 Identities = 62/266 (23%), Positives = 109/266 (40%), Gaps = 35/266 (13%)

Query: 340 GHSDGVKTLYFDDRKL--ITGSLDKTIRVWNYITGEC----ISTYRGHSDSVLSV----- 388
           GH D + +L   +  L   T S D T  VW Y    C     + Y GHS +V +V     
Sbjct: 386 GHEDLLNSLDATEDGLWIATASKDNTAIVWRYNENSCKFDIYAKYIGHSAAVTAVGLPNI 445

Query: 389 --DSYQKVIVSGSADKTVKVWHVESRTC-----------YTLRGHTEWVNCVKLHPKSFS 435
               Y + +++ S D T+K W +   T            YT   H + +N + + P    
Sbjct: 446 VSKGYPEFLLTASNDLTIKKWIIPKPTASMDVQIIKVSEYTRHAHEKDINALSVSPNDSI 505

Query: 436 CFSCSDDTTIRMWDIRTNSCLKVFRGHVGQVQKIIPLTIKDVENLATDNTSDGSSP--QD 493
             + S D T ++W++           H    + +  ++    + L   ++ D +      
Sbjct: 506 FATASYDKTCKIWNLENGELEATLANHK---RGLWDVSFCQYDKLLATSSGDKTVKIWSL 562

Query: 494 DPTMTDGADESDTPSNEQETVLDENIPYPTHLLSCGLDNTIKLWDVKTGKCIRTQFGHVE 553
           D        E  T + ++ + +++       L+SCG D  IK+WD  +G+C++T  GH  
Sbjct: 563 DTFSVMKTLEGHTNAVQRCSFINKQ----KQLISCGADGLIKIWDCSSGECLKTLDGHNN 618

Query: 554 GVWDIAA--DNFRIISGSHDGSIKVW 577
            +W ++   D   I+S   DG  + W
Sbjct: 619 RLWALSTMNDGDMIVSADADGVFQFW 644

 Score = 60.1 bits (144), Expect = 3e-09,   Method: Compositional matrix adjust.
 Identities = 67/242 (27%), Positives = 108/242 (44%), Gaps = 33/242 (13%)

Query: 375 ISTYRGHSDSVLSVDSYQKV--IVSGSADKTVKVWHVESRTC-----YTLRGHTEWVNCV 427
           +  Y GH D + S+D+ +    I + S D T  VW     +C         GH+  V  V
Sbjct: 381 VEIYEGHEDLLNSLDATEDGLWIATASKDNTAIVWRYNENSCKFDIYAKYIGHSAAVTAV 440

Query: 428 KLH---PKSFSCF--SCSDDTTIRMWDI-RTNSCLKVFRGHVGQVQKIIPLT----IKDV 477
            L     K +  F  + S+D TI+ W I +  + + V      Q+ K+   T     KD+
Sbjct: 441 GLPNIVSKGYPEFLLTASNDLTIKKWIIPKPTASMDV------QIIKVSEYTRHAHEKDI 494

Query: 478 ENLATD-NTSDGSSPQDDPT-----MTDGADESDTPSNEQETVLDENI-PYPTHLLSCGL 530
             L+   N S  ++   D T     + +G  E+ T +N +  + D +   Y   L +   
Sbjct: 495 NALSVSPNDSIFATASYDKTCKIWNLENGELEA-TLANHKRGLWDVSFCQYDKLLATSSG 553

Query: 531 DNTIKLWDVKTGKCIRTQFGHVEGVWDIAADNFR--IISGSHDGSIKVWDLQSGKCMHTF 588
           D T+K+W + T   ++T  GH   V   +  N +  +IS   DG IK+WD  SG+C+ T 
Sbjct: 554 DKTVKIWSLDTFSVMKTLEGHTNAVQRCSFINKQKQLISCGADGLIKIWDCSSGECLKTL 613

Query: 589 NG 590
           +G
Sbjct: 614 DG 615

 Score = 44.3 bits (103), Expect = 3e-04,   Method: Compositional matrix adjust.
 Identities = 54/246 (21%), Positives = 102/246 (41%), Gaps = 53/246 (21%)

Query: 304 GVLTLQFNYRLLFTGSYDSTIGIWDLFTG--KLIRRLSGHSDGVKT---LYFDDRKLITG 358
            V T+  N ++L T   D  I I DL  G  K++ ++S   +   T   L  D + L   
Sbjct: 21  AVATVSENGKILATPVLDE-INIIDLTPGSRKILHKISNEDEQEITALKLTPDGQYLTYV 79

Query: 359 SLDKTIRVWNYITGECISTYRGHSDS-VLSVDSYQKVIVSGSADKTVKVWHVES-RTCYT 416
           S  + +++++  TG+ + + +  S S +L  DS   ++  G  D ++ V  +E+    ++
Sbjct: 80  SQAQLLKIFHLKTGKVVRSMKISSPSYILDADSTSTLLAVGGTDGSIIVVDIENGYITHS 139

Query: 417 LRGHTEWVNCVK----LHPKSFSCFSCSDDTTIRMWDIRTNSCLKVFRGHVGQVQKIIPL 472
            +GH   ++ +K    L+ K +   S   +  +++WD+    CL   + H   V+     
Sbjct: 140 FKGHGGTISSLKFYGQLNSKIWLLASGDTNGMVKVWDLVKRKCLHTLQEHTSAVR----- 194

Query: 473 TIKDVENLATDNTSDGSSPQDDPTMTDGADESDTPSNEQETVLDENIPYPTHLLSCGLDN 532
                                      G D  + P N++ ++         +LLS G D+
Sbjct: 195 ---------------------------GLDIIEVPDNDEPSL---------NLLSGGRDD 218

Query: 533 TIKLWD 538
            I LWD
Sbjct: 219 IINLWD 224

 Score = 36.6 bits (83), Expect = 0.074,   Method: Compositional matrix adjust.
 Identities = 23/83 (27%), Positives = 41/83 (49%), Gaps = 1/83 (1%)

Query: 509 NEQETVLDENIPYPTHLLSCGLDNTIKLWDVKTGKCIRT-QFGHVEGVWDIAADNFRIIS 567
           +EQE    +  P   +L        +K++ +KTGK +R+ +      + D  + +  +  
Sbjct: 60  DEQEITALKLTPDGQYLTYVSQAQLLKIFHLKTGKVVRSMKISSPSYILDADSTSTLLAV 119

Query: 568 GSHDGSIKVWDLQSGKCMHTFNG 590
           G  DGSI V D+++G   H+F G
Sbjct: 120 GGTDGSIIVVDIENGYITHSFKG 142

 Score = 34.7 bits (78), Expect = 0.30,   Method: Compositional matrix adjust.
 Identities = 21/72 (29%), Positives = 35/72 (48%), Gaps = 6/72 (8%)

Query: 523 THLLSCGLDNTIKLWDVKTGKCIRTQFGH------VEGVWDIAADNFRIISGSHDGSIKV 576
           T L   G D +I + D++ G    +  GH      ++    + +  + + SG  +G +KV
Sbjct: 115 TLLAVGGTDGSIIVVDIENGYITHSFKGHGGTISSLKFYGQLNSKIWLLASGDTNGMVKV 174

Query: 577 WDLQSGKCMHTF 588
           WDL   KC+HT 
Sbjct: 175 WDLVKRKCLHTL 186

>YKL213C (DOA1) [3062] chr11 complement(31961..34108) Protein
           required in ubiquitin proteolysis and found complexed
           with Cdc48p, has WD (WD-40) repeats [2148 bp, 715 aa]
          Length = 715

 Score = 72.0 bits (175), Expect = 7e-13,   Method: Compositional matrix adjust.
 Identities = 58/169 (34%), Positives = 86/169 (50%), Gaps = 22/169 (13%)

Query: 300 GHMDGVLTLQFNYRLLFTGSYDSTIGIWDLFTGKLIRRLSGHSDGV---KTLYFDDRKLI 356
           GH   V +L F   ++ +GS+D T  +W    G L+  L  H+  V   K + F + K +
Sbjct: 97  GHQGNVCSLSFQDGVVISGSWDKTAKVWK--EGSLVYNLQAHNASVWDAKVVSFSENKFL 154

Query: 357 TGSLDKTIRVWNYITGECISTYRG-HSDSV--LSV--DSYQKVIVSGSADKTVKVWHVES 411
           T S DKTI++W     + I T+ G H+D V  L+V  D +    +S S D  +K+  V+ 
Sbjct: 155 TASADKTIKLWQ--NDKVIKTFSGIHNDVVRHLAVVDDGH---FISCSNDGLIKL--VDM 207

Query: 412 RTCYTLR---GHTEWVNCVKLHPKSFSCFSCSDDTTIRMWDIRTNSCLK 457
            T   LR   GH  +V C+KL P      SC +D T+R+W  + N  LK
Sbjct: 208 HTGDVLRTYEGHESFVYCIKLLPNG-DIVSCGEDRTVRIWS-KENGSLK 254

 Score = 57.4 bits (137), Expect = 3e-08,   Method: Compositional matrix adjust.
 Identities = 59/208 (28%), Positives = 85/208 (40%), Gaps = 52/208 (25%)

Query: 377 TYRGHSDSVLSVDSYQKVIVSGSADKTVKVWHVESRTCYTLRGHTEWVNCVKLHPKSFSC 436
           T  GH  +V S+     V++SGS DKT KVW  E    Y L+ H   V   K+   S + 
Sbjct: 94  TLIGHQGNVCSLSFQDGVVISGSWDKTAKVWK-EGSLVYNLQAHNASVWDAKVVSFSENK 152

Query: 437 F-SCSDDTTIRMWDIRTNSCLKVFRGHVGQVQKIIPLTIKDVENLATDNTSDGSSPQDDP 495
           F + S D TI++W  + +  +K F G    V          V +LA              
Sbjct: 153 FLTASADKTIKLW--QNDKVIKTFSGIHNDV----------VRHLA-------------- 186

Query: 496 TMTDGADESDTPSNEQETVLDENIPYPTHLLSCGLDNTIKLWDVKTGKCIRTQFGHVEGV 555
            + DG                       H +SC  D  IKL D+ TG  +RT  GH   V
Sbjct: 187 VVDDG-----------------------HFISCSNDGLIKLVDMHTGDVLRTYEGHESFV 223

Query: 556 WDIA-ADNFRIISGSHDGSIKVWDLQSG 582
           + I    N  I+S   D ++++W  ++G
Sbjct: 224 YCIKLLPNGDIVSCGEDRTVRIWSKENG 251

>CAGL0C00737g complement(75028..77478) similar to tr|Q05946
           Saccharomyces cerevisiae YLR222c, hypothetical start
          Length = 816

 Score = 72.0 bits (175), Expect = 8e-13,   Method: Compositional matrix adjust.
 Identities = 59/193 (30%), Positives = 83/193 (43%), Gaps = 24/193 (12%)

Query: 298 FKGHMDGVL------TLQFNY-RLLFTGSYDSTIGIW-------DLFTGKLIRRLS---- 339
           F GH   V        ++ NY + + T S D T+  W       DL     I + S    
Sbjct: 432 FVGHAASVSAVCLPNVMEKNYPKYIITASNDLTVKKWEIPPMKNDLNEVPFIVKSSIYTR 491

Query: 340 -GHSDGVKTLYF--DDRKLITGSLDKTIRVWNYITGECISTYRGHSDSVLSVD--SYQKV 394
             H   +  +    +D    T S DKT ++WN  TGE ++T   H   +  V     +K 
Sbjct: 492 HAHEKDINAISMAPNDSIFATASYDKTCKLWNVDTGEPVATLANHKRGLWDVSFCESEKW 551

Query: 395 IVSGSADKTVKVWHVESRTCY-TLRGHTEWVNCVKLHPKSFSCFSCSDDTTIRMWDIRTN 453
           I + S DKTVK+W +ES T   TL GHT  V       K     S   D  I++WDI + 
Sbjct: 552 IATCSGDKTVKIWSLESFTVLKTLEGHTNAVQRCSFMNKQKQLVSAGADGLIKVWDIASG 611

Query: 454 SCLKVFRGHVGQV 466
            C+K   GH  ++
Sbjct: 612 DCIKNLDGHSNRI 624

 Score = 67.0 bits (162), Expect = 3e-11,   Method: Compositional matrix adjust.
 Identities = 68/303 (22%), Positives = 125/303 (41%), Gaps = 36/303 (11%)

Query: 335 IRRLSGHSDGVKTLYF--DDRKLITGSLDKTIRVWNYITGE----CISTYRGHSDSVLSV 388
           +    GHSD + +L    D + L T S DKT  +W++          +T+ GH+ SV +V
Sbjct: 383 VNLYEGHSDLLNSLACTEDGQWLATASKDKTAILWHWNNTSKRFYIYATFVGHAASVSAV 442

Query: 389 -------DSYQKVIVSGSADKTVKVWHVE-------------SRTCYTLRGHTEWVNCVK 428
                   +Y K I++ S D TVK W +                + YT   H + +N + 
Sbjct: 443 CLPNVMEKNYPKYIITASNDLTVKKWEIPPMKNDLNEVPFIVKSSIYTRHAHEKDINAIS 502

Query: 429 LHPKSFSCFSCSDDTTIRMWDIRTNSCLKVFRGHVGQVQKI-IPLTIKDVENLATDNTSD 487
           + P      + S D T ++W++ T   +     H   +  +    + K +   + D T  
Sbjct: 503 MAPNDSIFATASYDKTCKLWNVDTGEPVATLANHKRGLWDVSFCESEKWIATCSGDKTVK 562

Query: 488 GSSPQDDPTMTDGADESDTPSNEQETVLDENIPYPTHLLSCGLDNTIKLWDVKTGKCIRT 547
             S +    +     E  T + ++ + +++       L+S G D  IK+WD+ +G CI+ 
Sbjct: 563 IWSLESFTVLK--TLEGHTNAVQRCSFMNKQ----KQLVSAGADGLIKVWDIASGDCIKN 616

Query: 548 QFGHVEGVWDIAA--DNFRIISGSHDGSIKVW-DLQSGKCMHTFNGRRLQRETQHTQTQS 604
             GH   +W ++   D   IIS   D   + W D    +        +++ E + + T  
Sbjct: 617 LDGHSNRIWALSVLEDGDLIISADADSVFQFWKDCTEAEIQGALEENKVRVEQEQSLTNY 676

Query: 605 LGD 607
           + +
Sbjct: 677 MNN 679

 Score = 58.9 bits (141), Expect = 1e-08,   Method: Compositional matrix adjust.
 Identities = 34/119 (28%), Positives = 61/119 (51%), Gaps = 6/119 (5%)

Query: 295 IQEFKGHMDGVLTLQF--NYRLLFTGSYDSTIGIWDLFTGKLIRRLSGHSDGVKTLYF-- 350
           +     H  G+  + F  + + + T S D T+ IW L +  +++ L GH++ V+   F  
Sbjct: 530 VATLANHKRGLWDVSFCESEKWIATCSGDKTVKIWSLESFTVLKTLEGHTNAVQRCSFMN 589

Query: 351 DDRKLITGSLDKTIRVWNYITGECISTYRGHSDSV--LSVDSYQKVIVSGSADKTVKVW 407
             ++L++   D  I+VW+  +G+CI    GHS+ +  LSV     +I+S  AD   + W
Sbjct: 590 KQKQLVSAGADGLIKVWDIASGDCIKNLDGHSNRIWALSVLEDGDLIISADADSVFQFW 648

 Score = 42.4 bits (98), Expect = 0.001,   Method: Compositional matrix adjust.
 Identities = 36/188 (19%), Positives = 77/188 (40%), Gaps = 20/188 (10%)

Query: 305 VLTLQFNYRLLFTGSYDSTIGIWDLFTGKLIRRLSGHSDGVKTLYFDDRK------LITG 358
           V+T      L+  G  D +I + D+  G +     GH   + +L F          L +G
Sbjct: 108 VMTCDPTSTLVAIGGTDGSITVIDIENGYIAHSFKGHGGTISSLKFYGELGTNIWLLGSG 167

Query: 359 SLDKTIRVWNYITGECISTYRGHSDSVLSVDSYQK------VIVSGSADKTVKVWHVE-- 410
             +   +VW+ +T +C  T + HS ++  +D  +        +++G  D  + +W     
Sbjct: 168 DTNGMAKVWDLVTRKCKFTVQEHSSAIRGIDFTKNDDKDVLNLITGGRDNVLNLWRFNIK 227

Query: 411 ---SRTCYTLRGHTEWVNCVKL-HPKSFSCFSCSDDTTIRMWDIRTNSCLKVFRGHVGQ- 465
              S+   T+  H +   C  + H      ++   D   ++ D+  +S +K  +  + + 
Sbjct: 228 GKSSKLVKTIPAHLQIEACGFITHNDETFAYTAGGDAVFQIIDLNESSVVKCTKKPIEEL 287

Query: 466 -VQKIIPL 472
            +  +IP+
Sbjct: 288 FITGVIPI 295

 Score = 30.4 bits (67), Expect = 4.9,   Method: Compositional matrix adjust.
 Identities = 20/85 (23%), Positives = 40/85 (47%), Gaps = 16/85 (18%)

Query: 519 IPYPTHLLSC----------GLDNTIKLWDVKTGKCIRTQFGH------VEGVWDIAADN 562
           +  P+++++C          G D +I + D++ G    +  GH      ++   ++  + 
Sbjct: 102 VSSPSYVMTCDPTSTLVAIGGTDGSITVIDIENGYIAHSFKGHGGTISSLKFYGELGTNI 161

Query: 563 FRIISGSHDGSIKVWDLQSGKCMHT 587
           + + SG  +G  KVWDL + KC  T
Sbjct: 162 WLLGSGDTNGMAKVWDLVTRKCKFT 186

 Score = 30.0 bits (66), Expect = 6.7,   Method: Compositional matrix adjust.
 Identities = 22/84 (26%), Positives = 38/84 (45%), Gaps = 1/84 (1%)

Query: 508 SNEQETVLDENIPYPTHLLSCGLDNTIKLWDVKTGKCIRT-QFGHVEGVWDIAADNFRII 566
           ++EQE       P   +L+       +K+ +V+TG   R+ +      V      +  + 
Sbjct: 60  ADEQEITGISLTPDGKYLIYVSQSQLVKIVNVETGVITRSLKVSSPSYVMTCDPTSTLVA 119

Query: 567 SGSHDGSIKVWDLQSGKCMHTFNG 590
            G  DGSI V D+++G   H+F G
Sbjct: 120 IGGTDGSITVIDIENGYIAHSFKG 143

>YCR084C (TUP1) [608] chr3 complement(260307..262448) General
           repressor of RNA polymerase II transcription that is
           brought to target promoters by regulated,
           sequence-specific DNA-binding proteins, exists in a
           complex with Ssn6p that is converted to a
           transcriptional activator in a Hog1p-dependent manner
           [2142 bp, 713 aa]
          Length = 713

 Score = 71.6 bits (174), Expect = 1e-12,   Method: Compositional matrix adjust.
 Identities = 73/288 (25%), Positives = 116/288 (40%), Gaps = 61/288 (21%)

Query: 313 RLLFTGSYDSTIGIWDLFTGKLIRRLSGHSDGVKTL-YF-DDRKLITGSLDKTIRVWNYI 370
           + L TG+ D  I IWD+   K++  L GH   + +L YF    KL++GS D+T+R+W+  
Sbjct: 456 KFLATGAEDRLIRIWDIENRKIVMILQGHEQDIYSLDYFPSGDKLVSGSGDRTVRIWDLR 515

Query: 371 TGECISTYRGHSDSVLSVDSYQ---KVIVSGSADKTVKVWHVESRTCYTLR--------- 418
           TG+C S      D V +V       K I +GS D+ V+VW  +S T + +          
Sbjct: 516 TGQC-SLTLSIEDGVTTVAVSPGDGKYIAAGSLDRAVRVW--DSETGFLVERLDSENESG 572

Query: 419 -GHTEWVNCVKLHPKSFSCFSCSDDTTIRMWDIRTNSCLKVFRGHVGQVQKIIPLTIKDV 477
            GH + V  V       S  S S D ++++W+++                          
Sbjct: 573 TGHKDSVYSVVFTRDGQSVVSGSLDRSVKLWNLQN------------------------- 607

Query: 478 ENLATDNTSDGSSPQDDPTMTDGADESDTPSNEQETVLDENIPYPTHLLSCGLDNTIKLW 537
                +N SD  +P             D   +   T  DE      ++LS   D  +  W
Sbjct: 608 ----ANNKSDSKTPNSGTCEVTYIGHKDFVLSVATTQNDE------YILSGSKDRGVLFW 657

Query: 538 DVKTGKCIRTQFGHVEGVWDIAADN-------FRIIS-GSHDGSIKVW 577
           D K+G  +    GH   V  +A  N       + + + GS D   ++W
Sbjct: 658 DKKSGNPLLMLQGHRNSVISVAVANGSPLGPEYNVFATGSGDCKARIW 705

 Score = 67.4 bits (163), Expect = 2e-11,   Method: Compositional matrix adjust.
 Identities = 61/266 (22%), Positives = 103/266 (38%), Gaps = 71/266 (26%)

Query: 351 DDRKLITGSLDKTIRVWNYITGECISTYRGHSDSVLSVDSYQK--VIVSGSADKTVKVWH 408
           D + L TG+ D+ IR+W+    + +   +GH   + S+D +     +VSGS D+TV++W 
Sbjct: 454 DGKFLATGAEDRLIRIWDIENRKIVMILQGHEQDIYSLDYFPSGDKLVSGSGDRTVRIWD 513

Query: 409 VESRTCYTLRGHTEWVNCVKLHPKSFSCFSC-SDDTTIRMWDIRTNSCLKVF-------R 460
           + +  C       + V  V + P      +  S D  +R+WD  T   ++          
Sbjct: 514 LRTGQCSLTLSIEDGVTTVAVSPGDGKYIAAGSLDRAVRVWDSETGFLVERLDSENESGT 573

Query: 461 GHVGQVQKIIPLTIKDVENLATDNTSDGSSPQDDPTMTDGADESDTPSNEQETVLDENIP 520
           GH   V  ++              T DG S                              
Sbjct: 574 GHKDSVYSVV-------------FTRDGQS------------------------------ 590

Query: 521 YPTHLLSCGLDNTIKLWDVK------------TGKCIRTQFGHVEGVWDIAA--DNFRII 566
               ++S  LD ++KLW+++            +G C  T  GH + V  +A   ++  I+
Sbjct: 591 ----VVSGSLDRSVKLWNLQNANNKSDSKTPNSGTCEVTYIGHKDFVLSVATTQNDEYIL 646

Query: 567 SGSHDGSIKVWDLQSGKCMHTFNGRR 592
           SGS D  +  WD +SG  +    G R
Sbjct: 647 SGSKDRGVLFWDKKSGNPLLMLQGHR 672

 Score = 35.8 bits (81), Expect = 0.10,   Method: Compositional matrix adjust.
 Identities = 25/89 (28%), Positives = 39/89 (43%), Gaps = 11/89 (12%)

Query: 291 GHCRIQEFKGHMDGVLTLQF--NYRLLFTGSYDSTIGIWDLFTGKLIRRLSGHSDGVKTL 348
           G C +  + GH D VL++    N   + +GS D  +  WD  +G  +  L GH + V ++
Sbjct: 620 GTCEVT-YIGHKDFVLSVATTQNDEYILSGSKDRGVLFWDKKSGNPLLMLQGHRNSVISV 678

Query: 349 YFDD--------RKLITGSLDKTIRVWNY 369
              +            TGS D   R+W Y
Sbjct: 679 AVANGSPLGPEYNVFATGSGDCKARIWKY 707

>CAGL0K00275g complement(25300..27447) similar to sp|P36037
           Saccharomyces cerevisiae YKL213c DOA1, hypothetical
           start
          Length = 715

 Score = 71.2 bits (173), Expect = 1e-12,   Method: Compositional matrix adjust.
 Identities = 54/156 (34%), Positives = 76/156 (48%), Gaps = 11/156 (7%)

Query: 300 GHMDGVLTLQFNYRLLFTGSYDSTIGIWDLFTGKLIRRLSGHSDGV--KTLYFDDRKLIT 357
           GH   V  L+F   LL + S+D T  IWD    KL   L  H   V   T+  DD  ++T
Sbjct: 100 GHTGNVCGLRFQNGLLLSSSWDKTAKIWD--NNKLKYDLRNHEASVWDSTMVSDDI-ILT 156

Query: 358 GSLDKTIRVWNYITGECISTYRGHSDSVLSVDSY--QKVIVSGSADKTVKVWHVESRTCY 415
            S DK+I VW  + G+ I       D V+    Y    +  S S D T+K+ ++E     
Sbjct: 157 ASADKSIGVW--MEGKLIKKLSNIHDDVIRHLEYISNDIFASCSNDGTIKLLNLEGEIKN 214

Query: 416 TLRGHTEWVNCVKLHPKSFSCFSCSDDTTIRMWDIR 451
              GH  +V CVK H  + + FSC +D+T+R+W I 
Sbjct: 215 VFEGHESFVYCVK-HMNN-TLFSCGEDSTVRIWSIN 248

 Score = 58.5 bits (140), Expect = 1e-08,   Method: Compositional matrix adjust.
 Identities = 43/137 (31%), Positives = 67/137 (48%), Gaps = 6/137 (4%)

Query: 314 LLFTGSYDSTIGIWDLFTGKLIRRLSG-HSDGVKTL-YFDDRKLITGSLDKTIRVWNYIT 371
           ++ T S D +IG+W    GKLI++LS  H D ++ L Y  +    + S D TI++ N + 
Sbjct: 153 IILTASADKSIGVW--MEGKLIKKLSNIHDDVIRHLEYISNDIFASCSNDGTIKLLN-LE 209

Query: 372 GECISTYRGHSDSVLSVDSYQKVIVSGSADKTVKVWHVESRTCYTLRGHTEWVNCVKLHP 431
           GE  + + GH   V  V      + S   D TV++W +   T   +R     V  + L P
Sbjct: 210 GEIKNVFEGHESFVYCVKHMNNTLFSCGEDSTVRIWSINGSTKQVIRIPAVSVWNLDLLP 269

Query: 432 KSFSCFSCSDDTTIRMW 448
                  CSD+ TIR++
Sbjct: 270 NGDFVICCSDN-TIRIF 285

 Score = 46.2 bits (108), Expect = 7e-05,   Method: Compositional matrix adjust.
 Identities = 70/272 (25%), Positives = 110/272 (40%), Gaps = 50/272 (18%)

Query: 333 KLIRRLSGHSDGVKTL-YFDDRKLITGSLDKTIRVWN-YITGECISTYRGHSDSVLSVDS 390
           +L   L GHS  VK +   +D K+ + S D ++RVW    +G+        SD  L+   
Sbjct: 3   QLSATLRGHSQDVKDITAVNDNKIASVSRDGSLRVWTRSSSGDWEDVLVYQSDKFLNAVC 62

Query: 391 YQKV---IVSGSADKTVKVWHVE------SRTCYTLRGHTEWVNCVKLHPKSFSCFSCSD 441
           Y K    +  G  D  +   H+E      +   YTL GHT   N   L  ++    S S 
Sbjct: 63  YDKTSQTVYYGGQDTLINGSHIEDVIGSSADPMYTLVGHTG--NVCGLRFQNGLLLSSSW 120

Query: 442 DTTIRMWDIRTNSCLKV-FRGHVGQVQKIIPLTIKDVENLATDNTSDGSSPQDDPTMTDG 500
           D T ++WD   N+ LK   R H   V                    D +   DD  +T  
Sbjct: 121 DKTAKIWD---NNKLKYDLRNHEASVW-------------------DSTMVSDDIILTAS 158

Query: 501 ADES----------DTPSNEQETVLDENIPYPTH--LLSCGLDNTIKLWDVKTGKCIRTQ 548
           AD+S             SN  + V+  ++ Y ++    SC  D TIKL +++ G+     
Sbjct: 159 ADKSIGVWMEGKLIKKLSNIHDDVI-RHLEYISNDIFASCSNDGTIKLLNLE-GEIKNVF 216

Query: 549 FGHVEGVWDIAADNFRIISGSHDGSIKVWDLQ 580
            GH   V+ +   N  + S   D ++++W + 
Sbjct: 217 EGHESFVYCVKHMNNTLFSCGEDSTVRIWSIN 248

>AER337W [2838] [Homologous to ScYOR272W (YTM1) - SH]
           complement(1256750..1258087) [1338 bp, 445 aa]
          Length = 445

 Score = 70.5 bits (171), Expect = 1e-12,   Method: Compositional matrix adjust.
 Identities = 84/336 (25%), Positives = 141/336 (41%), Gaps = 48/336 (14%)

Query: 303 DGVLTLQFNYRLLFTGSYDSTIGIWDLFTGKLIRRLSGHSDGVKTLYF-DDRKLITGSLD 361
           D V  L      + +GSYD  +  W+L +GK+ ++ SGH+  V+ + F    +L++G  D
Sbjct: 104 DWVSALDVGAERIVSGSYDGVVRTWNL-SGKIEKQYSGHTGAVRAVKFISSTRLVSGGND 162

Query: 362 KTIRVWNYITGEC--------------ISTYRGHSDSVLSVDSYQKVIVSGSADKTVKVW 407
           +T+R+W     +               ++   GH   V+SVD     I+S S D ++  W
Sbjct: 163 RTLRLWKTKNDDVKHVDELEGTEEAHTLAILEGHQAPVVSVDVQGDRILSASYDNSIGFW 222

Query: 408 HVESRTCYTLRGHTEWVNCVKLHPKSFSCFSCSDDTTIRMWDIRTNSCLKVFRGHVGQVQ 467
               +    +           L  K+ S        T++   +R  + L +   H   V+
Sbjct: 223 STNHKDMTAVDPMDS------LGDKASSAAKKRRKLTMKDGSVRRRAPLSLLESHKAPVE 276

Query: 468 KIIPLTIKDVENLATDNTSDGSSPQDDPTMTDGADES---DTPSNEQETVLDENIPYPTH 524
           ++I          + D+T   S  QD    T     S   DT S     +    +P    
Sbjct: 277 QVI--------FASNDSTVAYSVSQDHTIKTWDLVTSRCVDTKSTSYSLLSMVELP-KLR 327

Query: 525 LLSCGLDNT-IKLWDVK---TGKCIRTQF-GHVEGV--WDIAADN-FRIISGSHDGSIKV 576
           LL+CG     I L D +   + K  + Q  GH   V   D   +N + + S SHDG++KV
Sbjct: 328 LLACGSSARHITLHDPRADSSAKITQQQLLGHKNFVVALDTCPENEYMLCSASHDGTVKV 387

Query: 577 WDLQSGKCMHTFNGRRLQRETQHTQTQSLGDKVAPI 612
           WD++S   ++T     + RE Q  + + + DKV  +
Sbjct: 388 WDIRSSSSIYT-----ITREDQSVE-KGINDKVFAV 417

 Score = 43.1 bits (100), Expect = 5e-04,   Method: Compositional matrix adjust.
 Identities = 50/211 (23%), Positives = 85/211 (40%), Gaps = 59/211 (27%)

Query: 298 FKGHMDGVLTLQFNYRLLFTGSYDSTIGIWD----------------------------- 328
            +GH   V+++      + + SYD++IG W                              
Sbjct: 193 LEGHQAPVVSVDVQGDRILSASYDNSIGFWSTNHKDMTAVDPMDSLGDKASSAAKKRRKL 252

Query: 329 -LFTGKLIRR-----LSGHSDGVKTLYF---DDRKLITGSLDKTIRVWNYITGECISTYR 379
            +  G + RR     L  H   V+ + F   D     + S D TI+ W+ +T  C+ T +
Sbjct: 253 TMKDGSVRRRAPLSLLESHKAPVEQVIFASNDSTVAYSVSQDHTIKTWDLVTSRCVDT-K 311

Query: 380 GHSDSVLSVDSYQK--VIVSGS-----------ADKTVKVWHVESRTCYTLRGHTEWVNC 426
             S S+LS+    K  ++  GS           AD + K+      T   L GH  +V  
Sbjct: 312 STSYSLLSMVELPKLRLLACGSSARHITLHDPRADSSAKI------TQQQLLGHKNFVVA 365

Query: 427 VKLHPKS-FSCFSCSDDTTIRMWDIRTNSCL 456
           +   P++ +   S S D T+++WDIR++S +
Sbjct: 366 LDTCPENEYMLCSASHDGTVKVWDIRSSSSI 396

>Scas_631.17
          Length = 474

 Score = 70.5 bits (171), Expect = 1e-12,   Method: Compositional matrix adjust.
 Identities = 75/269 (27%), Positives = 111/269 (41%), Gaps = 64/269 (23%)

Query: 348 LYFDDRKLITGSLDKTIRVWNYITGECISTYR-GHSDSV--LSVDSYQKVIVSGSADKTV 404
           L  D+    TGS    I++ +  T + IS    GH   +  L+ +S    +VSG+ D  V
Sbjct: 194 LMSDNALCATGSWAGDIKILDTKTLDVISGIENGHDGKIGGLAWNSTNTHLVSGADDCLV 253

Query: 405 KVWHVES-----RTCYTLRGHTEWVNCVKLHPKSFSCFSCSDDTTIRMWDIRTNSCLKVF 459
           K+   +      +    L+GHT  V  V  HP      S S D T R+WDI + + L+  
Sbjct: 254 KIHSFDPDVKIIKELTALQGHTGRVVNVDFHPSGRFVASASFDMTWRLWDIESETELQFQ 313

Query: 460 RGHVGQVQKIIPLTIKDVENLATDNTSDGSSPQDDPTMTDGADESDTPSNEQETVLDENI 519
            GH            K+V +L+  N              DGA                  
Sbjct: 314 EGHG-----------KEVYSLSFQN--------------DGA------------------ 330

Query: 520 PYPTHLLSCGLDNTIKLWDVKTGKCIRTQFGHVEGVW--DIAADNFRIISGSHDGSIKVW 577
                L S GLDN   +WDV+TGK I    GH + ++  D + D + I +G  DG I +W
Sbjct: 331 ----LLCSGGLDNAAIVWDVRTGKSIMNLQGHAKPIYSVDWSPDGYHIATGGGDGVINIW 386

Query: 578 DL----QSGKCMHTFN---GRRLQRETQH 599
           D+    ++ + +   N   G R Q+ T H
Sbjct: 387 DIRKTTETTRLLAHNNIVTGVRFQKSTGH 415

 Score = 68.6 bits (166), Expect = 6e-12,   Method: Compositional matrix adjust.
 Identities = 50/179 (27%), Positives = 80/179 (44%), Gaps = 12/179 (6%)

Query: 298 FKGHMDGVLTLQFN--YRLLFTGSYDSTIGIWDLFTGKLIRRLSGHSDGVKTLYF--DDR 353
            +GH   V+ + F+   R + + S+D T  +WD+ +   ++   GH   V +L F  D  
Sbjct: 271 LQGHTGRVVNVDFHPSGRFVASASFDMTWRLWDIESETELQFQEGHGKEVYSLSFQNDGA 330

Query: 354 KLITGSLDKTIRVWNYITGECISTYRGHSDSVLSV----DSYQKVIVSGSADKTVKVWHV 409
            L +G LD    VW+  TG+ I   +GH+  + SV    D Y   I +G  D  + +W +
Sbjct: 331 LLCSGGLDNAAIVWDVRTGKSIMNLQGHAKPIYSVDWSPDGYH--IATGGGDGVINIWDI 388

Query: 410 ESRTCYT-LRGHTEWVNCVKLHPKSFSCF-SCSDDTTIRMWDIRTNSCLKVFRGHVGQV 466
              T  T L  H   V  V+    +  C  SC  D  IR++       +K   GH  ++
Sbjct: 389 RKTTETTRLLAHNNIVTGVRFQKSTGHCLVSCGYDKQIRIYSSDNWIQVKTLEGHTDKI 447

 Score = 52.4 bits (124), Expect = 6e-07,   Method: Compositional matrix adjust.
 Identities = 59/253 (23%), Positives = 95/253 (37%), Gaps = 55/253 (21%)

Query: 333 KLIRRLSGHSDGVKTLYF--DDRKLITGSLDKTIRVWNYITGECISTYRGHSDSVLSVDS 390
           K +  L GH+  V  + F    R + + S D T R+W+  +   +    GH   V S+ S
Sbjct: 266 KELTALQGHTGRVVNVDFHPSGRFVASASFDMTWRLWDIESETELQFQEGHGKEVYSL-S 324

Query: 391 YQK---VIVSGSADKTVKVWHVES-RTCYTLRGHTEWVNCVKLHPKSFSCFSCSDDTTIR 446
           +Q    ++ SG  D    VW V + ++   L+GH + +  V   P  +   +   D  I 
Sbjct: 325 FQNDGALLCSGGLDNAAIVWDVRTGKSIMNLQGHAKPIYSVDWSPDGYHIATGGGDGVIN 384

Query: 447 MWDIRTNSCLKVFRGHVGQVQKIIPLTIKDVENLATDNTSDGSSPQDDPTMTDGADESDT 506
           +WDIR                     T +    LA +N   G   Q              
Sbjct: 385 IWDIRK--------------------TTETTRLLAHNNIVTGVRFQKSTGHC-------- 416

Query: 507 PSNEQETVLDENIPYPTHLLSCGLDNTIKLWDVKTGKCIRTQFGHVEGVW--DIAADNFR 564
                             L+SCG D  I+++       ++T  GH + +   DI+ D   
Sbjct: 417 ------------------LVSCGYDKQIRIYSSDNWIQVKTLEGHTDKILDVDISEDAQL 458

Query: 565 IISGSHDGSIKVW 577
           I+S   D S+K+W
Sbjct: 459 IVSSGWDRSLKLW 471

 Score = 50.8 bits (120), Expect = 2e-06,   Method: Compositional matrix adjust.
 Identities = 45/174 (25%), Positives = 81/174 (46%), Gaps = 14/174 (8%)

Query: 288 WR----KGHCRIQEFKGHMDGVLTLQF--NYRLLFTGSYDSTIGIWDLFTGKLIRRLSGH 341
           WR    +    +Q  +GH   V +L F  +  LL +G  D+   +WD+ TGK I  L GH
Sbjct: 299 WRLWDIESETELQFQEGHGKEVYSLSFQNDGALLCSGGLDNAAIVWDVRTGKSIMNLQGH 358

Query: 342 SDGVKTLYF--DDRKLITGSLDKTIRVWNYITGECISTYRGHSDSVLSVDSYQK----VI 395
           +  + ++ +  D   + TG  D  I +W+       +    H++ V  V  +QK     +
Sbjct: 359 AKPIYSVDWSPDGYHIATGGGDGVINIWDIRKTTETTRLLAHNNIVTGV-RFQKSTGHCL 417

Query: 396 VSGSADKTVKVWHVESRT-CYTLRGHTEWVNCVKLHPKSFSCFSCSDDTTIRMW 448
           VS   DK ++++  ++     TL GHT+ +  V +   +    S   D ++++W
Sbjct: 418 VSCGYDKQIRIYSSDNWIQVKTLEGHTDKILDVDISEDAQLIVSSGWDRSLKLW 471

>Scas_679.28
          Length = 815

 Score = 68.6 bits (166), Expect = 8e-12,   Method: Compositional matrix adjust.
 Identities = 50/169 (29%), Positives = 69/169 (40%), Gaps = 21/169 (12%)

Query: 313 RLLFTGSYDSTIGIWDL--------------FTGKLIRRLSGHSDGVKTLYF--DDRKLI 356
             L T S D TI  W +                 +  RR   H   +  L    +D    
Sbjct: 450 EFLLTASNDLTIKKWKIPKPSTTVEEDCQIVKVSEYTRR--AHEKDINALAISPNDSIFA 507

Query: 357 TGSLDKTIRVWNYITGECISTYRGHSDSVLSVD--SYQKVIVSGSADKTVKVWHVESRTC 414
           T S DKT ++W+   GE  +T   H   +  V    Y K+I + S DKT+K+W +++ + 
Sbjct: 508 TASYDKTCKIWDLENGELTATLSNHKRGLWDVAFCQYDKLIATCSGDKTIKIWSLDTFSV 567

Query: 415 Y-TLRGHTEWVNCVKLHPKSFSCFSCSDDTTIRMWDIRTNSCLKVFRGH 462
             TL GHT  V       K     S   D  I++WD  T  CLK   GH
Sbjct: 568 MKTLEGHTNAVQRCMFINKQLQLVSSGADGLIKIWDCSTGDCLKTLDGH 616

 Score = 65.5 bits (158), Expect = 7e-11,   Method: Compositional matrix adjust.
 Identities = 75/315 (23%), Positives = 118/315 (37%), Gaps = 81/315 (25%)

Query: 295 IQEFKGHMDGVLTLQFNYRLLF--TGSYDSTIGIWDLFTGKLIRRLS------GHSDGVK 346
           ++ ++GH D + +L      L+  T S D T  +W      +I +        GHS  V 
Sbjct: 379 VEMYEGHEDLLNSLDTTDDGLWMATASKDHTAIVWKY--NSIINKFQPYVKFIGHSATVT 436

Query: 347 TLYFDD-------RKLITGSLDKTIRVWNY------ITGEC----ISTY--RGHSDSV-- 385
            +   +         L+T S D TI+ W        +  +C    +S Y  R H   +  
Sbjct: 437 AVGLPNVMLRGYPEFLLTASNDLTIKKWKIPKPSTTVEEDCQIVKVSEYTRRAHEKDINA 496

Query: 386 LSVDSYQKVIVSGSADKTVKVWHVES-RTCYTLRGHTEWVNCVKLHPKSFSCFSCSDDTT 444
           L++     +  + S DKT K+W +E+     TL  H   +  V          +CS D T
Sbjct: 497 LAISPNDSIFATASYDKTCKIWDLENGELTATLSNHKRGLWDVAFCQYDKLIATCSGDKT 556

Query: 445 IRMWDIRTNSCLKVFRGHVGQVQKIIPLTIKDVENLATDNTSDGSSPQDDPTMTDGADES 504
           I++W + T S +K   GH   VQ+ + +                                
Sbjct: 557 IKIWSLDTFSVMKTLEGHTNAVQRCMFI-------------------------------- 584

Query: 505 DTPSNEQETVLDENIPYPTHLLSCGLDNTIKLWDVKTGKCIRTQFGHVEGVWDIAA--DN 562
               N+Q             L+S G D  IK+WD  TG C++T  GH   +W +    D 
Sbjct: 585 ----NKQ-----------LQLVSSGADGLIKIWDCSTGDCLKTLDGHDNRIWALTEINDG 629

Query: 563 FRIISGSHDGSIKVW 577
             I+S   DG  + W
Sbjct: 630 DMIVSADADGVFQFW 644

 Score = 61.2 bits (147), Expect = 2e-09,   Method: Compositional matrix adjust.
 Identities = 64/287 (22%), Positives = 105/287 (36%), Gaps = 81/287 (28%)

Query: 335 IRRLSGHSDGVKTLYFDDRKL--ITGSLDKTIRVWNYITGECISTYR------GHSDSVL 386
           +    GH D + +L   D  L   T S D T  VW Y     I+ ++      GHS +V 
Sbjct: 379 VEMYEGHEDLLNSLDTTDDGLWMATASKDHTAIVWKY--NSIINKFQPYVKFIGHSATVT 436

Query: 387 SVD-------SYQKVIVSGSADKTVKVWHVESRTC-------------YTLRGHTEWVNC 426
           +V         Y + +++ S D T+K W +   +              YT R H + +N 
Sbjct: 437 AVGLPNVMLRGYPEFLLTASNDLTIKKWKIPKPSTTVEEDCQIVKVSEYTRRAHEKDINA 496

Query: 427 VKLHPKSFSCFSCSDDTTIRMWDIRTNSCLKVFRGHVGQVQKIIPLTIKDVENLATDNTS 486
           + + P      + S D T ++WD+                                    
Sbjct: 497 LAISPNDSIFATASYDKTCKIWDL------------------------------------ 520

Query: 487 DGSSPQDDPTMTDGADESDTPSNEQETVLDENI-PYPTHLLSCGLDNTIKLWDVKTGKCI 545
                       +  + + T SN +  + D     Y   + +C  D TIK+W + T   +
Sbjct: 521 ------------ENGELTATLSNHKRGLWDVAFCQYDKLIATCSGDKTIKIWSLDTFSVM 568

Query: 546 RTQFGHVEGVWDIAADN--FRIISGSHDGSIKVWDLQSGKCMHTFNG 590
           +T  GH   V      N   +++S   DG IK+WD  +G C+ T +G
Sbjct: 569 KTLEGHTNAVQRCMFINKQLQLVSSGADGLIKIWDCSTGDCLKTLDG 615

 Score = 43.9 bits (102), Expect = 3e-04,   Method: Compositional matrix adjust.
 Identities = 35/182 (19%), Positives = 76/182 (41%), Gaps = 27/182 (14%)

Query: 314 LLFTGSYDSTIGIWDLFTGKLIRRLSGHSDGVKTLYFDDRK------LITGSLDKTIRVW 367
           L+  G  D +I + D+  G +   L GH   +  L F  +       L +G  +  ++VW
Sbjct: 120 LVALGGTDGSITVVDIENGFITHSLKGHGATISALKFFGQANSNVWLLCSGDTNGMVKVW 179

Query: 368 NYITGECISTYRGHSDSVLSVDSYQK----VIVSGSADKTVKVWHVESRTCYTLRGHTEW 423
           + +  +C+ T + HS++V  +D  +      ++SG  D    +W+      + L+     
Sbjct: 180 DLVKRKCLHTMQEHSNAVRGLDVREVGDEWQLISGGRDNVCTLWN------FNLKKKCTL 233

Query: 424 VNCVKLHPKSFSC-----------FSCSDDTTIRMWDIRTNSCLKVFRGHVGQVQKIIPL 472
           +  + +H +  SC           ++   D  ++   +   + +K  + H+ ++  I  L
Sbjct: 234 LKTIPVHQQVESCGFINHEHDDLIYTAGGDALLQFISLEKATMIKKTKKHIEELFIIGVL 293

Query: 473 TI 474
            I
Sbjct: 294 PI 295

 Score = 40.8 bits (94), Expect = 0.003,   Method: Compositional matrix adjust.
 Identities = 77/390 (19%), Positives = 138/390 (35%), Gaps = 95/390 (24%)

Query: 298 FKGHMDGVLTLQF------NYRLLFTGSYDSTIGIWDLFTGKLIRRLSGHSDGVKTL--- 348
            KGH   +  L+F      N  LL +G  +  + +WDL   K +  +  HS+ V+ L   
Sbjct: 144 LKGHGATISALKFFGQANSNVWLLCSGDTNGMVKVWDLVKRKCLHTMQEHSNAVRGLDVR 203

Query: 349 -YFDDRKLITGSLDKTIRVWNY-ITGEC-----ISTYRGHSDSVLSVDSYQKVIVSGSAD 401
              D+ +LI+G  D    +WN+ +  +C     I  ++           +  +I +   D
Sbjct: 204 EVGDEWQLISGGRDNVCTLWNFNLKKKCTLLKTIPVHQQVESCGFINHEHDDLIYTAGGD 263

Query: 402 KTVKVWHVESRTCY-TLRGHTEWVNCVKLHP--KSFSCFSCSDDTTIRMWDIRTN----- 453
             ++   +E  T     + H E +  + + P  ++   +    D T+ + DI++N     
Sbjct: 264 ALLQFISLEKATMIKKTKKHIEELFIIGVLPILENDKMYLVMSDQTLELVDIKSNLLNES 323

Query: 454 -------SCLKVFRGHVGQVQ------------------KIIPLTIKDVENL-------- 480
                  SC+    G +  ++                  +IIP+   + E L        
Sbjct: 324 SDIIEIESCIAGNNGTIADMKFVGPNHDKLALATNSPTLRIIPVPSSEQEELPINVEMYE 383

Query: 481 -------ATDNTSDG---SSPQDDPTMTDGADESDTPS--------NEQETVLDENIP-- 520
                  + D T DG   ++   D T       S                TV    +P  
Sbjct: 384 GHEDLLNSLDTTDDGLWMATASKDHTAIVWKYNSIINKFQPYVKFIGHSATVTAVGLPNV 443

Query: 521 ----YPTHLLSCGLDNTIKLWD--------------VKTGKCIRTQFGHVEGVWDIAADN 562
               YP  LL+   D TIK W               VK  +  R           I+ ++
Sbjct: 444 MLRGYPEFLLTASNDLTIKKWKIPKPSTTVEEDCQIVKVSEYTRRAHEKDINALAISPND 503

Query: 563 FRIISGSHDGSIKVWDLQSGKCMHTFNGRR 592
               + S+D + K+WDL++G+   T +  +
Sbjct: 504 SIFATASYDKTCKIWDLENGELTATLSNHK 533

 Score = 35.0 bits (79), Expect = 0.18,   Method: Compositional matrix adjust.
 Identities = 21/90 (23%), Positives = 44/90 (48%), Gaps = 5/90 (5%)

Query: 385 VLSVDSYQKVIVSGSADKTVKVWHVESR-TCYTLRGHTEWVNCVKLHPKSFSC--FSCSD 441
           ++  DS   ++  G  D ++ V  +E+    ++L+GH   ++ +K   ++ S     CS 
Sbjct: 111 IMDCDSTSTLVALGGTDGSITVVDIENGFITHSLKGHGATISALKFFGQANSNVWLLCSG 170

Query: 442 DTT--IRMWDIRTNSCLKVFRGHVGQVQKI 469
           DT   +++WD+    CL   + H   V+ +
Sbjct: 171 DTNGMVKVWDLVKRKCLHTMQEHSNAVRGL 200

 Score = 34.3 bits (77), Expect = 0.36,   Method: Compositional matrix adjust.
 Identities = 21/66 (31%), Positives = 33/66 (50%), Gaps = 6/66 (9%)

Query: 529 GLDNTIKLWDVKTGKCIRTQFGHVEGVWDI-----AADNFRII-SGSHDGSIKVWDLQSG 582
           G D +I + D++ G    +  GH   +  +     A  N  ++ SG  +G +KVWDL   
Sbjct: 125 GTDGSITVVDIENGFITHSLKGHGATISALKFFGQANSNVWLLCSGDTNGMVKVWDLVKR 184

Query: 583 KCMHTF 588
           KC+HT 
Sbjct: 185 KCLHTM 190

>AGR180W [4491] [Homologous to ScYLR222C - SH]
           complement(1090647..1093067) [2421 bp, 806 aa]
          Length = 806

 Score = 68.2 bits (165), Expect = 1e-11,   Method: Compositional matrix adjust.
 Identities = 72/330 (21%), Positives = 120/330 (36%), Gaps = 85/330 (25%)

Query: 279 RERFKVESNWRKGHC-RIQEFKGHMDGVLTLQFNYRLLFTGSYDSTIGIWDLFTG----K 333
           +E  ++E+   +GH   +       DG+         L T S D ++ +W         +
Sbjct: 368 KEVMEIETEMYEGHTDLLNSLDATSDGLW--------LATASKDHSVILWRYNEASSSFE 419

Query: 334 LIRRLSGHSDGVKTLYFDD-------RKLITGSLDKTIRVWN-------------YITGE 373
              +  GH+  V  +   +         L+T S D TI+ W              +I   
Sbjct: 420 PFTKFLGHAGPVTAIALPNVMNRNWPEFLLTASNDLTIKRWKVPNPNDRKAIELPHIVKA 479

Query: 374 CISTYRGHSDSV--LSVDSYQKVIVSGSADKTVKVWHVES-RTCYTLRGHTEWVNCVKLH 430
              T R H   +  +S+     +  + S DKT K+W+V++     TL  H   +  V   
Sbjct: 480 SEYTRRAHEKDINAISMSPNDSIFATASYDKTCKIWNVDTGEVEATLANHKRGLWGVAFC 539

Query: 431 PKSFSCFSCSDDTTIRMWDIRTNSCLKVFRGHVGQVQKIIPLTIKDVENLATDNTSDGSS 490
              +   +CS D +I +W + + + LK   GH   VQ++                     
Sbjct: 540 EYDWLLATCSGDRSINLWSLESFTVLKTLEGHTNAVQRV--------------------- 578

Query: 491 PQDDPTMTDGADESDTPSNEQETVLDENIPYPTHLLSCGLDNTIKLWDVKTGKCIRTQFG 550
                        S    N+Q             L+S G D  +K+WD  TG+C+RT   
Sbjct: 579 -------------SFINGNKQ-------------LVSTGADGLVKIWDCSTGECVRTLDA 612

Query: 551 HVEGVWDIAA--DNFRIISGSHDGSIKVWD 578
           H   +W +A   D   II+   DG  + W+
Sbjct: 613 HNNRIWALAVANDGQLIITADADGVFQFWE 642

 Score = 57.0 bits (136), Expect = 3e-08,   Method: Compositional matrix adjust.
 Identities = 56/280 (20%), Positives = 109/280 (38%), Gaps = 76/280 (27%)

Query: 340 GHSDGVKTL--YFDDRKLITGSLDKTIRVWNYITG----ECISTYRGHSDSVLSVD---- 389
           GH+D + +L    D   L T S D ++ +W Y       E  + + GH+  V ++     
Sbjct: 380 GHTDLLNSLDATSDGLWLATASKDHSVILWRYNEASSSFEPFTKFLGHAGPVTAIALPNV 439

Query: 390 ---SYQKVIVSGSADKTVKVW--------------HVESRTCYTLRGHTEWVNCVKLHPK 432
              ++ + +++ S D T+K W              H+   + YT R H + +N + + P 
Sbjct: 440 MNRNWPEFLLTASNDLTIKRWKVPNPNDRKAIELPHIVKASEYTRRAHEKDINAISMSPN 499

Query: 433 SFSCFSCSDDTTIRMWDIRTNSCLKVFRGHVGQVQKIIPLTIKDVENLATDNTSDGSSPQ 492
                + S D T ++W++ T           G+V+  +    + +  +A           
Sbjct: 500 DSIFATASYDKTCKIWNVDT-----------GEVEATLANHKRGLWGVAF---------- 538

Query: 493 DDPTMTDGADESDTPSNEQETVLDENIPYPTHLLSCGLDNTIKLWDVKTGKCIRTQFGHV 552
                                       Y   L +C  D +I LW +++   ++T  GH 
Sbjct: 539 --------------------------CEYDWLLATCSGDRSINLWSLESFTVLKTLEGHT 572

Query: 553 EGVWDIA--ADNFRIISGSHDGSIKVWDLQSGKCMHTFNG 590
             V  ++    N +++S   DG +K+WD  +G+C+ T + 
Sbjct: 573 NAVQRVSFINGNKQLVSTGADGLVKIWDCSTGECVRTLDA 612

 Score = 45.4 bits (106), Expect = 1e-04,   Method: Compositional matrix adjust.
 Identities = 29/143 (20%), Positives = 64/143 (44%), Gaps = 17/143 (11%)

Query: 314 LLFTGSYDSTIGIWDLFTGKLIRRLSGHSDGVKTLYFDDRK------LITGSLDKTIRVW 367
           LL  G  D ++ ++D+  G +   L GH   + ++ F          L +G  +  +++W
Sbjct: 115 LLAVGGTDGSVNVFDIANGYVTHSLKGHGATISSVKFYGEVDSGMWLLASGDTNGMVKIW 174

Query: 368 NYITGECISTYRGHSDSVLSVD-----SYQKVIVSGSADKTVKVWHVESRTCYTLRGHTE 422
           + +   CI T + H+ +V  +D       + +++SG  D  V V H      + ++   +
Sbjct: 175 DLVKRRCIHTVQEHTAAVRGLDIRVQEGAESLLLSGGRDDVVHVHH------FDMKKKCK 228

Query: 423 WVNCVKLHPKSFSCFSCSDDTTI 445
            +  + +  +  SC    D+T++
Sbjct: 229 LLQTIPVKRQIESCGFIGDNTSL 251

 Score = 45.1 bits (105), Expect = 2e-04,   Method: Compositional matrix adjust.
 Identities = 71/326 (21%), Positives = 124/326 (38%), Gaps = 49/326 (15%)

Query: 311 NYRLLFTGSYDSTIGIWDLFTGKLIRRLSGHSD-----GV---------------KTLYF 350
           N  L++T   D+   I  L +GK I++ +   +     GV               +TL+ 
Sbjct: 248 NTSLIYTAGGDAVYQIISLESGKSIKQTAQPVEELFIVGVLPVQNSTKCYLVLSDQTLFL 307

Query: 351 DDRKLITGSLDKTIRVWNYITGE--CISTYR--GHSDSVLSVDSYQ---KVIVSGSADKT 403
            D +      +K I +   I G    I+  R  G S + L++ +     ++I +  A + 
Sbjct: 308 IDVEKALSQTEKMIEIEKKIAGNHGTIADMRLVGPSLNRLALATNSPTLRIIPTPQASED 367

Query: 404 VKVWHVESRTCYTLRGHTEWVNCVKLHPKSFSCFSCSDDTTIRMWDIRTNSC----LKVF 459
            +V  +E+       GHT+ +N +          + S D ++ +W     S        F
Sbjct: 368 KEVMEIETEM---YEGHTDLLNSLDATSDGLWLATASKDHSVILWRYNEASSSFEPFTKF 424

Query: 460 RGHVGQVQKII---------PLTIKDVENLATDNTSDGSSPQDDPTM----TDGADESDT 506
            GH G V  I          P  +    N  T       +P D   +       A E   
Sbjct: 425 LGHAGPVTAIALPNVMNRNWPEFLLTASNDLTIKRWKVPNPNDRKAIELPHIVKASEYTR 484

Query: 507 PSNEQETVLDENIPYPTHLLSCGLDNTIKLWDVKTGKCIRTQFGHVEGVWDIA--ADNFR 564
            ++E++       P  +   +   D T K+W+V TG+   T   H  G+W +A    ++ 
Sbjct: 485 RAHEKDINAISMSPNDSIFATASYDKTCKIWNVDTGEVEATLANHKRGLWGVAFCEYDWL 544

Query: 565 IISGSHDGSIKVWDLQSGKCMHTFNG 590
           + + S D SI +W L+S   + T  G
Sbjct: 545 LATCSGDRSINLWSLESFTVLKTLEG 570

 Score = 37.7 bits (86), Expect = 0.027,   Method: Compositional matrix adjust.
 Identities = 21/85 (24%), Positives = 40/85 (47%), Gaps = 16/85 (18%)

Query: 519 IPYPTHLLSC----------GLDNTIKLWDVKTGKCIRTQFGH------VEGVWDIAADN 562
           I  P ++L C          G D ++ ++D+  G    +  GH      V+   ++ +  
Sbjct: 100 ISSPAYVLDCDESSTLLAVGGTDGSVNVFDIANGYVTHSLKGHGATISSVKFYGEVDSGM 159

Query: 563 FRIISGSHDGSIKVWDLQSGKCMHT 587
           + + SG  +G +K+WDL   +C+HT
Sbjct: 160 WLLASGDTNGMVKIWDLVKRRCIHT 184

>YOR272W (YTM1) [5058] chr15 (832810..834192) Microtubule-associated
           protein essential for the G1/S transition, member of WD
           (WD-40) repeat family [1383 bp, 460 aa]
          Length = 460

 Score = 67.8 bits (164), Expect = 1e-11,   Method: Compositional matrix adjust.
 Identities = 90/336 (26%), Positives = 147/336 (43%), Gaps = 59/336 (17%)

Query: 315 LFTGSYDSTIGIWDLFTGKLIRRLSGHSDGVKTL-YFDDRKLITGSLDKTIRVW------ 367
           + +GSYD  +  WDL +G + ++ SGHS  ++ + Y  + +L++   D+T+R+W      
Sbjct: 118 IISGSYDGIVRTWDL-SGNVQKQYSGHSGPIRAVKYISNTRLVSAGNDRTLRLWKTKNDD 176

Query: 368 -----------------NYITGECISTYRGHSDSVLSVD-SYQKVIVSGSADKTVKVWHV 409
                            N   G+ ++   GH   V+S+D S    I+S S D ++  W  
Sbjct: 177 LKLTSQQQAQEDDDDEVNIEDGKTLAILEGHKAPVVSIDVSDNSRILSASYDNSIGFWST 236

Query: 410 ESRTCYTLRGHTEWVNCVKLHPKSFSCFSCSDDTTIRMWD--IRTNSCLKVFRGHVGQVQ 467
             +   T+    E +N    +P +    +      + M D  IR  + L +   H   V+
Sbjct: 237 IYKEM-TVVDPLEDIN----NPNNKISTAARKRRKLTMKDGTIRRRAPLSLLESHTAPVE 291

Query: 468 KIIPLTIKDVENLATDNTSDGSSPQDDPTMT---DGADESDTPSNEQETVLDENIPYPTH 524
           ++I          +TDNT   S  QD    T     A   DT +    ++L        +
Sbjct: 292 QVI--------FDSTDNTVGYSVSQDHTIKTWDLVTARCIDTRTTSY-SLLSIAQLSTLN 342

Query: 525 LLSCGLDNT-IKLWDVKTG---KCIRTQF-GHVEGV--WDIAADNFRII-SGSHDGSIKV 576
           LL+CG     I L D + G   K  + Q  GH   V   D   +N  I+ SGSHDG++KV
Sbjct: 343 LLACGSSARHITLHDPRVGASSKVTQQQLIGHKNFVSSLDTCPENEYILCSGSHDGTVKV 402

Query: 577 WDLQSGKCMHTFNGRRLQRETQHTQTQSLGDKVAPI 612
           WD++S   M+T     + RE +  Q + + DKV  +
Sbjct: 403 WDVRSTSPMYT-----ITREDKSVQ-KGVNDKVFAV 432

 Score = 35.0 bits (79), Expect = 0.18,   Method: Compositional matrix adjust.
 Identities = 40/180 (22%), Positives = 61/180 (33%), Gaps = 73/180 (40%)

Query: 422 EWVNCVKLHPKSFSCFSCSDDTTIRMWDIRTNSCLKVFRGHVGQVQKIIPLTIKDVENLA 481
           +WV+ + +   S    S S D  +R WD+  N   K + GH G ++      +K + N  
Sbjct: 104 DWVSSLDVGDGSKHIISGSYDGIVRTWDLSGN-VQKQYSGHSGPIR-----AVKYISN-- 155

Query: 482 TDNTSDGSSPQDDPTMTDGADESDTPSNEQETVLDENIPYPTHLLSCGLDNTIKLW---- 537
                                                    T L+S G D T++LW    
Sbjct: 156 -----------------------------------------TRLVSAGNDRTLRLWKTKN 174

Query: 538 -------------------DVKTGKCIRTQFGHVEGVWDI-AADNFRIISGSHDGSIKVW 577
                              +++ GK +    GH   V  I  +DN RI+S S+D SI  W
Sbjct: 175 DDLKLTSQQQAQEDDDDEVNIEDGKTLAILEGHKAPVVSIDVSDNSRILSASYDNSIGFW 234

 Score = 30.8 bits (68), Expect = 4.1,   Method: Compositional matrix adjust.
 Identities = 14/34 (41%), Positives = 21/34 (61%), Gaps = 1/34 (2%)

Query: 557 DIAADNFRIISGSHDGSIKVWDLQSGKCMHTFNG 590
           D+   +  IISGS+DG ++ WDL SG     ++G
Sbjct: 110 DVGDGSKHIISGSYDGIVRTWDL-SGNVQKQYSG 142

>Sklu_1880.3 YDR364C, Contig c1880 4293-5708
          Length = 471

 Score = 67.4 bits (163), Expect = 1e-11,   Method: Compositional matrix adjust.
 Identities = 50/179 (27%), Positives = 86/179 (48%), Gaps = 20/179 (11%)

Query: 295 IQEFKGHMDGVLTLQF---NYRLLFTGSYDSTIGIWDLFTGK-LIRRLSGHSDGVKTLYF 350
           I  FKGH++G   L+F      L  +G  D+ I IWD++  + L+R   GH   V+ + F
Sbjct: 171 IYTFKGHVNGTTKLKFLPETGHLFLSGGNDNVINIWDMYHERTLLRDYRGHRKAVRDINF 230

Query: 351 --DDRKLITGSLDKTIRVWNYITGECISTYRGHSDSVLSVDSYQKV----IVSGSADKTV 404
             D  + ++ S D+T++VW+  TG+  S  + H  SV +  +Y        + G ++  +
Sbjct: 231 NSDGTEFLSVSFDQTLKVWDTETGKVKSRLKWH--SVPNCATYHPTNNNEYIVGLSNSEI 288

Query: 405 KVWHVESRTC------YTLRGHTEWVNCVKLHPKSFSCFSCSDDTTIRMWDIRTNSCLK 457
           +  H +SR         T   H   +  +K  P      S S+D T+R+W+ + N  +K
Sbjct: 289 R--HYDSRVSNKEGLIQTYNHHLSSIISLKYFPDGSKFISSSEDKTVRIWENQVNIPIK 345

 Score = 52.4 bits (124), Expect = 7e-07,   Method: Compositional matrix adjust.
 Identities = 67/280 (23%), Positives = 118/280 (42%), Gaps = 35/280 (12%)

Query: 333 KLIRRLSGHSDGVKTLYF---DDRKLITGSLDKTIRVWN-YITGECISTYRGHSDSV--L 386
           K+I    GH +G   L F        ++G  D  I +W+ Y     +  YRGH  +V  +
Sbjct: 169 KIIYTFKGHVNGTTKLKFLPETGHLFLSGGNDNVINIWDMYHERTLLRDYRGHRKAVRDI 228

Query: 387 SVDSYQKVIVSGSADKTVKVWHVESRTCYT-LRGHTEWVNCVKLHPKSFSCFSCS-DDTT 444
           + +S     +S S D+T+KVW  E+    + L+ H+   NC   HP + + +     ++ 
Sbjct: 229 NFNSDGTEFLSVSFDQTLKVWDTETGKVKSRLKWHSV-PNCATYHPTNNNEYIVGLSNSE 287

Query: 445 IRMWDIRTNSCLKVFRGHVGQVQKIIPLTIKDVENLATDNTSDGS---SPQDDPTMTDGA 501
           IR +D R ++   + + +   +  II L              DGS   S  +D T+    
Sbjct: 288 IRHYDSRVSNKEGLIQTYNHHLSSIISLKY----------FPDGSKFISSSEDKTVRIWE 337

Query: 502 DESDTPSNEQETVLDENIPY-----PTHLLSC-GLDNTIKLWDVKTGKCIRTQF---GHV 552
           ++ + P  +       ++PY       H  S   +DN I  + +K       +    GH+
Sbjct: 338 NQVNIPIKQISDTSQYSMPYLEIHPEQHYFSAQSMDNAIYSFSMKPKYKKNLKKVFRGHL 397

Query: 553 EGVWDI----AADNFRIISGSHDGSIKVWDLQSGKCMHTF 588
              + I    + D   I+SG   GS+ VWD ++ + +  F
Sbjct: 398 CAGFGINFGFSPDGQYIVSGDSRGSVVVWDWKTTRTLKRF 437

 Score = 50.8 bits (120), Expect = 2e-06,   Method: Compositional matrix adjust.
 Identities = 51/192 (26%), Positives = 84/192 (43%), Gaps = 16/192 (8%)

Query: 288 WRKGHCR--IQEFKGHMDGVLTLQFNY--RLLFTGSYDSTIGIWDLFTGKLIRRLSGHSD 343
           W   H R  +++++GH   V  + FN       + S+D T+ +WD  TGK+  RL  HS 
Sbjct: 206 WDMYHERTLLRDYRGHRKAVRDINFNSDGTEFLSVSFDQTLKVWDTETGKVKSRLKWHSV 265

Query: 344 GVKTLYF--DDRKLITGSLDKTIRVWNYITGE---CISTYRGHSDSVLSVDSYQ--KVIV 396
                Y   ++ + I G  +  IR ++         I TY  H  S++S+  +      +
Sbjct: 266 PNCATYHPTNNNEYIVGLSNSEIRHYDSRVSNKEGLIQTYNHHLSSIISLKYFPDGSKFI 325

Query: 397 SGSADKTVKVWHVESRTCYTLRGHTEWVNC--VKLHPKSFSCFSCSDDTTI---RMWDIR 451
           S S DKTV++W  +          T   +   +++HP+     + S D  I    M    
Sbjct: 326 SSSEDKTVRIWENQVNIPIKQISDTSQYSMPYLEIHPEQHYFSAQSMDNAIYSFSMKPKY 385

Query: 452 TNSCLKVFRGHV 463
             +  KVFRGH+
Sbjct: 386 KKNLKKVFRGHL 397

>CAGL0A02772g complement(289274..290599) similar to sp|P40968
           Saccharomyces cerevisiae YDR364c CDC40, hypothetical
           start
          Length = 441

 Score = 67.4 bits (163), Expect = 1e-11,   Method: Compositional matrix adjust.
 Identities = 47/178 (26%), Positives = 86/178 (48%), Gaps = 18/178 (10%)

Query: 295 IQEFKGHMDGVLTLQF---NYRLLFTGSYDSTIGIWDLFTG-KLIRRLSGHSDGVKTLYF 350
           I  +KGH +G  +L+       L+ +G  D+T+ +WD +   K +R   GHS  +KTL F
Sbjct: 141 IYRYKGHHNGTTSLRLLPGTGHLILSGGNDNTVKLWDFYHDRKCLRDFVGHSKPIKTLDF 200

Query: 351 --DDRKLITGSLDKTIRVWNYITGEC---ISTYRGHSDSVLSVDSYQKVIVSGSADKTVK 405
             D  + ++GS D+ +++W+  TG+    ++TY   + +     S  + +V  S+ K   
Sbjct: 201 TSDSSQFLSGSYDQQVKIWDTETGKVTKRLNTYSTPNSAEFRPTSGNEFVVGLSSSK--- 257

Query: 406 VWHVESRT------CYTLRGHTEWVNCVKLHPKSFSCFSCSDDTTIRMWDIRTNSCLK 457
           + H ++R             H   +  +K  P      S S+D T+R+W+ + N  +K
Sbjct: 258 IKHYDTRVSEKDGLVQVYDHHLSSILAIKYFPDGSKFISSSEDKTLRIWNNQVNIPIK 315

 Score = 54.7 bits (130), Expect = 1e-07,   Method: Compositional matrix adjust.
 Identities = 30/75 (40%), Positives = 44/75 (58%), Gaps = 4/75 (5%)

Query: 519 IPYPTHL-LSCGLDNTIKLWDV-KTGKCIRTQFGHVEGV--WDIAADNFRIISGSHDGSI 574
           +P   HL LS G DNT+KLWD     KC+R   GH + +   D  +D+ + +SGS+D  +
Sbjct: 157 LPGTGHLILSGGNDNTVKLWDFYHDRKCLRDFVGHSKPIKTLDFTSDSSQFLSGSYDQQV 216

Query: 575 KVWDLQSGKCMHTFN 589
           K+WD ++GK     N
Sbjct: 217 KIWDTETGKVTKRLN 231

>YCR057C (PWP2) [586] chr3 complement(220452..223223) Essential
           protein required for cell separation, has eight WD
           (WD-40) repeats, component of U3 snoRNP (also called
           small subunit processome), which is required for 18S
           rRNA biogenesis [2772 bp, 923 aa]
          Length = 923

 Score = 67.8 bits (164), Expect = 2e-11,   Method: Compositional matrix adjust.
 Identities = 47/161 (29%), Positives = 78/161 (48%), Gaps = 9/161 (5%)

Query: 314 LLFTGSYDSTIGIWDLFTGKLIRRLSGHSDGVKTLYF--DDRKLITGSLDKTIRVWNYIT 371
           L F  S    + +++  +   I +  GH D   +L +  D  +++T S D  I+VW+  +
Sbjct: 317 LAFGSSKLGQLLVYEWQSESYILKQQGHFDSTNSLAYSPDGSRVVTASEDGKIKVWDITS 376

Query: 372 GECISTYRGHSDSVLSVDSYQK--VIVSGSADKTVKVWH-VESRTCYTLRGHTEWV--NC 426
           G C++T+  H+ SV +V   ++  V+ S S D TV+ W  +  R   T  G TE +  NC
Sbjct: 377 GFCLATFEEHTSSVTAVQFAKRGQVMFSSSLDGTVRAWDLIRYRNFRTFTG-TERIQFNC 435

Query: 427 VKLHPK-SFSCFSCSDDTTIRMWDIRTNSCLKVFRGHVGQV 466
           + + P     C    D+  I +W ++T   L    GH G V
Sbjct: 436 LAVDPSGEVVCAGSLDNFDIHVWSVQTGQLLDALSGHEGPV 476

 Score = 65.5 bits (158), Expect = 9e-11,   Method: Compositional matrix adjust.
 Identities = 59/233 (25%), Positives = 100/233 (42%), Gaps = 24/233 (10%)

Query: 253 IQQNSTGSSSNADIQTQTTRPWKVIYRERFK--VESNWRKGHCRIQEFKGHMDGVLTLQF 310
           IQQ S G +    +    T  W      +    +   W +    I + +GH D   +L +
Sbjct: 295 IQQLSMGQNPVNTVSVNQTGEWLAFGSSKLGQLLVYEW-QSESYILKQQGHFDSTNSLAY 353

Query: 311 --NYRLLFTGSYDSTIGIWDLFTGKLIRRLSGHSDGVKTLYFDDRK--LITGSLDKTIRV 366
             +   + T S D  I +WD+ +G  +     H+  V  + F  R   + + SLD T+R 
Sbjct: 354 SPDGSRVVTASEDGKIKVWDITSGFCLATFEEHTSSVTAVQFAKRGQVMFSSSLDGTVRA 413

Query: 367 WNYITGECISTYRGHSD---SVLSVDSYQKVIVSGSADK-TVKVWHVES-RTCYTLRGHT 421
           W+ I      T+ G      + L+VD   +V+ +GS D   + VW V++ +    L GH 
Sbjct: 414 WDLIRYRNFRTFTGTERIQFNCLAVDPSGEVVCAGSLDNFDIHVWSVQTGQLLDALSGHE 473

Query: 422 EWVNCVKLHPKSFSCFSCSDDTTIRMWDIRTNSCLKVFRGHVGQVQKIIPLTI 474
             V+C+    ++    S S D TIR+W I             G+ Q++ P+ +
Sbjct: 474 GPVSCLSFSQENSVLASASWDKTIRIWSI------------FGRSQQVEPIEV 514

 Score = 45.8 bits (107), Expect = 1e-04,   Method: Compositional matrix adjust.
 Identities = 66/304 (21%), Positives = 118/304 (38%), Gaps = 56/304 (18%)

Query: 336 RRLSGHSDGVKTLYF--DDRKLITGSLDKTIRVWNYITGE---CISTYRGHSDSVLSV-- 388
           R  +GH   + +L +  D R ++T S D + ++W+  + E     +T+ GH D V+    
Sbjct: 140 RVHAGHFQDITSLTWSQDSRFILTTSKDLSAKIWSVDSEEKNLAATTFNGHRDYVMGAFF 199

Query: 389 DSYQKVIVSGSADKTVKVWHVESR--------------------TCYTLR--------GH 420
              Q+ I + S D  V VW    R                    + Y+ R         +
Sbjct: 200 SHDQEKIYTVSKDGAVFVWEFTKRPSDDDDNESEDDDKQEEVDISKYSWRITKKHFFYAN 259

Query: 421 TEWVNCVKLHPKSFSCFSCSDDTTIRMWDIRTNSCLKVFRGHVGQVQKIIPLTIKDVENL 480
              V CV  HP +            R++D+   + ++  +  +GQ           V  +
Sbjct: 260 QAKVKCVTFHPATRLLAVGFTSGEFRLYDLPDFTLIQ--QLSMGQ---------NPVNTV 308

Query: 481 ATDNTSD----GSSPQDDPTMTDGADESDTPSNEQETVLDENIPYP---THLLSCGLDNT 533
           + + T +    GSS      + +   ES     +       ++ Y    + +++   D  
Sbjct: 309 SVNQTGEWLAFGSSKLGQLLVYEWQSESYILKQQGHFDSTNSLAYSPDGSRVVTASEDGK 368

Query: 534 IKLWDVKTGKCIRTQFGHVEGVWDI--AADNFRIISGSHDGSIKVWDLQSGKCMHTFNG- 590
           IK+WD+ +G C+ T   H   V  +  A     + S S DG+++ WDL   +   TF G 
Sbjct: 369 IKVWDITSGFCLATFEEHTSSVTAVQFAKRGQVMFSSSLDGTVRAWDLIRYRNFRTFTGT 428

Query: 591 RRLQ 594
            R+Q
Sbjct: 429 ERIQ 432

 Score = 41.2 bits (95), Expect = 0.003,   Method: Compositional matrix adjust.
 Identities = 38/130 (29%), Positives = 58/130 (44%), Gaps = 22/130 (16%)

Query: 270 TTRPWKVIYRERFKVESNWRKGHCRIQEFKGHMDGVLTLQFNYRLLFTGSYDS-TIGIWD 328
           T R W +I    F+  +    G  RIQ         L +  +  ++  GS D+  I +W 
Sbjct: 410 TVRAWDLIRYRNFRTFT----GTERIQF------NCLAVDPSGEVVCAGSLDNFDIHVWS 459

Query: 329 LFTGKLIRRLSGHSDGVKTLYF--DDRKLITGSLDKTIRVWNYITGECISTYRGHSDSVL 386
           + TG+L+  LSGH   V  L F  ++  L + S DKTIR+W+           G S  V 
Sbjct: 460 VQTGQLLDALSGHEGPVSCLSFSQENSVLASASWDKTIRIWSIF---------GRSQQVE 510

Query: 387 SVDSYQKVIV 396
            ++ Y  V+ 
Sbjct: 511 PIEVYSDVLA 520

>Sklu_2318.1 YKL213C, Contig c2318 605-2740 reverse complement
          Length = 711

 Score = 66.6 bits (161), Expect = 3e-11,   Method: Compositional matrix adjust.
 Identities = 60/226 (26%), Positives = 103/226 (45%), Gaps = 11/226 (4%)

Query: 380 GHSDSVLSVDSYQKVIVSGSADKTVKVWHVESRTCYTLRGHTEWVNCVKLHPKSFSCFSC 439
           GH  +V S+ S    ++S S DKT KVWH      Y L GH+  V   K  P+     + 
Sbjct: 97  GHKGNVCSLSSKNNFVISSSWDKTAKVWH-NGSAIYDLVGHSASVWDAKFLPEKDFFLTA 155

Query: 440 SDDTTIRMWDIRTNSCLKVFRGHVGQVQKIIPLTIKDVENLATDNTSDGSSPQDDPTMTD 499
           S D TI++W    N  +K F G    V + + ++  D E  A+  ++DG+   +D    D
Sbjct: 156 SADCTIKLW--HGNKLIKTFSGIHKDVIRHLDIS-PDGETFAS-CSNDGTVKIND---MD 208

Query: 500 GADESDTPSNEQETVLDENIPYPTHLLSCGLDNTIKLWDVKTGKCIRTQFGHVEGVWDI- 558
           G +   T +  +  V          L+SCG D ++++W  KTG   +        +WD+ 
Sbjct: 209 G-NILKTFTGHESFVYSVKFLPNGDLVSCGEDRSVRVWS-KTGAVKQVLRLPAVSIWDLD 266

Query: 559 AADNFRIISGSHDGSIKVWDLQSGKCMHTFNGRRLQRETQHTQTQS 604
              N  I+ GS D  ++++ ++  +         LQ++ +++   S
Sbjct: 267 ILPNGDILVGSSDNMVRIFTVEESRIASNSKLEELQKQVENSSINS 312

>Scas_692.29
          Length = 456

 Score = 66.2 bits (160), Expect = 3e-11,   Method: Compositional matrix adjust.
 Identities = 82/333 (24%), Positives = 142/333 (42%), Gaps = 53/333 (15%)

Query: 313 RLLFTGSYDSTIGIWDLFTGKLIRRLSGHSDGVKTLYF-DDRKLITGSLDKTIRVW---- 367
           + + T SYD  I  W+L +GK+ ++ SGHS  ++ + F  D +L++   D+T+R+W    
Sbjct: 116 KAIITASYDGVIRTWNL-SGKVQKQYSGHSGPIRAVKFISDTRLVSAGNDRTLRLWKTKN 174

Query: 368 ---------------NYITGECISTYRGHSDSVLSVD-SYQKVIVSGSADKTVKVWHVES 411
                          N   G+ ++   GH   V+S+D S    I+S S D ++ +W    
Sbjct: 175 NDSVVQHFDEEDEEANIEDGKTLAILEGHKAPVVSLDVSNTSRILSSSYDNSIGLWSTIY 234

Query: 412 RTCYTLRGHTEWVNCVKLHPKSFSCFSCSDDTTIRMWDIRTNSCLKVFRGHVGQVQKIIP 471
           +    +    E  N      K  +        T++   IR  + L +   H   V++   
Sbjct: 235 KEMTVVDPMEEINNA---DNKISTAARKRRKLTLKDGTIRRRAPLSLLESHTAPVEQ--- 288

Query: 472 LTIKDVENLATDNTSDGSSPQDDPTMTD----GADESDTPSNEQETVLDENIPYPTHLLS 527
                  +   ++ + G S   D T+       A   DT +     +    +P   +LL+
Sbjct: 289 ------ASFDINDDTVGYSVSQDHTIKTWDLVTARCIDTKTTSYSLLSLTQLP-TLNLLA 341

Query: 528 CGLDNT-IKLWDVKTGKCIRTQ----FGHVEGV--WDIAADNFRII-SGSHDGSIKVWDL 579
           CG     I L D + G   +       GH   V   D   +N  I+ SGSHDG++KVWD+
Sbjct: 342 CGSSARHITLHDPRMGASSKVTQHQLIGHKNFVVSLDTCPENEYILCSGSHDGTVKVWDV 401

Query: 580 QSGKCMHTFNGRRLQRETQHTQTQSLGDKVAPI 612
           +S   M+T     + RE ++ + + + DKV  +
Sbjct: 402 RSTAPMYT-----ITREDKNVE-KGVNDKVFAV 428

 Score = 33.1 bits (74), Expect = 0.74,   Method: Compositional matrix adjust.
 Identities = 24/128 (18%), Positives = 56/128 (43%), Gaps = 13/128 (10%)

Query: 422 EWVNCVKLHPKSFSCFSCSDDTTIRMWDIRTNSCLKVFRGHVGQVQKIIPLTIKDVENLA 481
           +W++ + +     +  + S D  IR W++ +    K + GH G ++ +  ++   + +  
Sbjct: 104 DWISSIDVSQDKKAIITASYDGVIRTWNL-SGKVQKQYSGHSGPIRAVKFISDTRLVSAG 162

Query: 482 TDNTSDGSSPQDDPTMTDGADESDTPSNEQE------------TVLDENIPYPTHLLSCG 529
            D T      +++ ++    DE D  +N ++             V+  ++   + +LS  
Sbjct: 163 NDRTLRLWKTKNNDSVVQHFDEEDEEANIEDGKTLAILEGHKAPVVSLDVSNTSRILSSS 222

Query: 530 LDNTIKLW 537
            DN+I LW
Sbjct: 223 YDNSIGLW 230

 Score = 31.6 bits (70), Expect = 2.0,   Method: Compositional matrix adjust.
 Identities = 14/34 (41%), Positives = 22/34 (64%), Gaps = 1/34 (2%)

Query: 557 DIAADNFRIISGSHDGSIKVWDLQSGKCMHTFNG 590
           D++ D   II+ S+DG I+ W+L SGK    ++G
Sbjct: 110 DVSQDKKAIITASYDGVIRTWNL-SGKVQKQYSG 142

>AAR057W [243] [Homologous to ScYCR057C (PWP2) - SH]
           complement(442821..445589) [2769 bp, 922 aa]
          Length = 922

 Score = 66.2 bits (160), Expect = 4e-11,   Method: Compositional matrix adjust.
 Identities = 47/182 (25%), Positives = 86/182 (47%), Gaps = 10/182 (5%)

Query: 295 IQEFKGHMDGVLTLQFNYRLLFTGSYDSTIG---IWDLFTGKLIRRLSGHSDGVKTLYF- 350
           IQ+     + V T+  N    +     ST+G   +++  +   I +  GH D +  L + 
Sbjct: 306 IQQLSMGQNAVNTVAVNRSGEWLAFGSSTLGQLLVYEWQSESYILKQQGHFDALNALAYS 365

Query: 351 -DDRKLITGSLDKTIRVWNYITGECISTYRGHSDSVLSVDSYQ--KVIVSGSADKTVKVW 407
            D  +++T + D  I++W+ ++G C++T+  H+ SV SV   +  +++ S S D TVK W
Sbjct: 366 PDGARIVTAAEDGKIKIWDIVSGFCLATFEEHTSSVTSVQFAKNGQIMFSSSLDGTVKAW 425

Query: 408 HVESRTCYTLRGHTEWV--NCVKLHPKS-FSCFSCSDDTTIRMWDIRTNSCLKVFRGHVG 464
            +     +     TE +  +C+   P     C    D+  I++W ++T   L    GH G
Sbjct: 426 DLMRFRNFRTFTATERIQFSCLAADPTGEVVCAGSLDNYDIQVWSVQTGQLLDTLSGHEG 485

Query: 465 QV 466
            V
Sbjct: 486 PV 487

 Score = 43.5 bits (101), Expect = 5e-04,   Method: Compositional matrix adjust.
 Identities = 26/78 (33%), Positives = 40/78 (51%), Gaps = 3/78 (3%)

Query: 520 PYPTHLLSCGLDNTIKLWDVKTGKCIRTQFGHVEGVWDIA-ADNFRII-SGSHDGSIKVW 577
           P    +++   D  IK+WD+ +G C+ T   H   V  +  A N +I+ S S DG++K W
Sbjct: 366 PDGARIVTAAEDGKIKIWDIVSGFCLATFEEHTSSVTSVQFAKNGQIMFSSSLDGTVKAW 425

Query: 578 DLQSGKCMHTFNG-RRLQ 594
           DL   +   TF    R+Q
Sbjct: 426 DLMRFRNFRTFTATERIQ 443

 Score = 40.8 bits (94), Expect = 0.003,   Method: Compositional matrix adjust.
 Identities = 19/55 (34%), Positives = 33/55 (60%), Gaps = 2/55 (3%)

Query: 536 LWDVKTGKCIRTQFGHVEGVWDIA--ADNFRIISGSHDGSIKVWDLQSGKCMHTF 588
           +++ ++   I  Q GH + +  +A   D  RI++ + DG IK+WD+ SG C+ TF
Sbjct: 340 VYEWQSESYILKQQGHFDALNALAYSPDGARIVTAAEDGKIKIWDIVSGFCLATF 394

 Score = 40.8 bits (94), Expect = 0.004,   Method: Compositional matrix adjust.
 Identities = 49/194 (25%), Positives = 74/194 (38%), Gaps = 58/194 (29%)

Query: 404 VKVWHVESRTCYTLR--GHTEWVNCVKLHPKSFSCFSCSDDTTIRMWDIRTNSCLKVFRG 461
           V  W  ES   Y L+  GH + +N +   P      + ++D  I++WDI +  CL  F  
Sbjct: 340 VYEWQSES---YILKQQGHFDALNALAYSPDGARIVTAAEDGKIKIWDIVSGFCLATFEE 396

Query: 462 HVGQVQKIIPLTIKDVENLATDNTSDGSSPQDDPTMTDGADESDTPSNEQETVLDENIPY 521
           H                      TS  +S Q                N Q          
Sbjct: 397 H----------------------TSSVTSVQ-------------FAKNGQI--------- 412

Query: 522 PTHLLSCGLDNTIKLWDVKTGKCIRTQFGHVEGVWD--IAAD--NFRIISGSHDG-SIKV 576
              + S  LD T+K WD+   +  RT F   E +    +AAD     + +GS D   I+V
Sbjct: 413 ---MFSSSLDGTVKAWDLMRFRNFRT-FTATERIQFSCLAADPTGEVVCAGSLDNYDIQV 468

Query: 577 WDLQSGKCMHTFNG 590
           W +Q+G+ + T +G
Sbjct: 469 WSVQTGQLLDTLSG 482

>ADR176W [1917] [Homologous to ScYOR269W (PAC1) - SH]
           complement(1012413..1013798) [1386 bp, 461 aa]
          Length = 461

 Score = 65.5 bits (158), Expect = 5e-11,   Method: Compositional matrix adjust.
 Identities = 52/196 (26%), Positives = 80/196 (40%), Gaps = 52/196 (26%)

Query: 314 LLFTGSYDSTIGIWDLFTGKLIRRLSGHSDGVKTLYFDDRKLITGSLDKTIRVWNYITGE 373
           LL T S D T+ +WD  +G  I+    H+  V+TL      +ITGS D TIR+ ++ +G 
Sbjct: 227 LLATCSRDLTVKVWDTKSGWCIKSFQPHNQWVRTLELHGDYVITGSNDATIRLSHWPSGN 286

Query: 374 CISTYRGHSDSV-------LSVDSYQKV-------------------------IVSGSAD 401
            +S    H   +       +  ++ QK                           +S S D
Sbjct: 287 GLSMAVMHEFPIERVLIIPMRANTAQKTEADDDQVELEYRKYDPDYSPLGFKYCISCSRD 346

Query: 402 KTVKVWHV------------------ESRTCYTLRGHTEWVNCVKLHPKSFSCFSCSDDT 443
             + +W +                       +  +GHT WV  +K+  +    FSCSDD 
Sbjct: 347 NLIVLWKIPLPKFIPHRPPQPNLLQTNFEKVHVFKGHTSWVRDIKVRGRHL--FSCSDDR 404

Query: 444 TIRMWDIRTNSCLKVF 459
           +IR WD+ T  CLKV+
Sbjct: 405 SIRCWDLVTGQCLKVW 420

 Score = 59.7 bits (143), Expect = 4e-09,   Method: Compositional matrix adjust.
 Identities = 69/316 (21%), Positives = 128/316 (40%), Gaps = 54/316 (17%)

Query: 306 LTLQFNYRLLFTGSYDSTIGIWDLFTGKL-IRRLSGHSDGVKTLYFDDRK-----LITGS 359
           + L  +  + F  +    +  +DLF   + +     H  GV +L   + +     + T S
Sbjct: 126 IKLHPSLPIAFLATDQGKVVAYDLFNRSMPLHSTQAHMKGVTSLAVMEAENGSLLISTTS 185

Query: 360 LDKTIRVWNYITGECISTYRGHS--DSVLSVDSYQK-----VIVSGSADKTVKVWHVESR 412
            D   ++W++         R  S  + ++S   + +     ++ + S D TVKVW  +S 
Sbjct: 186 KDLQCKIWSFTDNAAFQLLRTLSSHEHIVSQSCFLRSGSDLLLATCSRDLTVKVWDTKSG 245

Query: 413 TCY-TLRGHTEWVNCVKLHPKSFSCFSCSDDTTIRMWDIRTNSCLKVFRGHVGQVQKIIP 471
            C  + + H +WV  ++LH       + S+D TIR+    + + L +   H   +++++ 
Sbjct: 246 WCIKSFQPHNQWVRTLELHGDYV--ITGSNDATIRLSHWPSGNGLSMAVMHEFPIERVLI 303

Query: 472 LTIKDVENLATDNTSDGSSPQDDPTMTD--GADESDTPSNEQETVLDENIPYPTHLLSCG 529
           + ++        NT+  +   DD    +    D   +P   +            + +SC 
Sbjct: 304 IPMRA-------NTAQKTEADDDQVELEYRKYDPDYSPLGFK------------YCISCS 344

Query: 530 LDNTIKLWDVKTGKCI----------RTQF-------GHVEGVWDIAADNFRIISGSHDG 572
            DN I LW +   K I          +T F       GH   V DI      + S S D 
Sbjct: 345 RDNLIVLWKIPLPKFIPHRPPQPNLLQTNFEKVHVFKGHTSWVRDIKVRGRHLFSCSDDR 404

Query: 573 SIKVWDLQSGKCMHTF 588
           SI+ WDL +G+C+  +
Sbjct: 405 SIRCWDLVTGQCLKVW 420

 Score = 56.2 bits (134), Expect = 5e-08,   Method: Compositional matrix adjust.
 Identities = 75/308 (24%), Positives = 118/308 (38%), Gaps = 83/308 (26%)

Query: 299 KGHMDGVLTLQF----NYRLLF-TGSYDSTIGIW---DLFTGKLIRRLSGHSDGVKTLYF 350
           + HM GV +L      N  LL  T S D    IW   D    +L+R LS H   V    F
Sbjct: 160 QAHMKGVTSLAVMEAENGSLLISTTSKDLQCKIWSFTDNAAFQLLRTLSSHEHIVSQSCF 219

Query: 351 ----DDRKLITGSLDKTIRVWNYITGECISTYRGHSDSVLSVDSYQKVIVSGSADKTVKV 406
                D  L T S D T++VW+  +G CI +++ H+  V +++ +   +++GS D T+++
Sbjct: 220 LRSGSDLLLATCSRDLTVKVWDTKSGWCIKSFQPHNQWVRTLELHGDYVITGSNDATIRL 279

Query: 407 WH----------------VESRTCYTLRGHTEWV-----NCVKLHPKSFS---------- 435
            H                +E      +R +T        + V+L  + +           
Sbjct: 280 SHWPSGNGLSMAVMHEFPIERVLIIPMRANTAQKTEADDDQVELEYRKYDPDYSPLGFKY 339

Query: 436 CFSCSDDTTIRMWDIRTNSCLKVFRGHVGQVQKIIPLTIKDVENLATDNTSDGSSPQDDP 495
           C SCS D  I +W I               + K IP                   PQ + 
Sbjct: 340 CISCSRDNLIVLWKI--------------PLPKFIP----------------HRPPQPNL 369

Query: 496 TMTDGADESDTPSNEQETVLDENIPYPTHLLSCGLDNTIKLWDVKTGKCIRTQFGHVEGV 555
             T+  ++          V D  +    HL SC  D +I+ WD+ TG+C++        V
Sbjct: 370 LQTN-FEKVHVFKGHTSWVRDIKV-RGRHLFSCSDDRSIRCWDLVTGQCLK--------V 419

Query: 556 WDIAADNF 563
           W  A+  F
Sbjct: 420 WPEASHGF 427

 Score = 37.0 bits (84), Expect = 0.039,   Method: Compositional matrix adjust.
 Identities = 26/91 (28%), Positives = 42/91 (46%), Gaps = 4/91 (4%)

Query: 284 VESNWRKGHCRIQEFKGHMDGVLTLQFNYRLLFTGSYDSTIGIWDLFTGKLIRRLSGHSD 343
           +++N+ K H     FKGH   V  ++   R LF+ S D +I  WDL TG+ ++     S 
Sbjct: 370 LQTNFEKVHV----FKGHTSWVRDIKVRGRHLFSCSDDRSIRCWDLVTGQCLKVWPEASH 425

Query: 344 GVKTLYFDDRKLITGSLDKTIRVWNYITGEC 374
           G       D  +    L + + +   I G+C
Sbjct: 426 GFINCLSVDSDVSNDKLLRELFLSGSIDGKC 456

>Sklu_2160.3 YGL137W, Contig c2160 2536-4818 reverse complement
          Length = 760

 Score = 65.9 bits (159), Expect = 5e-11,   Method: Compositional matrix adjust.
 Identities = 50/160 (31%), Positives = 76/160 (47%), Gaps = 19/160 (11%)

Query: 287 NWRKGHCRIQEFKGHMDGVLTLQFNYR---LLFTGSYDSTIGIWDLFTGKLIRRLSGH-S 342
           NW K     Q F+GH   V+ + FN +      +   D T+ IW L        ++ H +
Sbjct: 7   NWEKNWALEQTFEGHEHFVMCVAFNPKDPNTFASACLDHTVKIWSLGQQSPNFTMTAHET 66

Query: 343 DGVKTLYF----DDRKLITGSLDKTIRVWNYITGECISTYRGHSDSVLSVDSYQ------ 392
            GV  + +    D   LIT S D+++++W+Y T  C++T  GH  +V    SY       
Sbjct: 67  RGVNFVDYYPLQDKPYLITSSDDRSVKIWDYQTKSCVATLEGHMANV----SYAIFHPSL 122

Query: 393 KVIVSGSADKTVKVWHVES-RTCYTLRGHTEWVNCVKLHP 431
            +I+SGS D TVK+W+  + +   TL    E   CV  HP
Sbjct: 123 PIIISGSEDGTVKIWNANTYKLEKTLNLGLERSWCVAAHP 162

 Score = 55.5 bits (132), Expect = 9e-08,   Method: Compositional matrix adjust.
 Identities = 48/192 (25%), Positives = 79/192 (41%), Gaps = 49/192 (25%)

Query: 403 TVKVWHVESRTCY--TLRGHTEWVNCVKLHPKSFSCFSCS-DDTTIRMWDIRTNSCLKVF 459
           T+K+W+ E       T  GH  +V CV  +PK  + F+ +  D T+++W +         
Sbjct: 2   TIKLWNWEKNWALEQTFEGHEHFVMCVAFNPKDPNTFASACLDHTVKIWSL--------- 52

Query: 460 RGHVGQVQKIIPLTIKDVENLATDNTSDGSSPQDDPTMTDGADESDTPSNEQETVLDENI 519
               GQ      +T  +   +   N  D    QD P                        
Sbjct: 53  ----GQQSPNFTMTAHETRGV---NFVDYYPLQDKP------------------------ 81

Query: 520 PYPTHLLSCGLDNTIKLWDVKTGKCIRTQFGHVEGV-WDIAADNFR-IISGSHDGSIKVW 577
               +L++   D ++K+WD +T  C+ T  GH+  V + I   +   IISGS DG++K+W
Sbjct: 82  ----YLITSSDDRSVKIWDYQTKSCVATLEGHMANVSYAIFHPSLPIIISGSEDGTVKIW 137

Query: 578 DLQSGKCMHTFN 589
           +  + K   T N
Sbjct: 138 NANTYKLEKTLN 149

 Score = 54.3 bits (129), Expect = 2e-07,   Method: Compositional matrix adjust.
 Identities = 35/116 (30%), Positives = 57/116 (49%), Gaps = 8/116 (6%)

Query: 363 TIRVWNYITGECIS-TYRGHSDSVLSVDSYQK---VIVSGSADKTVKVWHVESRT-CYTL 417
           TI++WN+     +  T+ GH   V+ V    K      S   D TVK+W +  ++  +T+
Sbjct: 2   TIKLWNWEKNWALEQTFEGHEHFVMCVAFNPKDPNTFASACLDHTVKIWSLGQQSPNFTM 61

Query: 418 RGH-TEWVNCVKLHPKSFSCF--SCSDDTTIRMWDIRTNSCLKVFRGHVGQVQKII 470
             H T  VN V  +P     +  + SDD ++++WD +T SC+    GH+  V   I
Sbjct: 62  TAHETRGVNFVDYYPLQDKPYLITSSDDRSVKIWDYQTKSCVATLEGHMANVSYAI 117

 Score = 51.2 bits (121), Expect = 2e-06,   Method: Compositional matrix adjust.
 Identities = 38/140 (27%), Positives = 65/140 (46%), Gaps = 10/140 (7%)

Query: 323 TIGIWDLFTG-KLIRRLSGHSDGVKTLYF---DDRKLITGSLDKTIRVWNYITGECISTY 378
           TI +W+      L +   GH   V  + F   D     +  LD T+++W+        T 
Sbjct: 2   TIKLWNWEKNWALEQTFEGHEHFVMCVAFNPKDPNTFASACLDHTVKIWSLGQQSPNFTM 61

Query: 379 RGH-SDSVLSVDSY----QKVIVSGSADKTVKVWHVESRTCY-TLRGHTEWVNCVKLHPK 432
             H +  V  VD Y    +  +++ S D++VK+W  ++++C  TL GH   V+    HP 
Sbjct: 62  TAHETRGVNFVDYYPLQDKPYLITSSDDRSVKIWDYQTKSCVATLEGHMANVSYAIFHPS 121

Query: 433 SFSCFSCSDDTTIRMWDIRT 452
                S S+D T+++W+  T
Sbjct: 122 LPIIISGSEDGTVKIWNANT 141

 Score = 35.4 bits (80), Expect = 0.14,   Method: Compositional matrix adjust.
 Identities = 23/74 (31%), Positives = 34/74 (45%), Gaps = 5/74 (6%)

Query: 522 PTHLLSCGLDNTIKLWDVKTGKCIRTQFGH-VEGV----WDIAADNFRIISGSHDGSIKV 576
           P    S  LD+T+K+W +       T   H   GV    +    D   +I+ S D S+K+
Sbjct: 35  PNTFASACLDHTVKIWSLGQQSPNFTMTAHETRGVNFVDYYPLQDKPYLITSSDDRSVKI 94

Query: 577 WDLQSGKCMHTFNG 590
           WD Q+  C+ T  G
Sbjct: 95  WDYQTKSCVATLEG 108

>AEL269C [2236] [Homologous to ScYPR178W (PRP4) - SH]
           (134760..136127) [1368 bp, 455 aa]
          Length = 455

 Score = 65.1 bits (157), Expect = 6e-11,   Method: Compositional matrix adjust.
 Identities = 60/241 (24%), Positives = 100/241 (41%), Gaps = 54/241 (22%)

Query: 347 TLYFDDRKLITGSLDKTIRVWNYIT-GECISTYRGHSDSVLSVDSY--QKVIVSGSADKT 403
            ++ D ++L TG    +I+V +  T G   S    H   +  +D +     ++SG  D  
Sbjct: 179 AVHRDGQQLATGCWGGSIKVVSCETLGIAKSIDAAHEGKIGGLDWHPDGNHLLSGGGDNL 238

Query: 404 VKVWHVESRTCYTLRGHTEWVNCVKLHPKSFSCFSCSDDTTIRMWDIRTNSCLKVFRGHV 463
           VK+W + S +   LRGH   V+ VK+HP      S S D T  +WD+     L++  GH 
Sbjct: 239 VKLWDMTSNSFEELRGHAGRVSRVKVHPSGRLAASASFDLTWILWDLERKVELQLQEGHS 298

Query: 464 GQVQKIIPLTIKDVENLATDNTSDGSSPQDDPTMTDGADESDTPSNEQETVLDENIPYPT 523
             V  I                            +DGA                      
Sbjct: 299 KAVYTI-------------------------AFQSDGA---------------------- 311

Query: 524 HLLSCGLDNTIKLWDVKTGKCIRTQFGH---VEGVWDIAADNFRIISGSHDGSIKVWDLQ 580
            L S GLD    +WD+++G+ I    GH   + GV D + + +++ +   DG+++VWD++
Sbjct: 312 LLASAGLDAVCAIWDLRSGEPIMKLEGHAGAISGV-DWSPNGYQLATAGADGTVRVWDIR 370

Query: 581 S 581
           +
Sbjct: 371 N 371

 Score = 61.2 bits (147), Expect = 1e-09,   Method: Compositional matrix adjust.
 Identities = 46/169 (27%), Positives = 82/169 (48%), Gaps = 12/169 (7%)

Query: 289 RKGHCRIQEFKGHMDGVLTLQF--NYRLLFTGSYDSTIGIWDLFTGKLIRRLSGHSDGVK 346
           RK   ++QE  GH   V T+ F  +  LL +   D+   IWDL +G+ I +L GH+  + 
Sbjct: 287 RKVELQLQE--GHSKAVYTIAFQSDGALLASAGLDAVCAIWDLRSGEPIMKLEGHAGAIS 344

Query: 347 TLYF--DDRKLITGSLDKTIRVWNYITGECISTYRGHSDSVLSVDSYQK----VIVSGSA 400
            + +  +  +L T   D T+RVW+       S    H  + L V  ++K     +VS   
Sbjct: 345 GVDWSPNGYQLATAGADGTVRVWDIRNVGTESALLAHQVAALDV-KFKKNNGTFLVSCGH 403

Query: 401 DKTVKVWHVES-RTCYTLRGHTEWVNCVKLHPKSFSCFSCSDDTTIRMW 448
           D+ V +++ ++ +   +L GHT+ V  V +     + +S   D +++ W
Sbjct: 404 DRLVNIFNADNWQKLASLEGHTDRVFTVDITEDGSTIYSGGKDRSLKQW 452

 Score = 60.1 bits (144), Expect = 3e-09,   Method: Compositional matrix adjust.
 Identities = 50/182 (27%), Positives = 80/182 (43%), Gaps = 12/182 (6%)

Query: 295 IQEFKGHMDGV--LTLQFNYRLLFTGSYDSTIGIWDLFTGKLIRRLSGHSDGVKTLYF-- 350
            +E +GH   V  + +  + RL  + S+D T  +WDL     ++   GHS  V T+ F  
Sbjct: 249 FEELRGHAGRVSRVKVHPSGRLAASASFDLTWILWDLERKVELQLQEGHSKAVYTIAFQS 308

Query: 351 DDRKLITGSLDKTIRVWNYITGECISTYRGHSDSVLSVD----SYQKVIVSGSADKTVKV 406
           D   L +  LD    +W+  +GE I    GH+ ++  VD     YQ  + +  AD TV+V
Sbjct: 309 DGALLASAGLDAVCAIWDLRSGEPIMKLEGHAGAISGVDWSPNGYQ--LATAGADGTVRV 366

Query: 407 WHVES-RTCYTLRGHTEWVNCVKLHPKSFSCF-SCSDDTTIRMWDIRTNSCLKVFRGHVG 464
           W + +  T   L  H      VK    + +   SC  D  + +++      L    GH  
Sbjct: 367 WDIRNVGTESALLAHQVAALDVKFKKNNGTFLVSCGHDRLVNIFNADNWQKLASLEGHTD 426

Query: 465 QV 466
           +V
Sbjct: 427 RV 428

 Score = 59.3 bits (142), Expect = 4e-09,   Method: Compositional matrix adjust.
 Identities = 59/270 (21%), Positives = 99/270 (36%), Gaps = 54/270 (20%)

Query: 315 LFTGSYDSTIGIWDLFTGKLIRRLSGHSDGVK--TLYFDDRKLITGSLDKTIRVWNYITG 372
           L +G  D+ + +WD+ T      L GH+  V    ++   R   + S D T  +W+    
Sbjct: 230 LLSGGGDNLVKLWDM-TSNSFEELRGHAGRVSRVKVHPSGRLAASASFDLTWILWDLERK 288

Query: 373 ECISTYRGHSDSVLSV--DSYQKVIVSGSADKTVKVWHVES-RTCYTLRGHTEWVNCVKL 429
             +    GHS +V ++   S   ++ S   D    +W + S      L GH   ++ V  
Sbjct: 289 VELQLQEGHSKAVYTIAFQSDGALLASAGLDAVCAIWDLRSGEPIMKLEGHAGAISGVDW 348

Query: 430 HPKSFSCFSCSDDTTIRMWDIRTNSCLKVFRGHVGQVQKIIPLTIKDVENLATDNTSDGS 489
            P  +   +   D T+R+WDIR          H     ++  L +K  +N          
Sbjct: 349 SPNGYQLATAGADGTVRVWDIRNVGTESALLAH-----QVAALDVKFKKN---------- 393

Query: 490 SPQDDPTMTDGADESDTPSNEQETVLDENIPYPTHLLSCGLDNTIKLWDVKTGKCIRTQF 549
                                            T L+SCG D  + +++    + + +  
Sbjct: 394 -------------------------------NGTFLVSCGHDRLVNIFNADNWQKLASLE 422

Query: 550 GHVEGVW--DIAADNFRIISGSHDGSIKVW 577
           GH + V+  DI  D   I SG  D S+K W
Sbjct: 423 GHTDRVFTVDITEDGSTIYSGGKDRSLKQW 452

 Score = 40.8 bits (94), Expect = 0.003,   Method: Compositional matrix adjust.
 Identities = 36/173 (20%), Positives = 60/173 (34%), Gaps = 50/173 (28%)

Query: 420 HTEWVNCVKLHPKSFSCFSCSDDTTIRMWDIRTNSCLKVFRGHVGQVQKIIPLTIKDVEN 479
           H   +  +  HP      S   D  +++WD+ +NS  +  RGH G+V ++          
Sbjct: 214 HEGKIGGLDWHPDGNHLLSGGGDNLVKLWDMTSNS-FEELRGHAGRVSRV---------- 262

Query: 480 LATDNTSDGSSPQDDPTMTDGADESDTPSNEQETVLDENIPYPTHLLSCGLDNTIKLWDV 539
                                                +  P      S   D T  LWD+
Sbjct: 263 -------------------------------------KVHPSGRLAASASFDLTWILWDL 285

Query: 540 KTGKCIRTQFGHVEGVWDIA--ADNFRIISGSHDGSIKVWDLQSGKCMHTFNG 590
           +    ++ Q GH + V+ IA  +D   + S   D    +WDL+SG+ +    G
Sbjct: 286 ERKVELQLQEGHSKAVYTIAFQSDGALLASAGLDAVCAIWDLRSGEPIMKLEG 338

>Scas_720.83d
          Length = 915

 Score = 65.9 bits (159), Expect = 7e-11,   Method: Compositional matrix adjust.
 Identities = 42/160 (26%), Positives = 76/160 (47%), Gaps = 7/160 (4%)

Query: 314 LLFTGSYDSTIGIWDLFTGKLIRRLSGHSDGVKTLYF--DDRKLITGSLDKTIRVWNYIT 371
           L F  S    + +++  +   I +  GH D   +L +  D  +++T + D  I+VW+ ++
Sbjct: 315 LAFGSSKLGQLLVYEWQSESYILKQQGHFDATNSLTYSPDGSRVVTAAEDGKIKVWDVVS 374

Query: 372 GECISTYRGHSDSVLSVDSYQK--VIVSGSADKTVKVWHVESRTCYTLRGHTEWV--NCV 427
           G C++T++ H+ SV  V   ++  V+ S S D TV+ W +     +      E +  NC+
Sbjct: 375 GFCLATFQEHTSSVTQVQFAKRGQVLFSSSLDGTVRAWDLIRYRNFRTFTAAERIQFNCL 434

Query: 428 KLHPK-SFSCFSCSDDTTIRMWDIRTNSCLKVFRGHVGQV 466
            + P     C    D+  I +W ++T   L    GH G V
Sbjct: 435 AVDPSGEVVCAGSLDNFDIHVWSVQTGQLLDTLSGHEGPV 474

 Score = 63.5 bits (153), Expect = 3e-10,   Method: Compositional matrix adjust.
 Identities = 46/161 (28%), Positives = 77/161 (47%), Gaps = 9/161 (5%)

Query: 299 KGHMDGVLTLQF--NYRLLFTGSYDSTIGIWDLFTGKLIRRLSGHSDGVKTLYFDDRK-- 354
           +GH D   +L +  +   + T + D  I +WD+ +G  +     H+  V  + F  R   
Sbjct: 340 QGHFDATNSLTYSPDGSRVVTAAEDGKIKVWDVVSGFCLATFQEHTSSVTQVQFAKRGQV 399

Query: 355 LITGSLDKTIRVWNYITGECISTYRGHSD---SVLSVDSYQKVIVSGSADK-TVKVWHVE 410
           L + SLD T+R W+ I      T+        + L+VD   +V+ +GS D   + VW V+
Sbjct: 400 LFSSSLDGTVRAWDLIRYRNFRTFTAAERIQFNCLAVDPSGEVVCAGSLDNFDIHVWSVQ 459

Query: 411 S-RTCYTLRGHTEWVNCVKLHPKSFSCFSCSDDTTIRMWDI 450
           + +   TL GH   V+C+    ++    S S D T+R+W I
Sbjct: 460 TGQLLDTLSGHEGPVSCLAFSQENSVLASASWDKTVRVWSI 500

 Score = 54.3 bits (129), Expect = 3e-07,   Method: Compositional matrix adjust.
 Identities = 43/131 (32%), Positives = 60/131 (45%), Gaps = 9/131 (6%)

Query: 291 GHCRIQEFKGHMDGVLTLQFNYR--LLFTGSYDSTIGIWDLFTGKLIRRLSGHSD-GVKT 347
           G C +  F+ H   V  +QF  R  +LF+ S D T+  WDL   +  R  +         
Sbjct: 375 GFC-LATFQEHTSSVTQVQFAKRGQVLFSSSLDGTVRAWDLIRYRNFRTFTAAERIQFNC 433

Query: 348 LYFDDRKLI--TGSLDK-TIRVWNYITGECISTYRGHSDSV--LSVDSYQKVIVSGSADK 402
           L  D    +   GSLD   I VW+  TG+ + T  GH   V  L+      V+ S S DK
Sbjct: 434 LAVDPSGEVVCAGSLDNFDIHVWSVQTGQLLDTLSGHEGPVSCLAFSQENSVLASASWDK 493

Query: 403 TVKVWHVESRT 413
           TV+VW +  R+
Sbjct: 494 TVRVWSIFGRS 504

 Score = 43.5 bits (101), Expect = 5e-04,   Method: Compositional matrix adjust.
 Identities = 68/298 (22%), Positives = 118/298 (39%), Gaps = 46/298 (15%)

Query: 336 RRLSGHSDGVKTLY--FDDRKLITGSLDKTIRVWNYITGE---CISTYRGHSDSVLSV-- 388
           R  +GH   + +L    D R +I+ S D T R+W+  + E      T+ GH D V+    
Sbjct: 140 RVHAGHFQDILSLTWSLDSRFIISTSKDLTARIWSIDSEEKDLASMTFAGHRDYVMGAFF 199

Query: 389 DSYQKVIVSGSADKTVKVWHVESRTC------------------YTLR---GHTEWVN-- 425
            + Q+ I + S D  + VW    ++                   Y+ R    H  + N  
Sbjct: 200 SADQEKIYTVSKDGALFVWEFTKKSTDDEDDDDEEEEEDIDISKYSWRITQKHFFYANQC 259

Query: 426 ---CVKLHPKSFSCFSCSDDTTIRMWDIRTNSCLKVFRGHVGQVQKIIPLTIKDVENLAT 482
              CV  H  S        +   R++++   + L+  +  +GQ     P+    V N + 
Sbjct: 260 KVKCVTFHAPSNMLVVGFTNGEFRLYELPHFTLLQ--QLSMGQN----PINTVAV-NSSG 312

Query: 483 DNTSDGSSPQDDPTMTDGADESDTPSNEQETVLDENIPYP---THLLSCGLDNTIKLWDV 539
           +  + GSS      + +   ES     +       ++ Y    + +++   D  IK+WDV
Sbjct: 313 EWLAFGSSKLGQLLVYEWQSESYILKQQGHFDATNSLTYSPDGSRVVTAAEDGKIKVWDV 372

Query: 540 KTGKCIRTQFGHVEGVWDI--AADNFRIISGSHDGSIKVWDLQSGKCMHTFN-GRRLQ 594
            +G C+ T   H   V  +  A     + S S DG+++ WDL   +   TF    R+Q
Sbjct: 373 VSGFCLATFQEHTSSVTQVQFAKRGQVLFSSSLDGTVRAWDLIRYRNFRTFTAAERIQ 430

 Score = 42.0 bits (97), Expect = 0.002,   Method: Compositional matrix adjust.
 Identities = 44/183 (24%), Positives = 75/183 (40%), Gaps = 16/183 (8%)

Query: 404 VKVWHVESRTCYTLR--GHTEWVNCVKLHPKSFSCFSCSDDTTIRMWDIRTNSCLKVFRG 461
           V  W  ES   Y L+  GH +  N +   P      + ++D  I++WD+ +  CL  F+ 
Sbjct: 327 VYEWQSES---YILKQQGHFDATNSLTYSPDGSRVVTAAEDGKIKVWDVVSGFCLATFQE 383

Query: 462 HVGQVQKIIPLTIKDVENLATDNTSDGSSPQDDPTMTDGADESDTPSNEQETVLDENIPY 521
           H   V ++          +   ++ DG+    D                Q   L  +   
Sbjct: 384 HTSSVTQV---QFAKRGQVLFSSSLDGTVRAWDLIRYRNFRTFTAAERIQFNCLAVD--- 437

Query: 522 PTHLLSCG--LDN-TIKLWDVKTGKCIRTQFGHVEGV--WDIAADNFRIISGSHDGSIKV 576
           P+  + C   LDN  I +W V+TG+ + T  GH   V     + +N  + S S D +++V
Sbjct: 438 PSGEVVCAGSLDNFDIHVWSVQTGQLLDTLSGHEGPVSCLAFSQENSVLASASWDKTVRV 497

Query: 577 WDL 579
           W +
Sbjct: 498 WSI 500

 Score = 40.4 bits (93), Expect = 0.004,   Method: Compositional matrix adjust.
 Identities = 29/83 (34%), Positives = 40/83 (48%), Gaps = 12/83 (14%)

Query: 317 TGSYDS-TIGIWDLFTGKLIRRLSGHSDGVKTLYF--DDRKLITGSLDKTIRVWNYITGE 373
            GS D+  I +W + TG+L+  LSGH   V  L F  ++  L + S DKT+RVW+     
Sbjct: 445 AGSLDNFDIHVWSVQTGQLLDTLSGHEGPVSCLAFSQENSVLASASWDKTVRVWSIF--- 501

Query: 374 CISTYRGHSDSVLSVDSYQKVIV 396
                 G S  V   D Y  V+ 
Sbjct: 502 ------GRSQQVEPFDVYSDVLA 518

>Kwal_56.23920
          Length = 937

 Score = 65.9 bits (159), Expect = 7e-11,   Method: Compositional matrix adjust.
 Identities = 50/173 (28%), Positives = 80/173 (46%), Gaps = 21/173 (12%)

Query: 315 LFTGSYDSTIGIWDL---------FTGKLIRRLSGHSDGVKTL---------YFDDRKLI 356
           L TGS D T+  WD           T K   +L    D    L           D+R L 
Sbjct: 482 LVTGSADKTVCFWDFQVEQEPVPGTTDKFNPKLKMFHDTTLELNDDVLAVKISPDNRLLA 541

Query: 357 TGSLDKTIRVWNYITGECISTYRGHSDSVLSVD-SY-QKVIVSGSADKTVKVWHVESRTC 414
              LD T++V+   + +   +  GH   VLS+D S+  K++++ SADK +K+W ++   C
Sbjct: 542 VSLLDNTVKVFFMDSMKFFLSLYGHKLPVLSIDISFDSKLLITSSADKNIKIWGLDFGDC 601

Query: 415 Y-TLRGHTEWVNCVKLHPKSFSCFSCSDDTTIRMWDIRTNSCLKVFRGHVGQV 466
           + +L  H + +  V   P+S + FSCS D  ++ WD     C++    H  +V
Sbjct: 602 HRSLFAHNDSIMKVVFVPESHNFFSCSKDALVKYWDGDKFECIQKLAAHQKEV 654

 Score = 63.5 bits (153), Expect = 3e-10,   Method: Compositional matrix adjust.
 Identities = 64/288 (22%), Positives = 113/288 (39%), Gaps = 71/288 (24%)

Query: 314 LLFTGSYDSTIGIWDLFTGKLIRRLSG-HSDGVKTLYF--DDRKLITGSLDKTIRVWNY- 369
           L+  G+    + ++DL +  L+  + G HS  + +L    D ++L+TGS DKT+  W++ 
Sbjct: 438 LVVLGTKTGDLHLYDLASSTLLNTIEGAHSGAIWSLDMTTDGKRLVTGSADKTVCFWDFQ 497

Query: 370 ITGECI---------------STYRGHSDSVLSV--DSYQKVIVSGSADKTVKVWHVESR 412
           +  E +                T    +D VL+V      +++     D TVKV+ ++S 
Sbjct: 498 VEQEPVPGTTDKFNPKLKMFHDTTLELNDDVLAVKISPDNRLLAVSLLDNTVKVFFMDSM 557

Query: 413 TCY-TLRGHTEWVNCVKLHPKSFSCFSCSDDTTIRMWDIRTNSCLKVFRGHVGQVQKIIP 471
             + +L GH   V  + +   S    + S D  I++W +    C +    H   + K++ 
Sbjct: 558 KFFLSLYGHKLPVLSIDISFDSKLLITSSADKNIKIWGLDFGDCHRSLFAHNDSIMKVV- 616

Query: 472 LTIKDVENLATDNTSDGSSPQDDPTMTDGADESDTPSNEQETVLDENIPYPTHLLSCGLD 531
                                                          +P   +  SC  D
Sbjct: 617 ----------------------------------------------FVPESHNFFSCSKD 630

Query: 532 NTIKLWDVKTGKCIRTQFGHVEGVWDIA--ADNFRIISGSHDGSIKVW 577
             +K WD    +CI+    H + VW +A  +D   ++S SHD SI+VW
Sbjct: 631 ALVKYWDGDKFECIQKLAAHQKEVWTLAISSDGRFVVSASHDQSIRVW 678

 Score = 62.0 bits (149), Expect = 1e-09,   Method: Compositional matrix adjust.
 Identities = 40/142 (28%), Positives = 67/142 (47%), Gaps = 6/142 (4%)

Query: 313 RLLFTGSYDSTIGIWDLFTGKLIRRLSGHSDGVKTLYFDD--RKLITGSLDKTIRVWNYI 370
           RLL  G  D  I IWDL +  ++   +GH   +  L FD    +LI+GS D  I VW+ +
Sbjct: 88  RLLAVGYNDGAIKIWDLLSKSVLISFNGHKSAITILTFDQTGTRLISGSRDSDIIVWDLV 147

Query: 371 TGECISTYRGHSDSVLSV-DSYQKVIVSGSADKTVKVWHVESRTCYTLRGHTEWV-NCVK 428
               +   R H DS+  +    ++ ++S S D  +KVW ++ + C  +  H   V  C  
Sbjct: 148 GEVGLYKLRSHKDSITGLWCEGEEWLISTSKDGLIKVWDLKVQQC--VETHVAHVGECWS 205

Query: 429 LHPKSFSCFSCSDDTTIRMWDI 450
           +        +   D  I++W++
Sbjct: 206 MGVHEDLVITAGADNQIKLWNL 227

 Score = 61.6 bits (148), Expect = 1e-09,   Method: Compositional matrix adjust.
 Identities = 33/115 (28%), Positives = 60/115 (52%), Gaps = 3/115 (2%)

Query: 298 FKGHMDGVLTLQFNYR--LLFTGSYDSTIGIWDLFTGKLIRRLSGHSDGVKTLYFDDRK- 354
           F GH   +  L F+     L +GS DS I +WDL     + +L  H D +  L+ +  + 
Sbjct: 113 FNGHKSAITILTFDQTGTRLISGSRDSDIIVWDLVGEVGLYKLRSHKDSITGLWCEGEEW 172

Query: 355 LITGSLDKTIRVWNYITGECISTYRGHSDSVLSVDSYQKVIVSGSADKTVKVWHV 409
           LI+ S D  I+VW+    +C+ T+  H     S+  ++ ++++  AD  +K+W++
Sbjct: 173 LISTSKDGLIKVWDLKVQQCVETHVAHVGECWSMGVHEDLVITAGADNQIKLWNL 227

 Score = 57.8 bits (138), Expect = 2e-08,   Method: Compositional matrix adjust.
 Identities = 41/168 (24%), Positives = 79/168 (47%), Gaps = 19/168 (11%)

Query: 315 LFTGSYDSTIGIWDLFTGKLIRRLS-----GHSDG-----VKTLYF----DDRKLITGSL 360
           + TG+ ++ +  W + +G+LI  L+     G  D       +T Y     + R L  G  
Sbjct: 37  VLTGALEN-VNCWSMKSGELIGTLTDGLPPGAVDAKSTKPAETSYLQYHPETRLLAVGYN 95

Query: 361 DKTIRVWNYITGECISTYRGHSDSV--LSVDSYQKVIVSGSADKTVKVWHVESRT-CYTL 417
           D  I++W+ ++   + ++ GH  ++  L+ D     ++SGS D  + VW +      Y L
Sbjct: 96  DGAIKIWDLLSKSVLISFNGHKSAITILTFDQTGTRLISGSRDSDIIVWDLVGEVGLYKL 155

Query: 418 RGHTEWVNCVKLHPKSFSCFSCSDDTTIRMWDIRTNSCLKVFRGHVGQ 465
           R H + +  +    + +   S S D  I++WD++   C++    HVG+
Sbjct: 156 RSHKDSITGLWCEGEEW-LISTSKDGLIKVWDLKVQQCVETHVAHVGE 202

 Score = 57.4 bits (137), Expect = 2e-08,   Method: Compositional matrix adjust.
 Identities = 46/155 (29%), Positives = 73/155 (47%), Gaps = 11/155 (7%)

Query: 303 DGVLTLQF--NYRLLFTGSYDSTIGIWDLFTGKLIRRLSGHSDGVKTL--YFDDRKLITG 358
           D VL ++   + RLL     D+T+ ++ + + K    L GH   V ++   FD + LIT 
Sbjct: 526 DDVLAVKISPDNRLLAVSLLDNTVKVFFMDSMKFFLSLYGHKLPVLSIDISFDSKLLITS 585

Query: 359 SLDKTIRVWNYITGECISTYRGHSDSVLSV----DSYQKVIVSGSADKTVKVWHVESRTC 414
           S DK I++W    G+C  +   H+DS++ V    +S+     S S D  VK W  +   C
Sbjct: 586 SADKNIKIWGLDFGDCHRSLFAHNDSIMKVVFVPESHN--FFSCSKDALVKYWDGDKFEC 643

Query: 415 Y-TLRGHTEWVNCVKLHPKSFSCFSCSDDTTIRMW 448
              L  H + V  + +        S S D +IR+W
Sbjct: 644 IQKLAAHQKEVWTLAISSDGRFVVSASHDQSIRVW 678

 Score = 49.3 bits (116), Expect = 9e-06,   Method: Compositional matrix adjust.
 Identities = 38/155 (24%), Positives = 65/155 (41%), Gaps = 10/155 (6%)

Query: 427 VKLHPKSFSCFSCSDDTTIRMWDIRTNSCLKVFRGHVGQVQKIIPLTIKDVENLATDNTS 486
           ++ HP++       +D  I++WD+ + S L  F GH   +      TI   +   T   S
Sbjct: 81  LQYHPETRLLAVGYNDGAIKIWDLLSKSVLISFNGHKSAI------TILTFDQTGTRLIS 134

Query: 487 DGSSPQDDPTMTDGADESDTPS--NEQETVLDENIPYPTHLLSCGLDNTIKLWDVKTGKC 544
              S   D  + D   E       + ++++          L+S   D  IK+WD+K  +C
Sbjct: 135 --GSRDSDIIVWDLVGEVGLYKLRSHKDSITGLWCEGEEWLISTSKDGLIKVWDLKVQQC 192

Query: 545 IRTQFGHVEGVWDIAADNFRIISGSHDGSIKVWDL 579
           + T   HV   W +      +I+   D  IK+W+L
Sbjct: 193 VETHVAHVGECWSMGVHEDLVITAGADNQIKLWNL 227

 Score = 48.1 bits (113), Expect = 2e-05,   Method: Compositional matrix adjust.
 Identities = 57/253 (22%), Positives = 104/253 (41%), Gaps = 38/253 (15%)

Query: 338 LSGHSDGVKTLYFD-DRKLITGSLDKTIRVWNYITGECISTYRGHSDSVLSVDSYQKVIV 396
           + GH   V+ +    D KL+  + + T+++WN  T  CI T+               ++V
Sbjct: 381 IRGHRSDVRAIDISGDNKLLATASNGTLKIWNIKTNSCIRTFECGYALACKFLPGGALVV 440

Query: 397 SGSADKTVKVWHVESRTCY-TLRG-HTEWVNCVKLHPKSFSCFSCSDDTTIRMWDIRTNS 454
            G+    + ++ + S T   T+ G H+  +  + +        + S D T+  WD +   
Sbjct: 441 LGTKTGDLHLYDLASSTLLNTIEGAHSGAIWSLDMTTDGKRLVTGSADKTVCFWDFQVE- 499

Query: 455 CLKVFRGHVGQVQKIIPLTIKDVENLATDNTSDGSSPQDDPTMTDGADESDTPSNEQETV 514
                       Q+ +P                G++ + +P +       DT     + V
Sbjct: 500 ------------QEPVP----------------GTTDKFNPKLKMF---HDTTLELNDDV 528

Query: 515 LDENIPYPTHLLSCGL-DNTIKLWDVKTGKCIRTQFGHVEGVW--DIAADNFRIISGSHD 571
           L   I     LL+  L DNT+K++ + + K   + +GH   V   DI+ D+  +I+ S D
Sbjct: 529 LAVKISPDNRLLAVSLLDNTVKVFFMDSMKFFLSLYGHKLPVLSIDISFDSKLLITSSAD 588

Query: 572 GSIKVWDLQSGKC 584
            +IK+W L  G C
Sbjct: 589 KNIKIWGLDFGDC 601

 Score = 39.3 bits (90), Expect = 0.009,   Method: Compositional matrix adjust.
 Identities = 69/326 (21%), Positives = 125/326 (38%), Gaps = 35/326 (10%)

Query: 291 GHCRIQEFKGHMDGVLTLQ-FNYRLLFTGSYDSTIGIWDLFTGKLIRRLSGHSDGVKTLY 349
           G   + + + H D +  L       L + S D  I +WDL   + +     H     ++ 
Sbjct: 148 GEVGLYKLRSHKDSITGLWCEGEEWLISTSKDGLIKVWDLKVQQCVETHVAHVGECWSMG 207

Query: 350 FDDRKLITGSLDKTIRVWNYI-------------TGECISTYRGHSDSVLSVDSYQKVIV 396
             +  +IT   D  I++WN               T E  S  RG +    +V        
Sbjct: 208 VHEDLVITAGADNQIKLWNLNFEESAGSMLIEKGTHEKQSRQRGVAIQFTTVSDETTFFF 267

Query: 397 SGSADKTVKVWHVESRTCYTLRGHTEWVNCVKLHPKSFSCFSCSDDTTIR-MWDIRTNSC 455
             +AD++V+         + LR   E    +K   K  +    S+D   + + D  T+  
Sbjct: 268 IQNADRSVE--------TFRLRKQDEIAKALKKREKRLTEKGLSEDEIQQNLKDSFTSFI 319

Query: 456 LKVFR--GHVGQVQKIIPLTIK----DVENLATDNTSDGSS---PQDDPTMTDGAD-ESD 505
           +  F+    + +V+ +   T      D+     +NT D  S    + +PTM       S 
Sbjct: 320 MHPFQIVRSIYKVRSVCWATTTTSKLDLVVTTANNTVDYYSIKYQKREPTMPSPPKLHSI 379

Query: 506 TPSNEQETVLDENIPYPTHLLSCGLDNTIKLWDVKTGKCIRT-QFGHVEGVWDIAADNFR 564
                +  V   +I     LL+   + T+K+W++KT  CIRT + G+      +      
Sbjct: 380 DIRGHRSDVRAIDISGDNKLLATASNGTLKIWNIKTNSCIRTFECGYALACKFLPGGAL- 438

Query: 565 IISGSHDGSIKVWDLQSGKCMHTFNG 590
           ++ G+  G + ++DL S   ++T  G
Sbjct: 439 VVLGTKTGDLHLYDLASSTLLNTIEG 464

 Score = 38.5 bits (88), Expect = 0.020,   Method: Compositional matrix adjust.
 Identities = 28/89 (31%), Positives = 41/89 (46%), Gaps = 5/89 (5%)

Query: 496 TMTDGADESDTPSNEQETVLDENIPY--PTHLLSCGL-DNTIKLWDVKTGKCIRTQFGHV 552
           T+TDG       +   +      + Y   T LL+ G  D  IK+WD+ +   + +  GH 
Sbjct: 58  TLTDGLPPGAVDAKSTKPAETSYLQYHPETRLLAVGYNDGAIKIWDLLSKSVLISFNGHK 117

Query: 553 EGVWDIAADN--FRIISGSHDGSIKVWDL 579
             +  +  D    R+ISGS D  I VWDL
Sbjct: 118 SAITILTFDQTGTRLISGSRDSDIIVWDL 146

 Score = 32.7 bits (73), Expect = 1.2,   Method: Compositional matrix adjust.
 Identities = 26/90 (28%), Positives = 43/90 (47%), Gaps = 15/90 (16%)

Query: 517 ENIPYPTHLLSCGLDNTIKLWDVKTGKCIRTQF-GHVEGVWDIAAD------------NF 563
           EN      +L+  L+N +  W +K+G+ I T   G   G  D  +               
Sbjct: 29  ENRNSTGQVLTGALEN-VNCWSMKSGELIGTLTDGLPPGAVDAKSTKPAETSYLQYHPET 87

Query: 564 RIIS-GSHDGSIKVWDLQSGKCMHTFNGRR 592
           R+++ G +DG+IK+WDL S   + +FNG +
Sbjct: 88  RLLAVGYNDGAIKIWDLLSKSVLISFNGHK 117

>KLLA0D16390g 1378884..1381694 similar to sp|Q12220 Saccharomyces
           cerevisiae YLR129w DIP2 DOM34P-interacting protein,
           start by similarity
          Length = 936

 Score = 65.9 bits (159), Expect = 7e-11,   Method: Compositional matrix adjust.
 Identities = 52/182 (28%), Positives = 83/182 (45%), Gaps = 21/182 (11%)

Query: 306 LTLQFNYRLLFTGSYDSTIGIWD------LFTG---KLIRRLSGHSDGVKTLYFD----- 351
           L L  N + L TGS D +   WD      L  G   K I +L    D    L  D     
Sbjct: 470 LDLTSNGKRLVTGSADKSCKFWDFEVVEQLVPGTKDKYIPQLKLVHDTTLELTDDILAVK 529

Query: 352 ----DRKLITGSLDKTIRVWNYITGECISTYRGHSDSVLSVDSY--QKVIVSGSADKTVK 405
               DR L    LD T++V+ + + +   +  GH   VLS+D     K++++ SADK +K
Sbjct: 530 ISSEDRYLAVSLLDNTVKVFFFDSLKFYLSLYGHKLPVLSIDFSVDSKMLITSSADKNIK 589

Query: 406 VWHVESRTCY-TLRGHTEWVNCVKLHPKSFSCFSCSDDTTIRMWDIRTNSCLKVFRGHVG 464
           +W V+   C+ ++  H + +  V+    + + FSC  D  ++ WD     C++   GH  
Sbjct: 590 IWGVDFGDCHKSIFAHQDSIMSVRFEADTHNFFSCGKDGAVKRWDGDKFDCIQKLNGHQS 649

Query: 465 QV 466
           +V
Sbjct: 650 EV 651

 Score = 65.1 bits (157), Expect = 1e-10,   Method: Compositional matrix adjust.
 Identities = 66/288 (22%), Positives = 107/288 (37%), Gaps = 72/288 (25%)

Query: 314 LLFTGSYDSTIGIWDLFTGKLIRRLSGHSDGVKTLYF--DDRKLITGSLDKTIRVWNYIT 371
           L+  G+    + ++DL +  L+     H+  + +L    + ++L+TGS DK+ + W++  
Sbjct: 436 LVVVGTRQGELQLFDLASSTLLSTTEAHTAAIWSLDLTSNGKRLVTGSADKSCKFWDFEV 495

Query: 372 GECI----------------STYRGHSDSVLSV--DSYQKVIVSGSADKTVKVWHVESRT 413
            E +                 T    +D +L+V   S  + +     D TVKV+  +S  
Sbjct: 496 VEQLVPGTKDKYIPQLKLVHDTTLELTDDILAVKISSEDRYLAVSLLDNTVKVFFFDSLK 555

Query: 414 CY-TLRGHTEWVNCVKLHPKSFSCFSCSDDTTIRMWDIRTNSCLKVFRGHVGQVQKIIPL 472
            Y +L GH   V  +     S    + S D  I++W +    C K    H          
Sbjct: 556 FYLSLYGHKLPVLSIDFSVDSKMLITSSADKNIKIWGVDFGDCHKSIFAH---------- 605

Query: 473 TIKDVENLATDNTSDGSSPQDDPTMTDGADESDTPSNEQETVLDENIPYPTH-LLSCGLD 531
                                                 Q++++       TH   SCG D
Sbjct: 606 --------------------------------------QDSIMSVRFEADTHNFFSCGKD 627

Query: 532 NTIKLWDVKTGKCIRTQFGHVEGVWDIAA--DNFRIISGSHDGSIKVW 577
             +K WD     CI+   GH   VW IA   D   ++S SHD SI+VW
Sbjct: 628 GAVKRWDGDKFDCIQKLNGHQSEVWCIAVSPDGRTVVSTSHDHSIRVW 675

 Score = 62.4 bits (150), Expect = 7e-10,   Method: Compositional matrix adjust.
 Identities = 44/141 (31%), Positives = 66/141 (46%), Gaps = 5/141 (3%)

Query: 313 RLLFTGSYDSTIGIWDLFTGKLIRRLSGHSDGVKTLYF--DDRKLITGSLDKTIRVWNYI 370
           R L     D+T+ ++   + K    L GH   V ++ F  D + LIT S DK I++W   
Sbjct: 535 RYLAVSLLDNTVKVFFFDSLKFYLSLYGHKLPVLSIDFSVDSKMLITSSADKNIKIWGVD 594

Query: 371 TGECISTYRGHSDSVLSV--DSYQKVIVSGSADKTVKVWHVESRTCY-TLRGHTEWVNCV 427
            G+C  +   H DS++SV  ++      S   D  VK W  +   C   L GH   V C+
Sbjct: 595 FGDCHKSIFAHQDSIMSVRFEADTHNFFSCGKDGAVKRWDGDKFDCIQKLNGHQSEVWCI 654

Query: 428 KLHPKSFSCFSCSDDTTIRMW 448
            + P   +  S S D +IR+W
Sbjct: 655 AVSPDGRTVVSTSHDHSIRVW 675

 Score = 62.0 bits (149), Expect = 1e-09,   Method: Compositional matrix adjust.
 Identities = 64/269 (23%), Positives = 103/269 (38%), Gaps = 68/269 (25%)

Query: 354 KLITGSLDKTIRVWNYITGECISTYRG----------HSDSVLSVDSYQK---VIVSGSA 400
           KLITG+L+  I++W   T E      G             SV++   + K   ++  G  
Sbjct: 35  KLITGALE-NIQIWTLKTNEVEVLTDGLPIGAVETNISKPSVVTAMCFHKETELLCVGYE 93

Query: 401 DKTVKVWHVESRTCYT-LRGHTEWVNCVKLHPKSFSCFSCSDDTTIRMWDIRTNSCLKVF 459
           D  +KVW + S++      GH   V  ++L  +     S S D+ + +WD+     L   
Sbjct: 94  DGVIKVWDLLSKSVLMQFNGHKSGVTVLRLDSEGTRLVSGSKDSDLIIWDLVGEVGLMKL 153

Query: 460 RGHVGQVQKIIPLTIKDVENLATDNTSDGSSPQDDPTMTDGADESDTPSNEQETVLDENI 519
           R H   +  I                                             +D N+
Sbjct: 154 RSHKDAITGIW--------------------------------------------IDHNM 169

Query: 520 PYPTHLLSCGLDNTIKLWDVKTG-KCIRTQFGHVEGVWDIAADNFRIISGSHDGSIKVWD 578
            +   L+S   D  IK+WD+K G +C+ T   H    W +A D   II+ S D   K+W+
Sbjct: 170 DW---LISVAKDGLIKVWDLKAGGQCVETHMAHTGQCWSMAIDEEVIITTSMDSQAKIWE 226

Query: 579 LQSGKCMHTFNGRRL-QRETQHTQTQSLG 606
           L   K     NG ++ +R T  T+++  G
Sbjct: 227 LDLEKS----NGEKISERGTFETESKQRG 251

 Score = 61.6 bits (148), Expect = 1e-09,   Method: Compositional matrix adjust.
 Identities = 36/121 (29%), Positives = 63/121 (52%), Gaps = 5/121 (4%)

Query: 295 IQEFKGHMDGVLTLQFNYR--LLFTGSYDSTIGIWDLFTGKLIRRLSGHSDGVKTLYFDD 352
           + +F GH  GV  L+ +     L +GS DS + IWDL     + +L  H D +  ++ D 
Sbjct: 108 LMQFNGHKSGVTVLRLDSEGTRLVSGSKDSDLIIWDLVGEVGLMKLRSHKDAITGIWIDH 167

Query: 353 RK--LITGSLDKTIRVWNY-ITGECISTYRGHSDSVLSVDSYQKVIVSGSADKTVKVWHV 409
               LI+ + D  I+VW+    G+C+ T+  H+    S+   ++VI++ S D   K+W +
Sbjct: 168 NMDWLISVAKDGLIKVWDLKAGGQCVETHMAHTGQCWSMAIDEEVIITTSMDSQAKIWEL 227

Query: 410 E 410
           +
Sbjct: 228 D 228

 Score = 55.8 bits (133), Expect = 8e-08,   Method: Compositional matrix adjust.
 Identities = 35/144 (24%), Positives = 68/144 (47%), Gaps = 8/144 (5%)

Query: 313 RLLFTGSYDSTIGIWDLFTGKLIRRLSGHSDGVKTLYFDDR--KLITGSLDKTIRVWNYI 370
            LL  G  D  I +WDL +  ++ + +GH  GV  L  D    +L++GS D  + +W+ +
Sbjct: 86  ELLCVGYEDGVIKVWDLLSKSVLMQFNGHKSGVTVLRLDSEGTRLVSGSKDSDLIIWDLV 145

Query: 371 TGECISTYRGHSDSV--LSVDSYQKVIVSGSADKTVKVWHVES--RTCYTLRGHTEWVNC 426
               +   R H D++  + +D     ++S + D  +KVW +++  +   T   HT    C
Sbjct: 146 GEVGLMKLRSHKDAITGIWIDHNMDWLISVAKDGLIKVWDLKAGGQCVETHMAHTG--QC 203

Query: 427 VKLHPKSFSCFSCSDDTTIRMWDI 450
             +        + S D+  ++W++
Sbjct: 204 WSMAIDEEVIITTSMDSQAKIWEL 227

 Score = 51.2 bits (121), Expect = 2e-06,   Method: Compositional matrix adjust.
 Identities = 63/277 (22%), Positives = 110/277 (39%), Gaps = 27/277 (9%)

Query: 337 RLSGHSDGVKTLYF-DDRKLITGSLDKTIRVWNYITGECISTYRGHSDSVLSVDSYQKVI 395
            L GH   ++++   DD KL++ + +  ++VWN  T +CI T+         +     ++
Sbjct: 378 ELQGHRTDIRSMDISDDGKLLSTASNGELKVWNLTTKKCIRTFSCGYALCSQMLPGGLLV 437

Query: 396 VSGSADKTVKVWHVESRTCY-TLRGHTEWVNCVKLHPKSFSCFSCSDDTTIRMWDIRTNS 454
           V G+    ++++ + S T   T   HT  +  + L        + S D + + WD     
Sbjct: 438 VVGTRQGELQLFDLASSTLLSTTEAHTAAIWSLDLTSNGKRLVTGSADKSCKFWDFEVVE 497

Query: 455 CLKVFRGHVGQVQKIIPLTIKDVENLATDNTSD----GSSPQD--------DPTMT---- 498
            L       G   K IP  +K V +   + T D      S +D        D T+     
Sbjct: 498 QLVP-----GTKDKYIP-QLKLVHDTTLELTDDILAVKISSEDRYLAVSLLDNTVKVFFF 551

Query: 499 DGADESDTPSNEQETVLDENIPYPTHLL-SCGLDNTIKLWDVKTGKCIRTQFGHVEGVWD 557
           D      +    +  VL  +    + +L +   D  IK+W V  G C ++ F H + +  
Sbjct: 552 DSLKFYLSLYGHKLPVLSIDFSVDSKMLITSSADKNIKIWGVDFGDCHKSIFAHQDSIMS 611

Query: 558 I--AADNFRIISGSHDGSIKVWDLQSGKCMHTFNGRR 592
           +   AD     S   DG++K WD     C+   NG +
Sbjct: 612 VRFEADTHNFFSCGKDGAVKRWDGDKFDCIQKLNGHQ 648

>KLLA0E21263g 1892524..1893813 similar to sp|P40968 Saccharomyces
           cerevisiae YDR364c CDC40 cell division control protein
           singleton, start by similarity
          Length = 429

 Score = 64.7 bits (156), Expect = 9e-11,   Method: Compositional matrix adjust.
 Identities = 53/188 (28%), Positives = 80/188 (42%), Gaps = 28/188 (14%)

Query: 294 RIQEFKGHMDGVLTLQF---NYRLLFTGSYDSTIGIWDLFTGK-LIRRLSGHSDGVKTLY 349
           +I E+ GH +G  +L+F      LL +G  D+ I +WD +  + L+R   GHS  +K L 
Sbjct: 127 KIAEYYGHKNGTTSLRFIPKTGHLLLSGGNDNIIKLWDFYHERELLRTYEGHSMTIKDLN 186

Query: 350 FDD--RKLITGSLDKTIRVWNYITGECISTYRGHSDSVLSVDSYQKVIVSGSADKTVKVW 407
           F D      + S DK +++WN        T +G  D  L  +S    I     DK   V 
Sbjct: 187 FTDNGHSFASASFDKWVKIWN--------TEKGIIDKRLRFNSVPNCITFHPKDKNQLVV 238

Query: 408 HVESRTC--YTLR------------GHTEWVNCVKLHPKSFSCFSCSDDTTIRMWDIRTN 453
            + +     Y LR             H   +  +K  P      S S+D T+R+W+ R N
Sbjct: 239 GLSNSEIRHYDLRLSENHGEVQKYDHHQGSILALKYFPDGKKLISSSEDKTVRIWENRIN 298

Query: 454 SCLKVFRG 461
             +K   G
Sbjct: 299 IPIKQISG 306

 Score = 36.2 bits (82), Expect = 0.082,   Method: Compositional matrix adjust.
 Identities = 25/68 (36%), Positives = 34/68 (50%), Gaps = 4/68 (5%)

Query: 519 IPYPTHLL-SCGLDNTIKLWDV-KTGKCIRTQFGHVEGVWDI--AADNFRIISGSHDGSI 574
           IP   HLL S G DN IKLWD     + +RT  GH   + D+    +     S S D  +
Sbjct: 144 IPKTGHLLLSGGNDNIIKLWDFYHERELLRTYEGHSMTIKDLNFTDNGHSFASASFDKWV 203

Query: 575 KVWDLQSG 582
           K+W+ + G
Sbjct: 204 KIWNTEKG 211

>Scas_721.7
          Length = 325

 Score = 63.5 bits (153), Expect = 1e-10,   Method: Compositional matrix adjust.
 Identities = 42/132 (31%), Positives = 64/132 (48%), Gaps = 16/132 (12%)

Query: 292 HCRIQEFKGHMDGVLTLQFN--YRLLFTGSYDSTIGIWDLFTGKLIRRLSGHSDGVKTLY 349
           H  +    GH   V++L +N    LLFT S D +I IWD F G +++ +S HS+ V +L 
Sbjct: 88  HGCLHRLMGHTAPVISLTYNDSGNLLFTSSMDESIKIWDTFHGAILKTISAHSESVVSLS 147

Query: 350 F----DDRKLITGSLDKTIRVWNYITGECISTYR-----GHSDSVLSVDSYQ-----KVI 395
                D   L +GS D  IR+++  TG C+ T          D V+ +   +     K +
Sbjct: 148 ICPDRDSSVLASGSFDGLIRLFDTRTGHCLKTLTYDKDWKSDDGVVPISQVRFSPNGKFL 207

Query: 396 VSGSADKTVKVW 407
           +  S D  VK+W
Sbjct: 208 LVSSFDGIVKIW 219

 Score = 46.6 bits (109), Expect = 4e-05,   Method: Compositional matrix adjust.
 Identities = 54/200 (27%), Positives = 88/200 (44%), Gaps = 22/200 (11%)

Query: 404 VKVWHVESRTCYTL--RGHTEWVNCVKLHPKSFSCFSCSDDTTIRMWDIRTNSCLKVFRG 461
           + ++ +++R  +++    H   ++ V   P +    S SDD TI +  + T+ CL    G
Sbjct: 38  ILIYDLQTRAIHSIIPTSHVAPISEVAWSPDNQCLASASDDFTIEITHL-THGCLHRLMG 96

Query: 462 HVGQVQKIIPLTIKDVENLATDNTSDGSSPQDDPTMTDGADESDTPSNEQETVLDENIPY 521
           H   V   I LT  D  NL   ++ D S    D   T       T S   E+V+  +I  
Sbjct: 97  HTAPV---ISLTYNDSGNLLFTSSMDESIKIWD---TFHGAILKTISAHSESVVSLSICP 150

Query: 522 ---PTHLLSCGLDNTIKLWDVKTGKCIRT-----QFGHVEGVWDIAADNFR-----IISG 568
               + L S   D  I+L+D +TG C++T      +   +GV  I+   F      ++  
Sbjct: 151 DRDSSVLASGSFDGLIRLFDTRTGHCLKTLTYDKDWKSDDGVVPISQVRFSPNGKFLLVS 210

Query: 569 SHDGSIKVWDLQSGKCMHTF 588
           S DG +K+WD   G  + TF
Sbjct: 211 SFDGIVKIWDCVRGYVVRTF 230

>KLLA0E24508g complement(2175775..2176758) similar to sp|P38123
           Saccharomyces cerevisiae YBR175w, start by similarity
          Length = 327

 Score = 62.8 bits (151), Expect = 2e-10,   Method: Compositional matrix adjust.
 Identities = 44/161 (27%), Positives = 86/161 (53%), Gaps = 15/161 (9%)

Query: 313 RLLFTGSYDSTIGIWDLFTGKLIRRLSGHSDGVKTLYFDDRK--LITGSLDKTIRVWNYI 370
           + + +GS D T+ I  +  G+ IRRL GH+  V ++ ++++   L + S+D++I+ W+ +
Sbjct: 82  KCIASGSEDFTVEITHIIYGR-IRRLMGHTAPVISICYNNKGNILCSSSMDESIKEWHVL 140

Query: 371 TGECISTYRGHSDSVLSVDSYQ---KVIVSGSADKTVKVWHVESRTCY-TLRGHTEWVNC 426
           +G  + T   HSD+V+S+D  +    ++ SGS D  ++++  ES  C  TL    +W+  
Sbjct: 141 SGTALKTMSAHSDAVVSIDIPKFDSSILSSGSYDGLIRIFDTESGHCLKTLTYDKDWIAE 200

Query: 427 VKLHPKSFSCFS--------CSDDTTIRMWDIRTNSCLKVF 459
             + P S   FS         S D  +++W+    + ++ F
Sbjct: 201 DGVVPISTVKFSRNGKFLLVKSLDNVVKLWEYTRGTVVRTF 241

 Score = 48.5 bits (114), Expect = 7e-06,   Method: Compositional matrix adjust.
 Identities = 61/244 (25%), Positives = 102/244 (41%), Gaps = 32/244 (13%)

Query: 393 KVIVSGSADKTVKVWHVESRTCYTLRGHTEWVNCVKLHPKSFSCFSCSDDTTIRMWDIRT 452
           K I SGS D TV++ H+       L GHT  V  +  + K     S S D +I+ W + +
Sbjct: 82  KCIASGSEDFTVEITHIIYGRIRRLMGHTAPVISICYNNKGNILCSSSMDESIKEWHVLS 141

Query: 453 NSCLKVFRGHVGQVQKI-IPLTIKDVENLATDNTSDGSSPQDDPTMTDGADESDTPSNEQ 511
            + LK    H   V  I IP   K   ++ +  + DG     D   T+      T + ++
Sbjct: 142 GTALKTMSAHSDAVVSIDIP---KFDSSILSSGSYDGLIRIFD---TESGHCLKTLTYDK 195

Query: 512 ETVLDEN-IPYPT--------HLLSCGLDNTIKLWDVKTGKCIRTQF------------- 549
           + + ++  +P  T         LL   LDN +KLW+   G  +RT               
Sbjct: 196 DWIAEDGVVPISTVKFSRNGKFLLVKSLDNVVKLWEYTRGTVVRTFLWPHQETKAKLKYN 255

Query: 550 GHVEGVWDIAADNFRIISGSHDGSIKVWDLQSGKCMHTFNGRRLQRETQHTQTQSLGDKV 609
             +E ++    D   +ISG+  GS+ VW++ S   +   + +   R +      +  DKV
Sbjct: 256 CGLELIYPQGKDPL-VISGNDSGSMCVWNVYSKNLVQKIDEK--HRNSPLISISASYDKV 312

Query: 610 APIA 613
           A ++
Sbjct: 313 ATLS 316

 Score = 42.4 bits (98), Expect = 8e-04,   Method: Compositional matrix adjust.
 Identities = 32/143 (22%), Positives = 68/143 (47%), Gaps = 25/143 (17%)

Query: 295 IQEFKGHMDGVLTL---QFNYRLLFTGSYDSTIGIWDLFTGKLIRRLSGHSD-------- 343
           ++    H D V+++   +F+  +L +GSYD  I I+D  +G  ++ L+   D        
Sbjct: 145 LKTMSAHSDAVVSIDIPKFDSSILSSGSYDGLIRIFDTESGHCLKTLTYDKDWIAEDGVV 204

Query: 344 GVKTLYF--DDRKLITGSLDKTIRVWNYITGECISTYR-GHSDS-----------VLSVD 389
            + T+ F  + + L+  SLD  +++W Y  G  + T+   H ++           ++   
Sbjct: 205 PISTVKFSRNGKFLLVKSLDNVVKLWEYTRGTVVRTFLWPHQETKAKLKYNCGLELIYPQ 264

Query: 390 SYQKVIVSGSADKTVKVWHVESR 412
               +++SG+   ++ VW+V S+
Sbjct: 265 GKDPLVISGNDSGSMCVWNVYSK 287

 Score = 39.7 bits (91), Expect = 0.005,   Method: Compositional matrix adjust.
 Identities = 39/172 (22%), Positives = 63/172 (36%), Gaps = 51/172 (29%)

Query: 420 HTEWVNCVKLHPKSFSCFSCSDDTTIRMWDIRTNSCLKVFRGHVGQVQKIIPLTIKDVEN 479
           H E +NC+   P S    S S+D T+ +    T+      R  +G    +I +   +  N
Sbjct: 68  HKECINCLCWSPDSKCIASGSEDFTVEI----THIIYGRIRRLMGHTAPVISICYNNKGN 123

Query: 480 LATDNTSDGSSPQDDPTMTDGADESDTPSNEQETVLDENIPYPTHLLSCGLDNTIKLWDV 539
           +                                            L S  +D +IK W V
Sbjct: 124 I--------------------------------------------LCSSSMDESIKEWHV 139

Query: 540 KTGKCIRTQFGHVEGVWDIAADNFR---IISGSHDGSIKVWDLQSGKCMHTF 588
            +G  ++T   H + V  I    F    + SGS+DG I+++D +SG C+ T 
Sbjct: 140 LSGTALKTMSAHSDAVVSIDIPKFDSSILSSGSYDGLIRIFDTESGHCLKTL 191

>Scas_658.1
          Length = 442

 Score = 63.2 bits (152), Expect = 3e-10,   Method: Compositional matrix adjust.
 Identities = 44/172 (25%), Positives = 79/172 (45%), Gaps = 16/172 (9%)

Query: 300 GHMDGVLTLQF---NYRLLFTGSYDSTIGIWDLFTGK-LIRRLSGHSDGVKTLYFDD--R 353
           GH +G  +L F   +  LL +G  D+ + +WD +  + L+R   GHS  + +L F+D   
Sbjct: 147 GHTNGTTSLTFLPNSGNLLLSGGNDNIVKVWDFYHKRNLLRDYKGHSKAINSLDFNDDGT 206

Query: 354 KLITGSLDKTIRVWNYITGECIST--YRGHSDSVLSVDSYQKVIVSGSADKTVKVWHVES 411
             I+ S D TI++W+   G+  +   ++   + V          + G A+   K++H ++
Sbjct: 207 NFISSSFDHTIKIWDTEQGKVKTKLHFKSTPNDVKFRPFNSSEFIVGFANS--KIYHYDT 264

Query: 412 RT------CYTLRGHTEWVNCVKLHPKSFSCFSCSDDTTIRMWDIRTNSCLK 457
           R             H   +  +K  P      S S+D T+R+WD + N  +K
Sbjct: 265 RISENDGRVQVYDHHMSSILALKFFPDGSKFISSSEDKTVRIWDNQVNVPIK 316

 Score = 48.5 bits (114), Expect = 1e-05,   Method: Compositional matrix adjust.
 Identities = 49/199 (24%), Positives = 86/199 (43%), Gaps = 30/199 (15%)

Query: 288 WRKGHCR--IQEFKGHMDGVLTLQFN--YRLLFTGSYDSTIGIWDLFTGKLIRRLSGHS- 342
           W   H R  ++++KGH   + +L FN       + S+D TI IWD   GK+  +L   S 
Sbjct: 177 WDFYHKRNLLRDYKGHSKAINSLDFNDDGTNFISSSFDHTIKIWDTEQGKVKTKLHFKST 236

Query: 343 -DGVKTLYFDDRKLITGSLDKTIRVWNYITGEC---ISTYRGHSDSVLSVDSYQ--KVIV 396
            + VK   F+  + I G  +  I  ++    E    +  Y  H  S+L++  +      +
Sbjct: 237 PNDVKFRPFNSSEFIVGFANSKIYHYDTRISENDGRVQVYDHHMSSILALKFFPDGSKFI 296

Query: 397 SGSADKTVKVW---------HVESRTCYTLRGHTEWVNCVKLHPKSFSCFSCSDDTTIRM 447
           S S DKTV++W          +   T Y++         + +HP   +  + S D TI  
Sbjct: 297 SSSEDKTVRIWDNQVNVPIKQISDTTQYSMP-------SIDIHPDKKNFCAQSMDNTIYT 349

Query: 448 WDIRTN---SCLKVFRGHV 463
           + ++     +  K+F+G  
Sbjct: 350 YSMKPKYRRNPNKMFKGQT 368

 Score = 42.0 bits (97), Expect = 0.001,   Method: Compositional matrix adjust.
 Identities = 24/63 (38%), Positives = 33/63 (52%), Gaps = 3/63 (4%)

Query: 525 LLSCGLDNTIKLWDVKTGK-CIRTQFGHVEGV--WDIAADNFRIISGSHDGSIKVWDLQS 581
           LLS G DN +K+WD    +  +R   GH + +   D   D    IS S D +IK+WD + 
Sbjct: 165 LLSGGNDNIVKVWDFYHKRNLLRDYKGHSKAINSLDFNDDGTNFISSSFDHTIKIWDTEQ 224

Query: 582 GKC 584
           GK 
Sbjct: 225 GKV 227

>YBR175W (SWD3) [360] chr2 (582365..583312) Component of SET1 and
           COMPASS complex, has several WD (WD-40) repeats and may
           be involved in chromatin remodeling [948 bp, 315 aa]
          Length = 315

 Score = 62.0 bits (149), Expect = 3e-10,   Method: Compositional matrix adjust.
 Identities = 41/128 (32%), Positives = 62/128 (48%), Gaps = 15/128 (11%)

Query: 295 IQEFKGHMDGVLTLQFNYR--LLFTGSYDSTIGIWDLFTGKLIRRLSGHSDGVKTL---Y 349
           +  F GH   V++L FN +  LLFT S D +I IWD   G L++ +S HS+ V ++    
Sbjct: 89  LHTFIGHTAPVISLTFNRKGNLLFTSSMDESIKIWDTLNGSLMKTISAHSEAVVSVDVPM 148

Query: 350 FDDRKLITGSLDKTIRVWNYITGECISTYRGHSD----------SVLSVDSYQKVIVSGS 399
            D   L +GS D  IR+++  TG C+ T     D          S +      + ++  S
Sbjct: 149 NDSSILSSGSYDGLIRIFDAETGHCLKTLTYDKDWKRENGVVPISQVKFSENARYLLVKS 208

Query: 400 ADKTVKVW 407
            D  VK+W
Sbjct: 209 LDGVVKIW 216

 Score = 50.1 bits (118), Expect = 3e-06,   Method: Compositional matrix adjust.
 Identities = 49/218 (22%), Positives = 82/218 (37%), Gaps = 58/218 (26%)

Query: 393 KVIVSGSADKTVKVWHVESRTCYTLRGHTEWVNCVKLHPKSFSCFSCSDDTTIRMWDIRT 452
           + I + S D +V++ H+     +T  GHT  V  +  + K    F+ S D +I++WD   
Sbjct: 68  QCIATASDDFSVEIIHLSYGLLHTFIGHTAPVISLTFNRKGNLLFTSSMDESIKIWDTLN 127

Query: 453 NSCLKVFRGHVGQVQKIIPLTIKDVENLATDNTSDGSSPQDDPTMTDGADESDTPSNEQE 512
            S +K    H   V  +                                   D P N+  
Sbjct: 128 GSLMKTISAHSEAVVSV-----------------------------------DVPMNDSS 152

Query: 513 TVLDENIPYPTHLLSCG-LDNTIKLWDVKTGKCIRT-----QFGHVEGVWDIAADNFR-- 564
                       +LS G  D  I+++D +TG C++T      +    GV  I+   F   
Sbjct: 153 ------------ILSSGSYDGLIRIFDAETGHCLKTLTYDKDWKRENGVVPISQVKFSEN 200

Query: 565 ---IISGSHDGSIKVWDLQSGKCMHTFNGRRLQRETQH 599
              ++  S DG +K+WD   G  + TF  + L++   H
Sbjct: 201 ARYLLVKSLDGVVKIWDCIGGCVVRTFQVQPLEKGVLH 238

>KLLA0E07942g 717476..718648 similar to sp|P20484 Saccharomyces
           cerevisiae YKL021c MAK11 involved in cell growth and
           replication of M1 dsRNA virus singleton, start by
           similarity
          Length = 390

 Score = 62.4 bits (150), Expect = 4e-10,   Method: Compositional matrix adjust.
 Identities = 42/137 (30%), Positives = 67/137 (48%), Gaps = 15/137 (10%)

Query: 329 LFTGKLIRRLSGHSDGVKTLYFDDRKLITGSLDKTIRVWNYITGECISTYRGHSDSVLSV 388
           LFT   I     HS  VK L    R L++GS D+ IR+++    + + T  GH  S+ ++
Sbjct: 30  LFTP--IFHFQAHSLSVKCLDISKRYLVSGSNDENIRIYDLQKRKELGTLLGHQGSITNL 87

Query: 389 D------------SYQKVIVSGSADKTVKVWHVESRTCY-TLRGHTEWVNCVKLHPKSFS 435
                           K ++S S D  + VW V+    + TL+GHT  +N   +HP +  
Sbjct: 88  RFSRGKDADGQDIQLNKWLLSASEDHKIIVWRVKDWENFGTLKGHTARINDFDIHPSNRV 147

Query: 436 CFSCSDDTTIRMWDIRT 452
             S S+D +IR+W++ T
Sbjct: 148 AVSVSEDHSIRLWNLMT 164

 Score = 49.3 bits (116), Expect = 5e-06,   Method: Compositional matrix adjust.
 Identities = 38/129 (29%), Positives = 57/129 (44%), Gaps = 14/129 (10%)

Query: 295 IQEFKGHMDGVLTLQFNYRLLFTGSYDSTIGIWDLFTGKLIRRLSGHSDGVKTLYFDDRK 354
           I  F+ H   V  L  + R L +GS D  I I+DL   K +  L GH   +  L F   K
Sbjct: 34  IFHFQAHSLSVKCLDISKRYLVSGSNDENIRIYDLQKRKELGTLLGHQGSITNLRFSRGK 93

Query: 355 ------------LITGSLDKTIRVWNYITGECISTYRGHSDSVLSVDSY--QKVIVSGSA 400
                       L++ S D  I VW     E   T +GH+  +   D +   +V VS S 
Sbjct: 94  DADGQDIQLNKWLLSASEDHKIIVWRVKDWENFGTLKGHTARINDFDIHPSNRVAVSVSE 153

Query: 401 DKTVKVWHV 409
           D ++++W++
Sbjct: 154 DHSIRLWNL 162

 Score = 38.5 bits (88), Expect = 0.013,   Method: Compositional matrix adjust.
 Identities = 44/190 (23%), Positives = 69/190 (36%), Gaps = 41/190 (21%)

Query: 414 CYTLRGHTEWVNCVKLHPKSFSCFSCSDDTTIRMWDIRTNSCLKVFRGHVGQVQKIIPLT 473
            +  + H+  V C+ +  +     S S+D  IR++D++    L    GH G +       
Sbjct: 34  IFHFQAHSLSVKCLDISKRYL--VSGSNDENIRIYDLQKRKELGTLLGHQGSIT------ 85

Query: 474 IKDVENLATDNTSDGSSPQDDPTMTDGADESDTPSNEQETVLDENIPYPTHLLSCGLDNT 533
                NL      D           DG D                I     LLS   D+ 
Sbjct: 86  -----NLRFSRGKDA----------DGQD----------------IQLNKWLLSASEDHK 114

Query: 534 IKLWDVKTGKCIRTQFGHVEGV--WDIAADNFRIISGSHDGSIKVWDLQSGKCMHTFNGR 591
           I +W VK  +   T  GH   +  +DI   N   +S S D SI++W+L + K       R
Sbjct: 115 IIVWRVKDWENFGTLKGHTARINDFDIHPSNRVAVSVSEDHSIRLWNLMTVKKAGVLKLR 174

Query: 592 RLQRETQHTQ 601
           +  +  Q  +
Sbjct: 175 KYNQNGQFVR 184

>Sklu_2172.6 YLR129W, Contig c2172 11261-12048 reverse complement
          Length = 263

 Score = 61.2 bits (147), Expect = 4e-10,   Method: Compositional matrix adjust.
 Identities = 39/141 (27%), Positives = 69/141 (48%), Gaps = 6/141 (4%)

Query: 314 LLFTGSYDSTIGIWDLFTGKLIRRLSGHSDGVKTLYFD--DRKLITGSLDKTIRVWNYIT 371
           LL  G  D  I IWDL +  ++   +GH   +  L FD    +LI+GS D  I +W+ + 
Sbjct: 89  LLAVGYADGVIKIWDLISKTVLINFNGHKSAITVLRFDPTGTRLISGSKDSDIIIWDLVG 148

Query: 372 GECISTYRGHSDSVLSVD-SYQKVIVSGSADKTVKVWHVESRTCY-TLRGHTEWVNCVKL 429
              +   R H DS+  +    +  ++S S D  +K+W ++++ C  T   HT    C  L
Sbjct: 149 EVGLYKLRSHKDSITGIWCENEDWLISTSKDGLIKIWDLKTQQCVETHMAHTS--ECWGL 206

Query: 430 HPKSFSCFSCSDDTTIRMWDI 450
              +    + S ++ I++W++
Sbjct: 207 AIHNDLVITTSTESQIKIWNL 227

 Score = 59.7 bits (143), Expect = 1e-09,   Method: Compositional matrix adjust.
 Identities = 31/116 (26%), Positives = 62/116 (53%), Gaps = 3/116 (2%)

Query: 298 FKGHMDGVLTLQFN--YRLLFTGSYDSTIGIWDLFTGKLIRRLSGHSDGVKTLYFDDRK- 354
           F GH   +  L+F+     L +GS DS I IWDL     + +L  H D +  ++ ++   
Sbjct: 113 FNGHKSAITVLRFDPTGTRLISGSKDSDIIIWDLVGEVGLYKLRSHKDSITGIWCENEDW 172

Query: 355 LITGSLDKTIRVWNYITGECISTYRGHSDSVLSVDSYQKVIVSGSADKTVKVWHVE 410
           LI+ S D  I++W+  T +C+ T+  H+     +  +  ++++ S +  +K+W+++
Sbjct: 173 LISTSKDGLIKIWDLKTQQCVETHMAHTSECWGLAIHNDLVITTSTESQIKIWNLD 228

 Score = 53.9 bits (128), Expect = 1e-07,   Method: Compositional matrix adjust.
 Identities = 40/168 (23%), Positives = 75/168 (44%), Gaps = 19/168 (11%)

Query: 315 LFTGSYDSTIGIWDLFTGKLIRRLS-----GHSDGVKT---------LYFDDRKLITGSL 360
           + TG+ ++ +  WD+ TG+L + L+     G  D   T          + +   L  G  
Sbjct: 37  ILTGALEN-VNCWDIKTGELSKILTDGLPPGAVDAKSTKLAESTYLQYHPETNLLAVGYA 95

Query: 361 DKTIRVWNYITGECISTYRGHSDS--VLSVDSYQKVIVSGSADKTVKVWHVESRT-CYTL 417
           D  I++W+ I+   +  + GH  +  VL  D     ++SGS D  + +W +      Y L
Sbjct: 96  DGVIKIWDLISKTVLINFNGHKSAITVLRFDPTGTRLISGSKDSDIIIWDLVGEVGLYKL 155

Query: 418 RGHTEWVNCVKLHPKSFSCFSCSDDTTIRMWDIRTNSCLKVFRGHVGQ 465
           R H + +  +    + +   S S D  I++WD++T  C++    H  +
Sbjct: 156 RSHKDSITGIWCENEDW-LISTSKDGLIKIWDLKTQQCVETHMAHTSE 202

 Score = 53.1 bits (126), Expect = 2e-07,   Method: Compositional matrix adjust.
 Identities = 45/205 (21%), Positives = 74/205 (36%), Gaps = 53/205 (25%)

Query: 394 VIVSGSADKTVKVWHVESRTCY-TLRGHTEWVNCVKLHPKSFSCFSCSDDTTIRMWDIRT 452
           ++  G AD  +K+W + S+T      GH   +  ++  P      S S D+ I +WD+  
Sbjct: 89  LLAVGYADGVIKIWDLISKTVLINFNGHKSAITVLRFDPTGTRLISGSKDSDIIIWDLVG 148

Query: 453 NSCLKVFRGHVGQVQKIIPLTIKDVENLATDNTSDGSSPQDDPTMTDGADESDTPSNEQE 512
              L   R H   +  I      + E+     + DG                        
Sbjct: 149 EVGLYKLRSHKDSITGIWC----ENEDWLISTSKDG------------------------ 180

Query: 513 TVLDENIPYPTHLLSCGLDNTIKLWDVKTGKCIRTQFGHVEGVWDIAADNFRIISGSHDG 572
                                IK+WD+KT +C+ T   H    W +A  N  +I+ S + 
Sbjct: 181 --------------------LIKIWDLKTQQCVETHMAHTSECWGLAIHNDLVITTSTES 220

Query: 573 SIKVWDLQSGKCMHTFNGRRLQRET 597
            IK+W+L   K M    G +L ++ 
Sbjct: 221 QIKIWNLDLDKDM----GSKLMKKA 241

 Score = 30.0 bits (66), Expect = 4.7,   Method: Compositional matrix adjust.
 Identities = 23/83 (27%), Positives = 35/83 (42%), Gaps = 15/83 (18%)

Query: 524 HLLSCGLDNTIKLWDVKTGKCIRTQF-GHVEGVWDIAADNFR-------------IISGS 569
            +L+  L+N +  WD+KTG+  +    G   G  D  +                 +  G 
Sbjct: 36  QILTGALEN-VNCWDIKTGELSKILTDGLPPGAVDAKSTKLAESTYLQYHPETNLLAVGY 94

Query: 570 HDGSIKVWDLQSGKCMHTFNGRR 592
            DG IK+WDL S   +  FNG +
Sbjct: 95  ADGVIKIWDLISKTVLINFNGHK 117

>Kwal_26.8953
          Length = 458

 Score = 62.0 bits (149), Expect = 6e-10,   Method: Compositional matrix adjust.
 Identities = 74/306 (24%), Positives = 127/306 (41%), Gaps = 63/306 (20%)

Query: 314 LLFTGSYDSTIGIWDLFTGKL-IRRLSGHSDGVKTL--YFDDRK---LITGSLDKTIRVW 367
           L+F  +    +  +DL    + +  +  H  G+ ++  + DD     + T S D   +V+
Sbjct: 142 LVFAATDSGKLLCYDLMNYTMPVASVQAHMRGITSIDVHIDDDSQCFVATASKDLHCKVF 201

Query: 368 NYITGEC--ISTYRGHSDSVLSVDSYQK----VIVSGSADKTVKVWHVES-RTCYTLRGH 420
             I  E   + T+ GH   V  +  ++     ++ S S D T K+  V +     + + H
Sbjct: 202 RLINSELQLVRTFSGHEHIVSHIKIWKNATDTLVASCSRDLTCKIGDVSNGYFLKSFQPH 261

Query: 421 TEWVNCVKLHPKSFSCFSCSDDTTIRMWDIRTNSCLKVFRGHVGQVQ--KIIPLTIKDVE 478
            EWV  + +  +     + S+D T+R+    T   L    GH   V+  KIIP+ +    
Sbjct: 262 AEWVRSLDIMGEYI--ITGSNDCTVRVSHWPTGRALSFGIGHDFPVEQVKIIPMELS--- 316

Query: 479 NLATDNTSDGSSPQDDPTMTDGADESDTPSNEQETVLDEN-IPYP-THLLSCGLDNTIKL 536
                                   ESD P N   +  +++ +P   +H++SC  DNT+++
Sbjct: 317 ------------------------ESDDPQNNTYSAFNKDYLPLGFSHVVSCSRDNTLRI 352

Query: 537 WDVKTGKCI----------RTQF-------GHVEGVWDIAADNFRIISGSHDGSIKVWDL 579
           W V   + I          R  F       GH   V DI      IIS S D S++VWDL
Sbjct: 353 WQVPIPRLIAHRAPQPNPARAHFTLVKTLKGHSSWVRDIRVRGNFIISCSDDRSVRVWDL 412

Query: 580 QSGKCM 585
           ++G+ +
Sbjct: 413 ETGETV 418

 Score = 46.2 bits (108), Expect = 7e-05,   Method: Compositional matrix adjust.
 Identities = 70/325 (21%), Positives = 124/325 (38%), Gaps = 74/325 (22%)

Query: 295 IQEFKGHMDGVLTLQFNYR-----LLFTGSYDSTIGIWDLFTG--KLIRRLSGHSDGVKT 347
           +   + HM G+ ++  +        + T S D    ++ L     +L+R  SGH   V  
Sbjct: 164 VASVQAHMRGITSIDVHIDDDSQCFVATASKDLHCKVFRLINSELQLVRTFSGHEHIVSH 223

Query: 348 LYF----DDRKLITGSLDKTIRVWNYITGECISTYRGHSDSVLSVDSYQKVIVSGSADKT 403
           +       D  + + S D T ++ +   G  + +++ H++ V S+D   + I++GS D T
Sbjct: 224 IKIWKNATDTLVASCSRDLTCKIGDVSNGYFLKSFQPHAEWVRSLDIMGEYIITGSNDCT 283

Query: 404 VKVWHVESRTCYTLR-GHTEWVNCVKLHP-----------KSFSCF-------------S 438
           V+V H  +    +   GH   V  VK+ P            ++S F             S
Sbjct: 284 VRVSHWPTGRALSFGIGHDFPVEQVKIIPMELSESDDPQNNTYSAFNKDYLPLGFSHVVS 343

Query: 439 CSDDTTIRMWDIRTNSCLKVFRGHVGQVQKIIPLTIKDVENLATDNTSDGSSPQDDPTMT 498
           CS D T+R+W                  Q  IP  I               +PQ +P   
Sbjct: 344 CSRDNTLRIW------------------QVPIPRLIAH------------RAPQPNPARA 373

Query: 499 DGADESDTPSNEQETVLDENIPYPTHLLSCGLDNTIKLWDVKTGKCIR------TQFGHV 552
                  T       V D  +     ++SC  D ++++WD++TG+ +R      T F + 
Sbjct: 374 HFT-LVKTLKGHSSWVRDIRV-RGNFIISCSDDRSVRVWDLETGETVREITDSHTGFANC 431

Query: 553 EGVWDIAADNFRIISGSHDGSIKVW 577
                   +   ++SG  DG + V+
Sbjct: 432 IDTDCGGLNRQLLVSGGADGKVIVY 456

 Score = 32.7 bits (73), Expect = 0.82,   Method: Compositional matrix adjust.
 Identities = 32/141 (22%), Positives = 55/141 (39%), Gaps = 20/141 (14%)

Query: 255 QNSTGSSSNADI------------QTQTTRPWKV----IYRERFKVESNWRKGHCRIQEF 298
           QN+T S+ N D             +  T R W+V    +   R    +  R     ++  
Sbjct: 322 QNNTYSAFNKDYLPLGFSHVVSCSRDNTLRIWQVPIPRLIAHRAPQPNPARAHFTLVKTL 381

Query: 299 KGHMDGVLTLQFNYRLLFTGSYDSTIGIWDLFTGKLIRRLSGHSDGVKTLYFDDRKLITG 358
           KGH   V  ++     + + S D ++ +WDL TG+ +R ++    G       D     G
Sbjct: 382 KGHSSWVRDIRVRGNFIISCSDDRSVRVWDLETGETVREITDSHTGFANCIDTD----CG 437

Query: 359 SLDKTIRVWNYITGECISTYR 379
            L++ + V     G+ I   R
Sbjct: 438 GLNRQLLVSGGADGKVIVYMR 458

>YKL021C (MAK11) [3234] chr11 complement(396987..398393) Protein
           essential for replication of M double-stranded RNA
           (dsRNA) virus, member of the WD (WD-40) repeat family
           [1407 bp, 468 aa]
          Length = 468

 Score = 62.0 bits (149), Expect = 6e-10,   Method: Compositional matrix adjust.
 Identities = 41/136 (30%), Positives = 64/136 (47%), Gaps = 18/136 (13%)

Query: 335 IRRLSGHSDGVKTLYFDDRKLITGSLDKTIRVWNYITGECISTYRGHSDSVLSVD----- 389
           I     HS  +K L    R L++GS D+ IR+++    + + T   H  S+ ++      
Sbjct: 99  IFHFQAHSLSIKCLAVSRRYLVSGSNDEHIRIYDLQKRKELGTLLSHQGSITALQFSHPA 158

Query: 390 ------------SYQKVIVSGSADKTVKVWHVES-RTCYTLRGHTEWVNCVKLHPKSFSC 436
                          K ++S S D  + VW V+   T  TL+GHT  VN V +HP +   
Sbjct: 159 SSSEDAAVSKGSKNSKWLLSASEDHKIMVWRVKDWETVGTLKGHTARVNDVDIHPTNRIA 218

Query: 437 FSCSDDTTIRMWDIRT 452
            S SDD +IR+W++ T
Sbjct: 219 ISVSDDHSIRLWNLMT 234

 Score = 46.6 bits (109), Expect = 5e-05,   Method: Compositional matrix adjust.
 Identities = 35/134 (26%), Positives = 59/134 (44%), Gaps = 19/134 (14%)

Query: 295 IQEFKGHMDGVLTLQFNYRLLFTGSYDSTIGIWDLFTGKLIRRLSGHSDGVKTLYF---- 350
           I  F+ H   +  L  + R L +GS D  I I+DL   K +  L  H   +  L F    
Sbjct: 99  IFHFQAHSLSIKCLAVSRRYLVSGSNDEHIRIYDLQKRKELGTLLSHQGSITALQFSHPA 158

Query: 351 -------------DDRKLITGSLDKTIRVWNYITGECISTYRGHSDSVLSVDSY--QKVI 395
                        + + L++ S D  I VW     E + T +GH+  V  VD +   ++ 
Sbjct: 159 SSSEDAAVSKGSKNSKWLLSASEDHKIMVWRVKDWETVGTLKGHTARVNDVDIHPTNRIA 218

Query: 396 VSGSADKTVKVWHV 409
           +S S D ++++W++
Sbjct: 219 ISVSDDHSIRLWNL 232

 Score = 37.0 bits (84), Expect = 0.043,   Method: Compositional matrix adjust.
 Identities = 39/169 (23%), Positives = 66/169 (39%), Gaps = 36/169 (21%)

Query: 415 YTLRGHTEWVNCVKLHPKSFSCFSCSDDTTIRMWDIRTNSCLKVFRGHVGQVQKIIPLTI 474
           +  + H+  + C+ +  +     S S+D  IR++D++    L     H G +  +     
Sbjct: 100 FHFQAHSLSIKCLAVSRRYL--VSGSNDEHIRIYDLQKRKELGTLLSHQGSITAL----- 152

Query: 475 KDVENLATDNTSDGSSPQDDPTMTDGADESDTPSNEQETVLDENIPYPTHLLSCGLDNTI 534
                      S  +S  +D  ++ G+  S                    LLS   D+ I
Sbjct: 153 ---------QFSHPASSSEDAAVSKGSKNSKW------------------LLSASEDHKI 185

Query: 535 KLWDVKTGKCIRTQFGHVEGV--WDIAADNFRIISGSHDGSIKVWDLQS 581
            +W VK  + + T  GH   V   DI   N   IS S D SI++W+L +
Sbjct: 186 MVWRVKDWETVGTLKGHTARVNDVDIHPTNRIAISVSDDHSIRLWNLMT 234

 Score = 35.0 bits (79), Expect = 0.17,   Method: Compositional matrix adjust.
 Identities = 25/111 (22%), Positives = 50/111 (45%), Gaps = 16/111 (14%)

Query: 375 ISTYRGHSDSVLSVDSYQKVIVSGSADKTVKVWHVESRT-CYTLRGHTEWVNCVKL-HPK 432
           I  ++ HS S+  +   ++ +VSGS D+ ++++ ++ R    TL  H   +  ++  HP 
Sbjct: 99  IFHFQAHSLSIKCLAVSRRYLVSGSNDEHIRIYDLQKRKELGTLLSHQGSITALQFSHPA 158

Query: 433 SFS--------------CFSCSDDTTIRMWDIRTNSCLKVFRGHVGQVQKI 469
           S S                S S+D  I +W ++    +   +GH  +V  +
Sbjct: 159 SSSEDAAVSKGSKNSKWLLSASEDHKIMVWRVKDWETVGTLKGHTARVNDV 209

>CAGL0K09284g 914937..917672 highly similar to sp|P25635
           Saccharomyces cerevisiae YCR057c PWP2 periodic
           tryptophan protein, start by similarity
          Length = 911

 Score = 62.4 bits (150), Expect = 8e-10,   Method: Compositional matrix adjust.
 Identities = 39/139 (28%), Positives = 69/139 (49%), Gaps = 7/139 (5%)

Query: 335 IRRLSGHSDGVKTLYF--DDRKLITGSLDKTIRVWNYITGECISTYRGHSDSVLSVDSYQ 392
           I +  GH D   +L +  D  +++T + D  I+VW+  +G C++T+  H+ +V +V   +
Sbjct: 334 ILKQQGHFDATNSLTYSPDGSRVVTAAEDGKIKVWDVASGFCLATFEEHTSAVTAVQFAK 393

Query: 393 K--VIVSGSADKTVKVWHVESRTCYTLRGHTEWVN--CVKLHPKSFSCFSCSDDTT-IRM 447
           K  V+ S S D TV+ W +     + +   TE V   C+ + P      + S D+  + +
Sbjct: 394 KGQVLFSASLDGTVRAWDLIRYRNFRVFTATERVQFTCLAVEPSGEVVSAGSTDSFDVFV 453

Query: 448 WDIRTNSCLKVFRGHVGQV 466
           W ++T   L    GH G V
Sbjct: 454 WSVQTGQLLDTLSGHEGPV 472

 Score = 61.6 bits (148), Expect = 1e-09,   Method: Compositional matrix adjust.
 Identities = 67/277 (24%), Positives = 116/277 (41%), Gaps = 31/277 (11%)

Query: 228 CEQHIDRKCPNCGWG---LPLLHM-KRARIQQNSTGSSSNADIQTQTTRPWKVIYRERFK 283
           C  HI+      G+      L  M +   +QQ S G +    +    +  W      +  
Sbjct: 262 CTFHINSNLLIVGFSNGEFRLYEMPEFVMVQQLSMGQNPVNTVSVNNSGEWLAFGSSKLG 321

Query: 284 --VESNWRKGHCRIQEFKGHMDGVLTLQF--NYRLLFTGSYDSTIGIWDLFTGKLIRRLS 339
             +   W+     +++ +GH D   +L +  +   + T + D  I +WD+ +G  +    
Sbjct: 322 QLLVYEWQSESYILKQ-QGHFDATNSLTYSPDGSRVVTAAEDGKIKVWDVASGFCLATFE 380

Query: 340 GHSDGVKTLYFDDRK--LITGSLDKTIRVWNYITGECISTYRGHSD---SVLSVDSYQKV 394
            H+  V  + F  +   L + SLD T+R W+ I       +        + L+V+   +V
Sbjct: 381 EHTSAVTAVQFAKKGQVLFSASLDGTVRAWDLIRYRNFRVFTATERVQFTCLAVEPSGEV 440

Query: 395 IVSGSADKT-VKVWHVES-RTCYTLRGHTEWVNCVKLHPKSFSCFSCSDDTTIRMWDIRT 452
           + +GS D   V VW V++ +   TL GH   V+C+    ++    S S D TIR+W I  
Sbjct: 441 VSAGSTDSFDVFVWSVQTGQLLDTLSGHEGPVSCLAFSMENAVLASASWDKTIRIWSI-- 498

Query: 453 NSCLKVFRGHVGQVQKIIPLTI-KDVENLATDNTSDG 488
                      G+ Q++ PL +  D+  LA   T DG
Sbjct: 499 ----------FGRSQQVEPLEVFADI--LAITITPDG 523

 Score = 41.6 bits (96), Expect = 0.002,   Method: Compositional matrix adjust.
 Identities = 66/280 (23%), Positives = 104/280 (37%), Gaps = 44/280 (15%)

Query: 351 DDRKLITGSLDKTIRVWNYITGE----CISTYRGHSDSVLSV--DSYQKVIVSGSADKTV 404
           D R L+T S D T RVW+ I  E      +T  GH D VL    +S Q+ I + S D  V
Sbjct: 157 DSRFLLTTSKDLTSRVWS-INSEDKELVATTLAGHRDYVLGAYFNSTQEKIYTISKDGAV 215

Query: 405 KVWHVESRT----------CYTLRGHTEW--------------VNCVKLHPKSFSCFSCS 440
             W   S+                    W              V C   H  S       
Sbjct: 216 FTWEYISKAQKEGLDEEDLEDEDLSKLSWRITKKNFFYANQAKVKCCTFHINSNLLIVGF 275

Query: 441 DDTTIRMWDIRTNSCLKVFRGHVGQVQKIIPLTIKDVENLATDNTSDGSSPQDDPTMTDG 500
            +   R++++     + V +  +GQ     P+    V N + +  + GSS      + + 
Sbjct: 276 SNGEFRLYEMP--EFVMVQQLSMGQN----PVNTVSVNN-SGEWLAFGSSKLGQLLVYEW 328

Query: 501 ADESDTPSNEQETVLDENIPYP---THLLSCGLDNTIKLWDVKTGKCIRTQFGHVEGVWD 557
             ES     +       ++ Y    + +++   D  IK+WDV +G C+ T   H   V  
Sbjct: 329 QSESYILKQQGHFDATNSLTYSPDGSRVVTAAEDGKIKVWDVASGFCLATFEEHTSAVTA 388

Query: 558 I--AADNFRIISGSHDGSIKVWDLQSGKCMHTFNG-RRLQ 594
           +  A     + S S DG+++ WDL   +    F    R+Q
Sbjct: 389 VQFAKKGQVLFSASLDGTVRAWDLIRYRNFRVFTATERVQ 428

>KLLA0F13244g 1224178..1226622 similar to sgd|S0004212 Saccharomyces
           cerevisiae YLR222c, start by similarity
          Length = 814

 Score = 62.0 bits (149), Expect = 8e-10,   Method: Compositional matrix adjust.
 Identities = 48/171 (28%), Positives = 70/171 (40%), Gaps = 17/171 (9%)

Query: 313 RLLFTGSYDSTIGIW-----------DLF---TGKLIRRLSGHSDGVKTLYFDDRKLITG 358
             + T S D TI  W           DL    T +  RR         ++  +D    T 
Sbjct: 454 EFIITASNDLTIKKWKVPKVTSDEPEDLILVKTSEYTRRAHEKDINAISISPNDSLFATA 513

Query: 359 SLDKTIRVWNYITGECISTYRGHSDSVLSVD--SYQKVIVSGSADKTVKVWHVESRTCY- 415
           S DKT ++WN   GE  +T   H   +  V    Y K++ + S DKT+K+W +ES     
Sbjct: 514 SYDKTCKIWNLDDGEFQATLANHKRGLWDVAFCQYDKLLATCSGDKTIKIWSLESYAVVK 573

Query: 416 TLRGHTEWVNCVKLHPKSFSCFSCSDDTTIRMWDIRTNSCLKVFRGHVGQV 466
           TL GHT  V       K+    S   D  + +WD+ T   +K    H  ++
Sbjct: 574 TLEGHTNAVQRCSFINKNKQLISTGADGLVIIWDLSTGESVKTLDAHNNRI 624

 Score = 57.0 bits (136), Expect = 3e-08,   Method: Compositional matrix adjust.
 Identities = 44/154 (28%), Positives = 72/154 (46%), Gaps = 7/154 (4%)

Query: 306 LTLQFNYRLLFTGSYDSTIGIWDLFTGKLIRRLSGHSDGVKTLYF--DDRKLITGSLDKT 363
           +++  N  L  T SYD T  IW+L  G+    L+ H  G+  + F   D+ L T S DKT
Sbjct: 501 ISISPNDSLFATASYDKTCKIWNLDDGEFQATLANHKRGLWDVAFCQYDKLLATCSGDKT 560

Query: 364 IRVWNYITGECISTYRGHSDSV--LSVDSYQKVIVSGSADKTVKVWHVES-RTCYTLRGH 420
           I++W+  +   + T  GH+++V   S  +  K ++S  AD  V +W + +  +  TL  H
Sbjct: 561 IKIWSLESYAVVKTLEGHTNAVQRCSFINKNKQLISTGADGLVIIWDLSTGESVKTLDAH 620

Query: 421 TEWVNCVKLHPKSFSCFSCSDDTTIRMWDIRTNS 454
              +  + +     S  +   D     W  R NS
Sbjct: 621 NNRIWALAVMNDGESFVTADADGFFEFW--RDNS 652

 Score = 55.5 bits (132), Expect = 1e-07,   Method: Compositional matrix adjust.
 Identities = 61/245 (24%), Positives = 103/245 (42%), Gaps = 37/245 (15%)

Query: 375 ISTYRGHSDSVLSVDSYQKV--IVSGSADKTVKVW--HVESRTCY---TLRGHTEWVNCV 427
           +  Y GH+D + S+D+      + + S D +V +W  H +    Y      GH   VN V
Sbjct: 383 VKMYEGHTDLLNSLDATADGLWVATASKDHSVILWRYHAKYEDFYPYTKFVGHVGSVNAV 442

Query: 428 KL---HPKSFSCF--SCSDDTTIRMWDIRTNSCLKVFRGHVGQVQKIIPLTIKDVENLA- 481
            L    P+S+  F  + S+D TI+ W        KV +    + + +I +   +    A 
Sbjct: 443 GLPNVMPRSWPEFIITASNDLTIKKW--------KVPKVTSDEPEDLILVKTSEYTRRAH 494

Query: 482 -TDNTSDGSSPQDDPTMTDGADES------------DTPSNEQETVLDENI-PYPTHLLS 527
             D  +   SP D    T   D++             T +N +  + D     Y   L +
Sbjct: 495 EKDINAISISPNDSLFATASYDKTCKIWNLDDGEFQATLANHKRGLWDVAFCQYDKLLAT 554

Query: 528 CGLDNTIKLWDVKTGKCIRTQFGHVEGVW--DIAADNFRIISGSHDGSIKVWDLQSGKCM 585
           C  D TIK+W +++   ++T  GH   V        N ++IS   DG + +WDL +G+ +
Sbjct: 555 CSGDKTIKIWSLESYAVVKTLEGHTNAVQRCSFINKNKQLISTGADGLVIIWDLSTGESV 614

Query: 586 HTFNG 590
            T + 
Sbjct: 615 KTLDA 619

 Score = 52.8 bits (125), Expect = 8e-07,   Method: Compositional matrix adjust.
 Identities = 67/332 (20%), Positives = 116/332 (34%), Gaps = 83/332 (25%)

Query: 279 RERFKVESNWRKGHCRIQEFKGHMDGVLTLQFNYRLLF--TGSYDSTIGIW-------DL 329
            E F+   N       ++ ++GH D + +L      L+  T S D ++ +W       D 
Sbjct: 367 EEEFENGENKETFPIEVKMYEGHTDLLNSLDATADGLWVATASKDHSVILWRYHAKYEDF 426

Query: 330 FTGKLIRRLSGHSDGVKTLYFDD-------RKLITGSLDKTIRVWNY------------I 370
           +      +  GH   V  +   +         +IT S D TI+ W              +
Sbjct: 427 YP---YTKFVGHVGSVNAVGLPNVMPRSWPEFIITASNDLTIKKWKVPKVTSDEPEDLIL 483

Query: 371 TGECISTYRGHSDSV--LSVDSYQKVIVSGSADKTVKVWHVE-SRTCYTLRGHTEWVNCV 427
                 T R H   +  +S+     +  + S DKT K+W+++      TL  H   +  V
Sbjct: 484 VKTSEYTRRAHEKDINAISISPNDSLFATASYDKTCKIWNLDDGEFQATLANHKRGLWDV 543

Query: 428 KLHPKSFSCFSCSDDTTIRMWDIRTNSCLKVFRGHVGQVQKIIPLTIKDVENLATDNTSD 487
                     +CS D TI++W + + + +K   GH   VQ+                   
Sbjct: 544 AFCQYDKLLATCSGDKTIKIWSLESYAVVKTLEGHTNAVQRC------------------ 585

Query: 488 GSSPQDDPTMTDGADESDTPSNEQETVLDENIPYPTHLLSCGLDNTIKLWDVKTGKCIRT 547
                           S    N+Q             L+S G D  + +WD+ TG+ ++T
Sbjct: 586 ----------------SFINKNKQ-------------LISTGADGLVIIWDLSTGESVKT 616

Query: 548 QFGHVEGVWDIAA--DNFRIISGSHDGSIKVW 577
              H   +W +A   D    ++   DG  + W
Sbjct: 617 LDAHNNRIWALAVMNDGESFVTADADGFFEFW 648

 Score = 32.7 bits (73), Expect = 0.93,   Method: Compositional matrix adjust.
 Identities = 21/86 (24%), Positives = 40/86 (46%), Gaps = 16/86 (18%)

Query: 519 IPYPTHLLSC----------GLDNTIKLWDVKTGKCIRTQFGH------VEGVWDIAADN 562
           I  P ++++C          G D ++ + D++ G    +  GH      V+   ++ ++ 
Sbjct: 100 ISSPVYVMNCDQTSTLLAIGGTDGSVSVIDIENGYVTHSLKGHGATISSVKFHGELNSEI 159

Query: 563 FRIISGSHDGSIKVWDLQSGKCMHTF 588
           +++ SG  +G IKVWDL    C  T 
Sbjct: 160 WKLASGDTNGMIKVWDLVKRNCQCTI 185

 Score = 30.0 bits (66), Expect = 6.3,   Method: Compositional matrix adjust.
 Identities = 20/77 (25%), Positives = 36/77 (46%), Gaps = 7/77 (9%)

Query: 355 LITGSLDKTIRVWNYITGECISTYRGHSDSVLSVDSYQKV------IVSGSADKTVKVWH 408
           L  G  D ++ V +   G    + +GH  ++ SV  + ++      + SG  +  +KVW 
Sbjct: 116 LAIGGTDGSVSVIDIENGYVTHSLKGHGATISSVKFHGELNSEIWKLASGDTNGMIKVWD 175

Query: 409 VESRTCY-TLRGHTEWV 424
           +  R C  T++ HT  V
Sbjct: 176 LVKRNCQCTIQEHTTAV 192

>CAGL0G09845g 940598..942100 similar to sp|P20053 Saccharomyces
           cerevisiae YPR178w PRP4 U4/U6 snRNP, hypothetical start
          Length = 500

 Score = 61.6 bits (148), Expect = 9e-10,   Method: Compositional matrix adjust.
 Identities = 73/276 (26%), Positives = 121/276 (43%), Gaps = 13/276 (4%)

Query: 311 NYRLLFTGSYDSTIGIWDLFTGKLIRRLSGHSDGVKTLYF--DDRKLITGSLDKTIRVWN 368
           N   + +GS++  + I D  T ++ + L  H   V  + +  +D  LITG  D  I V N
Sbjct: 223 NGNYVASGSWNGEVSIIDSNTLEVTQTLQNHDGKVGGIAWTSNDSVLITGGEDHLITVSN 282

Query: 369 YITGECISTYR--GHSDSV--LSVDSYQKVIVSGSADKTVKVWHVESRTCYTLR-GHTEW 423
              GE I++    GH   +  L V    K I + S D T ++W +E +    L+ GH++ 
Sbjct: 283 RSDGEFITSNSIGGHEGRITDLQVHPSGKFIGTSSFDSTWRLWDIEKQKQLLLQEGHSKE 342

Query: 424 VNCVKLHPKSFSCFSCSDDTTIRMWDIRTNSCLKVFRGHVGQVQKIIPLTIKDVENLATD 483
           + C+          +   D T  +WD+R+   +   +GH   +   +  +I D   LAT 
Sbjct: 343 LYCLAFQADGALVSTAGTDKTAIIWDLRSGKAVSQLQGHAKTIY-CMDWSI-DGHTLAT- 399

Query: 484 NTSDGSSPQDDPTMTDGADESDTPSNEQETVLDENIPYPTHLLSCGLDNTIKLWDVKTGK 543
              DG     D   +D   +  T      T L  +     +L+S G D +I ++      
Sbjct: 400 GGGDGVITIWDLRKSDKLTKI-TEHKSIVTSLKFDKANDHNLISSGYDRSIFVYSKDNYL 458

Query: 544 CIRTQFGHVEGV--WDIAADNFRIISGSHDGSIKVW 577
            + +  GH + V  +DI  +N  +ISG  D S+K W
Sbjct: 459 KVSSLIGHADKVLTFDIDKNNKNLISGGWDRSVKHW 494

 Score = 48.1 bits (113), Expect = 1e-05,   Method: Compositional matrix adjust.
 Identities = 53/233 (22%), Positives = 93/233 (39%), Gaps = 54/233 (23%)

Query: 355 LITGSLDKTIRVWNYITGECISTYRGHSDSV--LSVDSYQKVIVSGSADKTVKVWHV--- 409
           + +GS +  + + +  T E   T + H   V  ++  S   V+++G  D  + V +    
Sbjct: 227 VASGSWNGEVSIIDSNTLEVTQTLQNHDGKVGGIAWTSNDSVLITGGEDHLITVSNRSDG 286

Query: 410 ESRTCYTLRGHTEWVNCVKLHPKSFSCFSCSDDTTIRMWDIRTNSCLKVFRGHVGQVQKI 469
           E  T  ++ GH   +  +++HP      + S D+T R+WDI     L +  GH       
Sbjct: 287 EFITSNSIGGHEGRITDLQVHPSGKFIGTSSFDSTWRLWDIEKQKQLLLQEGHS------ 340

Query: 470 IPLTIKDVENLATDNTSDGSSPQDDPTMTDGADESDTPSNEQETVLDENIPYPTHLLSCG 529
                K++  LA                 DGA  S                      + G
Sbjct: 341 -----KELYCLAF--------------QADGALVS----------------------TAG 359

Query: 530 LDNTIKLWDVKTGKCIRTQFGHVEGVW--DIAADNFRIISGSHDGSIKVWDLQ 580
            D T  +WD+++GK +    GH + ++  D + D   + +G  DG I +WDL+
Sbjct: 360 TDKTAIIWDLRSGKAVSQLQGHAKTIYCMDWSIDGHTLATGGGDGVITIWDLR 412

 Score = 45.8 bits (107), Expect = 8e-05,   Method: Compositional matrix adjust.
 Identities = 41/149 (27%), Positives = 63/149 (42%), Gaps = 47/149 (31%)

Query: 306 LTLQFNYRLLFTGSYDSTIGIWDLFTGKLIRRLSGHS--------------------DGV 345
           L  Q +  L+ T   D T  IWDL +GK + +L GH+                    DGV
Sbjct: 346 LAFQADGALVSTAGTDKTAIIWDLRSGKAVSQLQGHAKTIYCMDWSIDGHTLATGGGDGV 405

Query: 346 KTLY----------------------FD---DRKLITGSLDKTIRVWNYITGECISTYRG 380
            T++                      FD   D  LI+   D++I V++      +S+  G
Sbjct: 406 ITIWDLRKSDKLTKITEHKSIVTSLKFDKANDHNLISSGYDRSIFVYSKDNYLKVSSLIG 465

Query: 381 HSDSVLS--VDSYQKVIVSGSADKTVKVW 407
           H+D VL+  +D   K ++SG  D++VK W
Sbjct: 466 HADKVLTFDIDKNNKNLISGGWDRSVKHW 494

 Score = 39.3 bits (90), Expect = 0.009,   Method: Compositional matrix adjust.
 Identities = 21/73 (28%), Positives = 38/73 (52%), Gaps = 2/73 (2%)

Query: 520 PYPTHLLSCGLDNTIKLWDVKTGKCIRTQFGHVEGVWDIA--ADNFRIISGSHDGSIKVW 577
           P    + +   D+T +LWD++  K +  Q GH + ++ +A  AD   + +   D +  +W
Sbjct: 308 PSGKFIGTSSFDSTWRLWDIEKQKQLLLQEGHSKELYCLAFQADGALVSTAGTDKTAIIW 367

Query: 578 DLQSGKCMHTFNG 590
           DL+SGK +    G
Sbjct: 368 DLRSGKAVSQLQG 380

>Kwal_23.6240
          Length = 913

 Score = 62.0 bits (149), Expect = 1e-09,   Method: Compositional matrix adjust.
 Identities = 66/312 (21%), Positives = 123/312 (39%), Gaps = 42/312 (13%)

Query: 314 LLFTGSYDSTIGIWDLFTGKLIRRLSGHSDGVKTLYF--DDRKLITGSLDKTIRVWNYIT 371
           L F  S    + +++  +   I +  GH D    + +  D  +++T S D  I++W+ ++
Sbjct: 313 LAFGSSKLGQLLVYEWQSESYILKQQGHFDATNAVTYSPDGSRVVTASEDGKIKIWDVVS 372

Query: 372 GECISTYRGHSDSV--LSVDSYQKVIVSGSADKTVKVWH-VESRTCYTLRGHTE-WVNCV 427
           G C+ T++ H+ +V  L+     +V+ S S D TV+ W  V  R   T         NC+
Sbjct: 373 GFCLVTFQEHTAAVSALAFAKRGQVLFSASLDGTVRAWDLVRYRNFRTFTAAERIQFNCL 432

Query: 428 KLHPKS-FSCFSCSDDTTIRMWDIRTNSCLKVFRGHVGQVQKIIPLTIKDVENLATDNTS 486
              P     C    D   + +W ++T   ++   GH G V  +         + + +N+ 
Sbjct: 433 AADPSGEVVCAGSVDSFAVHVWSVQTGQLVETLDGHEGPVSCL---------SFSQENSV 483

Query: 487 DGSSPQDDPTM---TDGADESDTPSNEQETVLDENI-PYPTHLLSCGLDNTIKLWDVKTG 542
             S+  D         G  +   P      VL  ++ P    + +  LD  I  +DV  G
Sbjct: 484 LASASWDKTIRIWSIFGRSQQVEPLEVYADVLSLSVRPDGNEVAAATLDGQILFFDVHEG 543

Query: 543 KCIRTQFG--------HVEGVW--------------DIAADNFRIISGSHDGSIKVWDLQ 580
           K +    G        H+E  +              D + D   I++  ++ SI ++D+ 
Sbjct: 544 KQVNAIDGKKDILSGRHLEDRFTSQNSARSKHFTTIDYSFDGLSIVAAGNNNSICLYDIP 603

Query: 581 SGKCMHTFNGRR 592
           +   +  F   R
Sbjct: 604 NSVLLKRFTVSR 615

 Score = 52.0 bits (123), Expect = 1e-06,   Method: Compositional matrix adjust.
 Identities = 39/135 (28%), Positives = 61/135 (45%), Gaps = 17/135 (12%)

Query: 291 GHCRIQEFKGHMDGVLTLQFNYR--LLFTGSYDSTIGIWDLFTGKLIRRLSGHSDGVKTL 348
           G C +  F+ H   V  L F  R  +LF+ S D T+  WDL   +  R  +      + +
Sbjct: 373 GFCLVT-FQEHTAAVSALAFAKRGQVLFSASLDGTVRAWDLVRYRNFRTFT----AAERI 427

Query: 349 YFD-------DRKLITGSLDK-TIRVWNYITGECISTYRGHSDSV--LSVDSYQKVIVSG 398
            F+          +  GS+D   + VW+  TG+ + T  GH   V  LS      V+ S 
Sbjct: 428 QFNCLAADPSGEVVCAGSVDSFAVHVWSVQTGQLVETLDGHEGPVSCLSFSQENSVLASA 487

Query: 399 SADKTVKVWHVESRT 413
           S DKT+++W +  R+
Sbjct: 488 SWDKTIRIWSIFGRS 502

 Score = 44.7 bits (104), Expect = 2e-04,   Method: Compositional matrix adjust.
 Identities = 67/296 (22%), Positives = 118/296 (39%), Gaps = 44/296 (14%)

Query: 336 RRLSGHSDGVKTLYF--DDRKLITGSLDKTIRVWNYIT---GECISTYRGHSDSVLSV-- 388
           R  +GH   + +L +  D R LI+ S D T R+W+  +   G    T+ GH D V+    
Sbjct: 140 RVHAGHFSNIISLTWSRDSRFLISTSKDLTARIWSLDSQEKGLASVTFAGHRDYVMGAFF 199

Query: 389 DSYQKVIVSGSADKTVKVWHVESRTCYTLRGHTE----------W--------------V 424
            + Q+ I + S D  V  W    R  +      E          W              V
Sbjct: 200 SADQERIYTVSKDGAVFQWEYTPRPGFESPEQDEETEIDPSLYSWRITKKNYFYASQARV 259

Query: 425 NCVKLHPKSFSCFSCSDDTTIRMWDIRTNSCLKVFRGHVGQVQKIIPLTIKDVENLATDN 484
            CV  H  S +     ++   R++++   + ++     +GQ   +  + + D    + + 
Sbjct: 260 KCVTFHANSNTLVVGFNNGEFRLYELPEFTLIQQLS--MGQ-NAVNTVCVND----SGEW 312

Query: 485 TSDGSSPQDDPTMTDGADESDTPSNEQETVLDENIPYP---THLLSCGLDNTIKLWDVKT 541
            + GSS      + +   ES     +        + Y    + +++   D  IK+WDV +
Sbjct: 313 LAFGSSKLGQLLVYEWQSESYILKQQGHFDATNAVTYSPDGSRVVTASEDGKIKIWDVVS 372

Query: 542 GKCIRTQFGHVEGVWDIA-ADNFRII-SGSHDGSIKVWDLQSGKCMHTFN-GRRLQ 594
           G C+ T   H   V  +A A   +++ S S DG+++ WDL   +   TF    R+Q
Sbjct: 373 GFCLVTFQEHTAAVSALAFAKRGQVLFSASLDGTVRAWDLVRYRNFRTFTAAERIQ 428

>YDR364C (CDC40) [1190] chr4 complement(1202831..1204198) Protein
           required for the second catalytic step of mRNA splicing,
           member of WD (WD-40) repeat family [1368 bp, 455 aa]
          Length = 455

 Score = 60.8 bits (146), Expect = 2e-09,   Method: Compositional matrix adjust.
 Identities = 47/179 (26%), Positives = 84/179 (46%), Gaps = 20/179 (11%)

Query: 295 IQEFKGHMDGVLTLQF---NYRLLFTGSYDSTIGIWDLFTG-KLIRRLSGHSDGVKTLYF 350
           I+ + GH +G   L+F      L+ +G  D TI IWD +   + +R   GH+  +K L F
Sbjct: 155 IRNYPGHPEGTTALKFLPKTGHLILSGGNDHTIKIWDFYHDYECLRDFQGHNKPIKALRF 214

Query: 351 --DDRKLITGSLDKTIRVWNYITGECISTYRGHSDS----VLSVDSYQKVIVSGSADKTV 404
             D +  ++ S D+++++W+  TG+  +  R H +S    V S  +     + G ++   
Sbjct: 215 TEDCQSFLSSSFDRSVKIWDTETGKVKT--RLHLNSTPADVESRPTNPHEFIVGLSNS-- 270

Query: 405 KVWHVESRT------CYTLRGHTEWVNCVKLHPKSFSCFSCSDDTTIRMWDIRTNSCLK 457
           K+ H + R         T   H   +  +K  P      S S+D T+R+W+ + N  +K
Sbjct: 271 KILHYDDRVSENQGLVQTYDHHLSSILALKYFPDGSKFISSSEDKTVRIWENQINVPIK 329

 Score = 41.6 bits (96), Expect = 0.002,   Method: Compositional matrix adjust.
 Identities = 28/82 (34%), Positives = 44/82 (53%), Gaps = 4/82 (4%)

Query: 507 PSNEQETVLDENIPYPTHL-LSCGLDNTIKLWDV-KTGKCIRTQFGHVEGVWDI--AADN 562
           P + + T   + +P   HL LS G D+TIK+WD     +C+R   GH + +  +    D 
Sbjct: 159 PGHPEGTTALKFLPKTGHLILSGGNDHTIKIWDFYHDYECLRDFQGHNKPIKALRFTEDC 218

Query: 563 FRIISGSHDGSIKVWDLQSGKC 584
              +S S D S+K+WD ++GK 
Sbjct: 219 QSFLSSSFDRSVKIWDTETGKV 240

>Scas_692.25
          Length = 488

 Score = 60.8 bits (146), Expect = 2e-09,   Method: Compositional matrix adjust.
 Identities = 47/197 (23%), Positives = 84/197 (42%), Gaps = 50/197 (25%)

Query: 309 QFNYRLLFTGSYDSTIGIWDLFTGKLIRRLSGHSDGVKTLYFDDRKLITGSLDKTIRVWN 368
           + N   L + S D++I IW    G ++     H++ V+ L      +++GS D ++R+ +
Sbjct: 246 KLNNIYLASCSRDTSIRIWTAEDGMILNSFHPHNEWVRCLDVSGDFVLSGSQDASLRLTH 305

Query: 369 YITGECISTYRGHSDSV-------------------------LSVDS-YQKV----IVSG 398
           + +G  +S   GH   +                         L +DS Y+K+      S 
Sbjct: 306 WPSGNGLSIGIGHEFPIESVKFILPLSTNEKASPTINYLRKPLEIDSDYEKMSFKYCASA 365

Query: 399 SADKTVKVWHVES------------------RTCYTLRGHTEWVNCVKLHPKSFSCFSCS 440
           S D+ +K+W + +                  +   TL+GH  WV  +++  +    FSCS
Sbjct: 366 SRDRLIKIWEIPTPRFVMHRPPVPNSSNSNFKCIMTLKGHASWVKDLRI--RGNYLFSCS 423

Query: 441 DDTTIRMWDIRTNSCLK 457
           DD TIR W++    C+K
Sbjct: 424 DDKTIRCWNLENGECVK 440

 Score = 52.4 bits (124), Expect = 8e-07,   Method: Compositional matrix adjust.
 Identities = 66/314 (21%), Positives = 127/314 (40%), Gaps = 66/314 (21%)

Query: 314 LLFTGSYDSTIGIWDLFTGKL-IRRLSGHSDGVKTL-----YFDDRK-------LITGSL 360
           ++F G+ +  +  +D+F   L +     H  G+ ++     + ++ K       + T S 
Sbjct: 150 IIFIGTDNGKLYAYDIFNYSLPLDSTQAHIKGITSIDAIMEFKNNNKTEEPSAIIATSSK 209

Query: 361 DKTIRVWNYITGE----CISTYRGHSDSVLSVDSYQKV----IVSGSADKTVKVWHVE-S 411
           D +I+++ +   E           H   V  V  ++K+    + S S D ++++W  E  
Sbjct: 210 DLSIKLFRWSAKENKFLLFRVLMNHEHIVSEVKLFRKLNNIYLASCSRDTSIRIWTAEDG 269

Query: 412 RTCYTLRGHTEWVNCVKLHPKSFSCFSCSDDTTIRMWDIRTNSCLKVFRGH---VGQVQK 468
               +   H EWV C+ +        S S D ++R+    + + L +  GH   +  V+ 
Sbjct: 270 MILNSFHPHNEWVRCLDVSGDF--VLSGSQDASLRLTHWPSGNGLSIGIGHEFPIESVKF 327

Query: 469 IIPLTIKDVENLATDNTSDGSSPQDDPTMTDGADESDTPSNEQETVLDENIPYPTHLLSC 528
           I+PL+           T++ +SP  +        +SD           E + +  +  S 
Sbjct: 328 ILPLS-----------TNEKASPTINYLRKPLEIDSDY----------EKMSF-KYCASA 365

Query: 529 GLDNTIKLWDVKTG-----------------KCIRTQFGHVEGVWDIAADNFRIISGSHD 571
             D  IK+W++ T                  KCI T  GH   V D+      + S S D
Sbjct: 366 SRDRLIKIWEIPTPRFVMHRPPVPNSSNSNFKCIMTLKGHASWVKDLRIRGNYLFSCSDD 425

Query: 572 GSIKVWDLQSGKCM 585
            +I+ W+L++G+C+
Sbjct: 426 KTIRCWNLENGECV 439

 Score = 40.4 bits (93), Expect = 0.004,   Method: Compositional matrix adjust.
 Identities = 29/99 (29%), Positives = 42/99 (42%), Gaps = 18/99 (18%)

Query: 309 QFNYRLLFTGSYDSTIGIWDLFTGKL-----------------IRRLSGHSDGVKTLYFD 351
           + +++   + S D  I IW++ T +                  I  L GH+  VK L   
Sbjct: 356 KMSFKYCASASRDRLIKIWEIPTPRFVMHRPPVPNSSNSNFKCIMTLKGHASWVKDLRIR 415

Query: 352 DRKLITGSLDKTIRVWNYITGECISTYRG-HSDSVLSVD 389
              L + S DKTIR WN   GEC+  +   HS  V  +D
Sbjct: 416 GNYLFSCSDDKTIRCWNLENGECVKQWTDLHSGFVTCLD 454

 Score = 30.0 bits (66), Expect = 6.3,   Method: Compositional matrix adjust.
 Identities = 20/58 (34%), Positives = 28/58 (48%), Gaps = 1/58 (1%)

Query: 295 IQEFKGHMDGVLTLQFNYRLLFTGSYDSTIGIWDLFTGKLIRRLSG-HSDGVKTLYFD 351
           I   KGH   V  L+     LF+ S D TI  W+L  G+ +++ +  HS  V  L  D
Sbjct: 399 IMTLKGHASWVKDLRIRGNYLFSCSDDKTIRCWNLENGECVKQWTDLHSGFVTCLDMD 456

>CAGL0M06193g 643917..644867 similar to sp|P38123 Saccharomyces
           cerevisiae YBR175w, start by similarity
          Length = 316

 Score = 59.7 bits (143), Expect = 2e-09,   Method: Compositional matrix adjust.
 Identities = 38/128 (29%), Positives = 64/128 (50%), Gaps = 15/128 (11%)

Query: 295 IQEFKGHMDGVLTLQFNYR--LLFTGSYDSTIGIWDLFTGKLIRRLSGHSDGVKTLYFDD 352
           +    GH   V++L +N +  LLFT S D +I +WD+ TG +++ +S HS+ V ++   D
Sbjct: 89  LHRLVGHTAPVISLCYNNKGNLLFTSSMDESIKVWDVLTGTVMKTMSAHSEPVVSIDLSD 148

Query: 353 RK---LITGSLDKTIRVWNYITGECISTYRGHSD----------SVLSVDSYQKVIVSGS 399
                L +GS D  IR+++  TG C+ T     D          + +   +  K ++  S
Sbjct: 149 NDGSILSSGSHDGLIRIFDTATGHCLKTLTYDKDWQSETGVVPIAKVKFSANTKYLLVKS 208

Query: 400 ADKTVKVW 407
            D  VK+W
Sbjct: 209 YDGVVKIW 216

 Score = 49.7 bits (117), Expect = 3e-06,   Method: Compositional matrix adjust.
 Identities = 26/67 (38%), Positives = 42/67 (62%), Gaps = 3/67 (4%)

Query: 525 LLSCGLDNTIKLWDVKTGKCIRTQFGHVEGV--WDIAADNFRIIS-GSHDGSIKVWDLQS 581
           L +  +D +IK+WDV TG  ++T   H E V   D++ ++  I+S GSHDG I+++D  +
Sbjct: 111 LFTSSMDESIKVWDVLTGTVMKTMSAHSEPVVSIDLSDNDGSILSSGSHDGLIRIFDTAT 170

Query: 582 GKCMHTF 588
           G C+ T 
Sbjct: 171 GHCLKTL 177

 Score = 47.8 bits (112), Expect = 1e-05,   Method: Compositional matrix adjust.
 Identities = 54/218 (24%), Positives = 85/218 (38%), Gaps = 58/218 (26%)

Query: 393 KVIVSGSADKTVKVWHVESRTCYTLRGHTEWVNCVKLHPKSFSCFSCSDDTTIRMWDIRT 452
           K I S S D TV V H +    + L GHT  V  +  + K    F+ S D +I++WD+ T
Sbjct: 68  KCIASCSDDFTVVVTHRQLGLLHRLVGHTAPVISLCYNNKGNLLFTSSMDESIKVWDVLT 127

Query: 453 NSCLKVFRGHVGQVQKIIPLTIKDVENLATDNTSDGSSPQDDPTMTDGADESDTPSNEQE 512
            + +K    H    + ++ + + D         +DGS                       
Sbjct: 128 GTVMKTMSAHS---EPVVSIDLSD---------NDGS----------------------- 152

Query: 513 TVLDENIPYPTHLLSCGL-DNTIKLWDVKTGKCIRT-----QFGHVEGVWDIAADNFR-- 564
                       +LS G  D  I+++D  TG C++T      +    GV  IA   F   
Sbjct: 153 ------------ILSSGSHDGLIRIFDTATGHCLKTLTYDKDWQSETGVVPIAKVKFSAN 200

Query: 565 ---IISGSHDGSIKVWDLQSGKCMHTFNGRRLQRETQH 599
              ++  S+DG +K+WD  SG  + TF     +    H
Sbjct: 201 TKYLLVKSYDGVVKIWDSVSGDVVRTFKPSNKKYNLTH 238

>Kwal_55.22067
          Length = 451

 Score = 60.1 bits (144), Expect = 3e-09,   Method: Compositional matrix adjust.
 Identities = 49/172 (28%), Positives = 79/172 (45%), Gaps = 9/172 (5%)

Query: 298 FKGHMDGVLTLQFNYR--LLFTGSYDSTIGIWDLFTGKLIRRLSGHSDGVKTLYFD--DR 353
            + H   V  +++++    L +G  D TI IW      +      H+  ++ + F   D 
Sbjct: 121 MQAHDSAVAVMKYSHAGDWLISGDSDGTIKIWQPNFNMVKVLDEAHTQCIRGISFSGTDS 180

Query: 354 KLITGSLDKTIRVWNYITGECISTYRGHSDSVLSVDSY--QKVIVSGSADKTVKVWHVES 411
           K +T S D  +++WN+  G+  ST  GH   V S D +    +I SGS D  VK+W   +
Sbjct: 181 KFVTCSDDNILKIWNFSNGQQESTLSGHHWDVRSCDWHPTMGLIASGSKDNLVKLWDPRA 240

Query: 412 RTCY-TLRGHTEWVNCVKLHPKSFSCFSC-SDDTTIRMWDIRTN-SCLKVFR 460
             C  T+ G    +   K  P   +  +  S D + R++DIR N   L V+R
Sbjct: 241 GQCISTILGCKHTIISTKFQPTKGNMLAVISKDKSCRIFDIRQNMKELAVYR 292

 Score = 43.1 bits (100), Expect = 5e-04,   Method: Compositional matrix adjust.
 Identities = 23/71 (32%), Positives = 39/71 (54%), Gaps = 8/71 (11%)

Query: 525 LLSCGLDNTIKLWDVKTGKCIRTQFGHVEGVWDIAADNFR-----IISGSHDGSIKVWDL 579
            ++C  DN +K+W+   G+   T  GH    WD+ + ++      I SGS D  +K+WD 
Sbjct: 182 FVTCSDDNILKIWNFSNGQQESTLSGHH---WDVRSCDWHPTMGLIASGSKDNLVKLWDP 238

Query: 580 QSGKCMHTFNG 590
           ++G+C+ T  G
Sbjct: 239 RAGQCISTILG 249

>ADL184W [1557] [Homologous to ScYNL317W (PFS2) - SH]
           complement(375532..376881) [1350 bp, 449 aa]
          Length = 449

 Score = 60.1 bits (144), Expect = 3e-09,   Method: Compositional matrix adjust.
 Identities = 47/164 (28%), Positives = 81/164 (49%), Gaps = 12/164 (7%)

Query: 298 FKGHMDGVLTLQFNYR--LLFTGSYDSTIGIW--DLFTGKLIRRLSGHSDGVKTLYFD-- 351
            + H   V  +Q+++    L +G  D TI IW  +    K++ R   H++ ++ + F   
Sbjct: 117 MQAHDSAVTVMQYSHAGDWLISGDADGTIKIWQPNFNMVKVLDR--AHTECMRDISFSYS 174

Query: 352 DRKLITGSLDKTIRVWNYITGECISTYRGHSDSVLSVDSYQK--VIVSGSADKTVKVWHV 409
           D+K +T S D  +++WN+  G+      GH   V S D + K  +IVSGS D  +K+W  
Sbjct: 175 DQKFVTCSDDNVLKIWNFSNGQQERVLSGHHWDVKSCDWHPKMGLIVSGSKDNLIKLWDP 234

Query: 410 ES-RTCYTLRGHTEWVNCVKLHPKSFSCFS-CSDDTTIRMWDIR 451
            + R   T+ G    V   K  P   +  +  S D +I+++D+R
Sbjct: 235 RTGRNVSTILGLKHTVIKTKFQPTQGNLLAVVSKDKSIKIYDMR 278

 Score = 50.1 bits (118), Expect = 3e-06,   Method: Compositional matrix adjust.
 Identities = 30/116 (25%), Positives = 51/116 (43%), Gaps = 5/116 (4%)

Query: 351 DDRKLITGSLDKTIRVWNYITGECISTYRGHSDSVLSVDSYQKV---IVSGSADKTVKVW 407
           + R+L+  +      +WN  +    S  + H DS ++V  Y      ++SG AD T+K+W
Sbjct: 90  EGRRLVVATYSGEFSLWNGSSFNFESIMQAH-DSAVTVMQYSHAGDWLISGDADGTIKIW 148

Query: 408 HVESRTCYTL-RGHTEWVNCVKLHPKSFSCFSCSDDTTIRMWDIRTNSCLKVFRGH 462
                    L R HTE +  +          +CSDD  +++W+       +V  GH
Sbjct: 149 QPNFNMVKVLDRAHTECMRDISFSYSDQKFVTCSDDNVLKIWNFSNGQQERVLSGH 204

 Score = 43.5 bits (101), Expect = 4e-04,   Method: Compositional matrix adjust.
 Identities = 27/90 (30%), Positives = 47/90 (52%), Gaps = 11/90 (12%)

Query: 525 LLSCGLDNTIKLWDVKTGKCIRTQFGHVEGVWDIAADNFR-----IISGSHDGSIKVWDL 579
            ++C  DN +K+W+   G+  R   GH    WD+ + ++      I+SGS D  IK+WD 
Sbjct: 178 FVTCSDDNVLKIWNFSNGQQERVLSGHH---WDVKSCDWHPKMGLIVSGSKDNLIKLWDP 234

Query: 580 QSGKCMHTFNGRR---LQRETQHTQTQSLG 606
           ++G+ + T  G +   ++ + Q TQ   L 
Sbjct: 235 RTGRNVSTILGLKHTVIKTKFQPTQGNLLA 264

>AGR207C [4518] [Homologous to ScYBR175W (SWD3) - SH]
           (1146710..1147672) [963 bp, 320 aa]
          Length = 320

 Score = 58.9 bits (141), Expect = 3e-09,   Method: Compositional matrix adjust.
 Identities = 46/163 (28%), Positives = 81/163 (49%), Gaps = 15/163 (9%)

Query: 317 TGSYDSTIGIWDLFTGKLIRRLSGHSDGVKTLYFDDRK--LITGSLDKTIRVWNYITGEC 374
           +GS D T+ I  L  G+L  +L GHS  V ++ F+ +   L T S+D++I+ W+ ++G  
Sbjct: 72  SGSEDFTVEITHLEYGRL-HKLRGHSAPVLSVVFNCKGNLLCTASVDESIKQWDVLSGTL 130

Query: 375 ISTYRGHSDSVLSVDSY---QKVIVSGSADKTVKVWHVESRTCY-TLRGHTEW------- 423
           + T   HSD V+S+D+      ++ SGS D  ++++  ES  C  TL    +W       
Sbjct: 131 LKTMSAHSDPVVSIDTPDCDATILSSGSYDGLIRIFDTESGHCLKTLTYDKDWQTDDGVV 190

Query: 424 -VNCVKLHPKSFSCFSCSDDTTIRMWDIRTNSCLKVFRGHVGQ 465
            ++ VK           S D  +++WD      ++ F+   G+
Sbjct: 191 PISQVKFSRNGKFLLVRSLDGVVKLWDFIRGCVVRTFKDASGE 233

 Score = 57.0 bits (136), Expect = 1e-08,   Method: Compositional matrix adjust.
 Identities = 44/143 (30%), Positives = 72/143 (50%), Gaps = 16/143 (11%)

Query: 280 ERFKVESNWRKGHCRIQEFKGHMDGVLTLQFNYR--LLFTGSYDSTIGIWDLFTGKLIRR 337
           E F VE    + + R+ + +GH   VL++ FN +  LL T S D +I  WD+ +G L++ 
Sbjct: 75  EDFTVEITHLE-YGRLHKLRGHSAPVLSVVFNCKGNLLCTASVDESIKQWDVLSGTLLKT 133

Query: 338 LSGHSDGVKTL---YFDDRKLITGSLDKTIRVWNYITGECISTYR-----GHSDSVLSVD 389
           +S HSD V ++     D   L +GS D  IR+++  +G C+ T          D V+ + 
Sbjct: 134 MSAHSDPVVSIDTPDCDATILSSGSYDGLIRIFDTESGHCLKTLTYDKDWQTDDGVVPIS 193

Query: 390 SYQ-----KVIVSGSADKTVKVW 407
             +     K ++  S D  VK+W
Sbjct: 194 QVKFSRNGKFLLVRSLDGVVKLW 216

 Score = 52.8 bits (125), Expect = 3e-07,   Method: Compositional matrix adjust.
 Identities = 55/220 (25%), Positives = 91/220 (41%), Gaps = 30/220 (13%)

Query: 395 IVSGSADKTVKVWHVESRTCYTLRGHTEWVNCVKLHPKSFSCFSCSDDTTIRMWDIRTNS 454
           + SGS D TV++ H+E    + LRGH+  V  V  + K     + S D +I+ WD+ + +
Sbjct: 70  VASGSEDFTVEITHLEYGRLHKLRGHSAPVLSVVFNCKGNLLCTASVDESIKQWDVLSGT 129

Query: 455 CLKVFRGHVGQVQKIIPLTIKDVE-NLATDNTSDGSSPQDDPTMTDGADESDTPSNEQET 513
            LK    H      ++ +   D +  + +  + DG     D   T+      T + +++ 
Sbjct: 130 LLKTMSAH---SDPVVSIDTPDCDATILSSGSYDGLIRIFD---TESGHCLKTLTYDKDW 183

Query: 514 VLDENIPYPTH---------LLSCGLDNTIKLWDVKTGKCIRTQFGHVEG---------- 554
             D+ +   +          LL   LD  +KLWD   G  +RT F    G          
Sbjct: 184 QTDDGVVPISQVKFSRNGKFLLVRSLDGVVKLWDFIRGCVVRT-FKDASGESRMKYSCGM 242

Query: 555 ---VWDIAADNFRIISGSHDGSIKVWDLQSGKCMHTFNGR 591
                D  A +  ++ G  DG+I VW+ QS     T  G+
Sbjct: 243 DFLYPDSEAADVMVVVGGEDGNICVWNAQSKAVAQTLKGQ 282

>CAGL0F06853g 671942..673108 highly similar to sp|P20484
           Saccharomyces cerevisiae YKL021c MAK11 involved in cell
           growth and replication of M1 dsRNA virus, hypothetical
           start
          Length = 388

 Score = 59.3 bits (142), Expect = 4e-09,   Method: Compositional matrix adjust.
 Identities = 39/131 (29%), Positives = 66/131 (50%), Gaps = 14/131 (10%)

Query: 335 IRRLSGHSDGVKTLYFDDRKLITGSLDKTIRVWNYITGECISTYRGHSDSVLSVDSYQKV 394
           I     HS  VK L    R L++GS D+ IR+++    + + T   H  S+ ++  + KV
Sbjct: 34  IFHFQAHSLSVKCLDISKRYLVSGSNDEHIRIYDLQKRKELGTLLAHQGSITNL-KFSKV 92

Query: 395 ------------IVSGSADKTVKVWHVESRTCY-TLRGHTEWVNCVKLHPKSFSCFSCSD 441
                       ++S S D  + VW V+    + TL+GHT  +N + +HP +    S S+
Sbjct: 93  SDQEPKSTSGKWLLSASEDNKIIVWRVKDWENFGTLKGHTARINDMDIHPSNRVVASVSE 152

Query: 442 DTTIRMWDIRT 452
           D +IR+W++ T
Sbjct: 153 DHSIRLWNLMT 163

 Score = 45.1 bits (105), Expect = 1e-04,   Method: Compositional matrix adjust.
 Identities = 35/128 (27%), Positives = 57/128 (44%), Gaps = 13/128 (10%)

Query: 295 IQEFKGHMDGVLTLQFNYRLLFTGSYDSTIGIWDLFTGKLIRRLSGHSDGVKTLYFDD-- 352
           I  F+ H   V  L  + R L +GS D  I I+DL   K +  L  H   +  L F    
Sbjct: 34  IFHFQAHSLSVKCLDISKRYLVSGSNDEHIRIYDLQKRKELGTLLAHQGSITNLKFSKVS 93

Query: 353 ---------RKLITGSLDKTIRVWNYITGECISTYRGHSDSVLSVDSY--QKVIVSGSAD 401
                    + L++ S D  I VW     E   T +GH+  +  +D +   +V+ S S D
Sbjct: 94  DQEPKSTSGKWLLSASEDNKIIVWRVKDWENFGTLKGHTARINDMDIHPSNRVVASVSED 153

Query: 402 KTVKVWHV 409
            ++++W++
Sbjct: 154 HSIRLWNL 161

 Score = 36.2 bits (82), Expect = 0.069,   Method: Compositional matrix adjust.
 Identities = 41/170 (24%), Positives = 62/170 (36%), Gaps = 42/170 (24%)

Query: 414 CYTLRGHTEWVNCVKLHPKSFSCFSCSDDTTIRMWDIRTNSCLKVFRGHVGQVQKIIPLT 473
            +  + H+  V C+ +  +     S S+D  IR++D++    L     H G +       
Sbjct: 34  IFHFQAHSLSVKCLDISKRYL--VSGSNDEHIRIYDLQKRKELGTLLAHQGSIT------ 85

Query: 474 IKDVENLATDNTSDGSSPQDDPTMTDGADESDTPSNEQETVLDENIPYPTHLLSCGLDNT 533
                NL     SD      +P  T G                        LLS   DN 
Sbjct: 86  -----NLKFSKVSD-----QEPKSTSGK----------------------WLLSASEDNK 113

Query: 534 IKLWDVKTGKCIRTQFGHVEGV--WDIAADNFRIISGSHDGSIKVWDLQS 581
           I +W VK  +   T  GH   +   DI   N  + S S D SI++W+L +
Sbjct: 114 IIVWRVKDWENFGTLKGHTARINDMDIHPSNRVVASVSEDHSIRLWNLMT 163

>CAGL0M04081g complement(450572..451939) highly similar to sp|P42841
           Saccharomyces cerevisiae YNL317w PFS2 polyadenylation
           factor I, hypothetical start
          Length = 455

 Score = 59.3 bits (142), Expect = 4e-09,   Method: Compositional matrix adjust.
 Identities = 46/165 (27%), Positives = 81/165 (49%), Gaps = 10/165 (6%)

Query: 298 FKGHMDGVLTLQFNYR--LLFTGSYDSTIGIWDLFTGKLIRRLSG-HSDGVKTLYF--DD 352
            + H   V T+++++    + +G  D TI IW      +++ L   H++G++ + F  +D
Sbjct: 120 MQAHDTSVTTMKYSHAGDWMISGDADGTIKIWQP-NFNMVKELDRIHTEGIRDVAFSNND 178

Query: 353 RKLITGSLDKTIRVWNYITGECISTYRGHSDSVLSVDSYQK--VIVSGSADKTVKVWHVE 410
            K +T S D  +++WN+  G+      GH   V S D + +  +IVSGS D  VK+W   
Sbjct: 179 SKFVTCSDDNILKIWNFSNGQQERVLSGHHWDVRSCDWHPELGLIVSGSKDNLVKLWDPR 238

Query: 411 SRTCY-TLRGHTEWVNCVKLHPKSFSCFSC-SDDTTIRMWDIRTN 453
           S  C  TL      V   +  P   +  +  S D + R++D+R +
Sbjct: 239 SGQCVSTLLKFKHTVLKTRFQPTKGNLLAAISKDKSCRVFDLRAS 283

 Score = 47.8 bits (112), Expect = 2e-05,   Method: Compositional matrix adjust.
 Identities = 30/116 (25%), Positives = 50/116 (43%), Gaps = 5/116 (4%)

Query: 351 DDRKLITGSLDKTIRVWNYITGECISTYRGHSDSVLSVDSYQKV---IVSGSADKTVKVW 407
           + R+LI  +      +WN  +    +  + H  SV ++  Y      ++SG AD T+K+W
Sbjct: 93  EGRRLIVATFSGEFSLWNGSSFTFETIMQAHDTSVTTM-KYSHAGDWMISGDADGTIKIW 151

Query: 408 HVESRTCYTL-RGHTEWVNCVKLHPKSFSCFSCSDDTTIRMWDIRTNSCLKVFRGH 462
                    L R HTE +  V          +CSDD  +++W+       +V  GH
Sbjct: 152 QPNFNMVKELDRIHTEGIRDVAFSNNDSKFVTCSDDNILKIWNFSNGQQERVLSGH 207

 Score = 46.2 bits (108), Expect = 6e-05,   Method: Compositional matrix adjust.
 Identities = 23/71 (32%), Positives = 40/71 (56%), Gaps = 8/71 (11%)

Query: 523 THLLSCGLDNTIKLWDVKTGKCIRTQFGHVEGVWDIAADNFR-----IISGSHDGSIKVW 577
           +  ++C  DN +K+W+   G+  R   GH    WD+ + ++      I+SGS D  +K+W
Sbjct: 179 SKFVTCSDDNILKIWNFSNGQQERVLSGHH---WDVRSCDWHPELGLIVSGSKDNLVKLW 235

Query: 578 DLQSGKCMHTF 588
           D +SG+C+ T 
Sbjct: 236 DPRSGQCVSTL 246

>Scas_685.11
          Length = 384

 Score = 58.9 bits (141), Expect = 5e-09,   Method: Compositional matrix adjust.
 Identities = 40/138 (28%), Positives = 67/138 (48%), Gaps = 16/138 (11%)

Query: 329 LFTGKLIRRLSGHSDGVKTLYFDDRKLITGSLDKTIRVWNYITGECISTYRGHSDSVLSV 388
           LFT   I     H+  VK L    R L++GS D+ IR+++    + + T   H  S+ ++
Sbjct: 30  LFTP--IFHFQAHALSVKCLDVSKRYLVSGSNDEHIRIYDLQKRKELGTLLAHQGSITNL 87

Query: 389 D-------------SYQKVIVSGSADKTVKVWHVESRTCY-TLRGHTEWVNCVKLHPKSF 434
                         S  K ++S S D  + +W V+    + TL+GH   +N V +HP + 
Sbjct: 88  KFSKSKTENGDGEGSNNKWLLSASEDNKIIIWRVKDWENFGTLKGHIARINDVDIHPSNR 147

Query: 435 SCFSCSDDTTIRMWDIRT 452
              S S+D +IR+W++ T
Sbjct: 148 VAISVSEDHSIRLWNLMT 165

 Score = 38.1 bits (87), Expect = 0.018,   Method: Compositional matrix adjust.
 Identities = 29/88 (32%), Positives = 39/88 (44%), Gaps = 2/88 (2%)

Query: 525 LLSCGLDNTIKLWDVKTGKCIRTQFGHVEGV--WDIAADNFRIISGSHDGSIKVWDLQSG 582
           LLS   DN I +W VK  +   T  GH+  +   DI   N   IS S D SI++W+L + 
Sbjct: 107 LLSASEDNKIIIWRVKDWENFGTLKGHIARINDVDIHPSNRVAISVSEDHSIRLWNLMTV 166

Query: 583 KCMHTFNGRRLQRETQHTQTQSLGDKVA 610
           K       R   +  Q  +    GD  A
Sbjct: 167 KKAAVLKLRNYSQNGQFVRWIGNGDYFA 194

 Score = 35.0 bits (79), Expect = 0.17,   Method: Compositional matrix adjust.
 Identities = 22/107 (20%), Positives = 47/107 (43%), Gaps = 12/107 (11%)

Query: 375 ISTYRGHSDSVLSVDSYQKVIVSGSADKTVKVWHVESR-TCYTLRGHTEWVNCVKLHPKS 433
           I  ++ H+ SV  +D  ++ +VSGS D+ ++++ ++ R    TL  H   +  +K     
Sbjct: 34  IFHFQAHALSVKCLDVSKRYLVSGSNDEHIRIYDLQKRKELGTLLAHQGSITNLKFSKSK 93

Query: 434 FS-----------CFSCSDDTTIRMWDIRTNSCLKVFRGHVGQVQKI 469
                          S S+D  I +W ++        +GH+ ++  +
Sbjct: 94  TENGDGEGSNNKWLLSASEDNKIIIWRVKDWENFGTLKGHIARINDV 140

>AER255C [2757] [Homologous to ScYDR364C (CDC40) - SH]
           (1107932..1109335) [1404 bp, 467 aa]
          Length = 467

 Score = 58.9 bits (141), Expect = 6e-09,   Method: Compositional matrix adjust.
 Identities = 42/174 (24%), Positives = 81/174 (46%), Gaps = 16/174 (9%)

Query: 298 FKGHMDGVLTLQFNYR---LLFTGSYDSTIGIWDLFTGK-LIRRLSGHSDGVKTLYF--D 351
           + GH  G   L+F  +   L  +G  D  + IWD++  + L+R   GH   +    F  D
Sbjct: 170 YDGHDRGTTALEFLRKTGHLFLSGGNDGVLKIWDMYHERLLLRDYCGHRKAISATSFSHD 229

Query: 352 DRKLITGSLDKTIRVWNYITGECIS--TYRGHSDSVLSVDSYQKVIVSGSADKTVKVWHV 409
           + +  + S DKT+++W+  TG+ I+  +++   + +      ++ ++ G +D   K+ H 
Sbjct: 230 NVQFASSSYDKTVKIWDTETGDIINRLSFKATPNCMTFHPQNKEQLLVGFSDS--KIRHF 287

Query: 410 ESR------TCYTLRGHTEWVNCVKLHPKSFSCFSCSDDTTIRMWDIRTNSCLK 457
           + R             H   +N ++  P      S SDD +IR+W+ + N  +K
Sbjct: 288 DLRVDKKDGVIQIYDHHLAAINALRYFPDGSKFISSSDDKSIRIWENQINIPIK 341

 Score = 52.8 bits (125), Expect = 5e-07,   Method: Compositional matrix adjust.
 Identities = 69/316 (21%), Positives = 124/316 (39%), Gaps = 48/316 (15%)

Query: 333 KLIRRLSGHSDGVKTLYFDDRK---LITGSLDKTIRVWN-YITGECISTYRGHSDSV--- 385
           +++    GH  G   L F  +     ++G  D  +++W+ Y     +  Y GH  ++   
Sbjct: 165 RILHVYDGHDRGTTALEFLRKTGHLFLSGGNDGVLKIWDMYHERLLLRDYCGHRKAISAT 224

Query: 386 -LSVDSYQKVIVSGSADKTVKVWHVESRTCYTLRGHTEWVNCVKLHPKSFSCFSCS-DDT 443
             S D+ Q    S S DKTVK+W  E+             NC+  HP++         D+
Sbjct: 225 SFSHDNVQ--FASSSYDKTVKIWDTETGDIINRLSFKATPNCMTFHPQNKEQLLVGFSDS 282

Query: 444 TIRMWDIRTN---SCLKVFRGHVGQVQKIIPLTIKDVENLATDNTSDGS---SPQDDPTM 497
            IR +D+R +     ++++  H+  +              A     DGS   S  DD ++
Sbjct: 283 KIRHFDLRVDKKDGVIQIYDHHLAAIN-------------ALRYFPDGSKFISSSDDKSI 329

Query: 498 TDGADESDTPSNEQETVLDENIPY----PTH--LLSCGLDNTIKLWDVKTG--KCIRTQF 549
               ++ + P  +         P+    P H    +  +DN+I ++ +K    +  R  F
Sbjct: 330 RIWENQINIPIKQISDTDQYPAPWIQLHPEHNQFAAQSMDNSIYVYSMKPKYKRHPRKAF 389

Query: 550 -GH----VEGVWDIAADNFRIISGSHDGSIKVWDLQSGKCMHTFNGRRLQRETQHTQTQS 604
            GH       ++DIA D   + +G   G + +WD ++ K +     R+L+     T  Q 
Sbjct: 390 RGHKSAGYNSMFDIAPDGRYVAAGDTSGRLFIWDWKTTKIL-----RQLETTKGETLKQV 444

Query: 605 LGDKVAPIACVCIGDS 620
                     +C G S
Sbjct: 445 AWSPQETSKIICSGKS 460

 Score = 42.7 bits (99), Expect = 8e-04,   Method: Compositional matrix adjust.
 Identities = 45/191 (23%), Positives = 85/191 (44%), Gaps = 16/191 (8%)

Query: 288 WRKGHCRI--QEFKGHMDGVLTLQFNYR--LLFTGSYDSTIGIWDLFTGKLIRRLS-GHS 342
           W   H R+  +++ GH   +    F++      + SYD T+ IWD  TG +I RLS   +
Sbjct: 202 WDMYHERLLLRDYCGHRKAISATSFSHDNVQFASSSYDKTVKIWDTETGDIINRLSFKAT 261

Query: 343 DGVKTLYFDDR-KLITGSLDKTIRVWNYITGE---CISTYRGHSDSVLSVDSYQ--KVIV 396
               T +  ++ +L+ G  D  IR ++    +    I  Y  H  ++ ++  +      +
Sbjct: 262 PNCMTFHPQNKEQLLVGFSDSKIRHFDLRVDKKDGVIQIYDHHLAAINALRYFPDGSKFI 321

Query: 397 SGSADKTVKVWHVESRTCYTLRGHTEWVNC--VKLHPKSFSCFSCSDDTTIRMWDIRTN- 453
           S S DK++++W  +          T+      ++LHP+     + S D +I ++ ++   
Sbjct: 322 SSSDDKSIRIWENQINIPIKQISDTDQYPAPWIQLHPEHNQFAAQSMDNSIYVYSMKPKY 381

Query: 454 --SCLKVFRGH 462
                K FRGH
Sbjct: 382 KRHPRKAFRGH 392

>Sklu_1963.2 YBR175W, Contig c1963 4075-5019 reverse complement
          Length = 314

 Score = 58.2 bits (139), Expect = 6e-09,   Method: Compositional matrix adjust.
 Identities = 42/143 (29%), Positives = 70/143 (48%), Gaps = 16/143 (11%)

Query: 280 ERFKVESNWRKGHCRIQEFKGHMDGVLTLQFNYR--LLFTGSYDSTIGIWDLFTGKLIRR 337
           + F +E N    + R+    GH   VL+L +  +  LL + S D +I IWD+ TG L++ 
Sbjct: 76  DDFTIEIN-HITYGRLHRLVGHTAPVLSLVYTSKGNLLCSASMDESIKIWDVLTGTLLKT 134

Query: 338 LSGHSDGVKTL---YFDDRKLITGSLDKTIRVWNYITGECISTYRGHSD-----SVLSVD 389
           +S HS+ V ++     D   L +GS D  IR+++  TG C+ T     D      V+ + 
Sbjct: 135 ISAHSEPVVSIDMPVCDPSILSSGSYDGLIRIFDTTTGHCLKTLTYDKDWKSENGVVPIS 194

Query: 390 SYQ-----KVIVSGSADKTVKVW 407
             +     K ++  S D  +K+W
Sbjct: 195 QVKFSVNGKYLLVKSLDGVLKIW 217

 Score = 55.8 bits (133), Expect = 3e-08,   Method: Compositional matrix adjust.
 Identities = 45/160 (28%), Positives = 80/160 (50%), Gaps = 15/160 (9%)

Query: 315 LFTGSYDSTIGIWDLFTGKLIRRLSGHSDGVKTLYFDDRK--LITGSLDKTIRVWNYITG 372
           + T S D TI I  +  G+L  RL GH+  V +L +  +   L + S+D++I++W+ +TG
Sbjct: 71  IATASDDFTIEINHITYGRL-HRLVGHTAPVLSLVYTSKGNLLCSASMDESIKIWDVLTG 129

Query: 373 ECISTYRGHSDSVLSVDSY---QKVIVSGSADKTVKVWHVESRTCY-TLRGHTEWVNCVK 428
             + T   HS+ V+S+D       ++ SGS D  ++++   +  C  TL    +W +   
Sbjct: 130 TLLKTISAHSEPVVSIDMPVCDPSILSSGSYDGLIRIFDTTTGHCLKTLTYDKDWKSENG 189

Query: 429 LHPKSFSCFSC--------SDDTTIRMWDIRTNSCLKVFR 460
           + P S   FS         S D  +++WD    S ++ F+
Sbjct: 190 VVPISQVKFSVNGKYLLVKSLDGVLKIWDFIRGSVVRTFK 229

 Score = 48.1 bits (113), Expect = 1e-05,   Method: Compositional matrix adjust.
 Identities = 26/67 (38%), Positives = 38/67 (56%), Gaps = 3/67 (4%)

Query: 525 LLSCGLDNTIKLWDVKTGKCIRTQFGHVEGVWDI---AADNFRIISGSHDGSIKVWDLQS 581
           L S  +D +IK+WDV TG  ++T   H E V  I     D   + SGS+DG I+++D  +
Sbjct: 112 LCSASMDESIKIWDVLTGTLLKTISAHSEPVVSIDMPVCDPSILSSGSYDGLIRIFDTTT 171

Query: 582 GKCMHTF 588
           G C+ T 
Sbjct: 172 GHCLKTL 178

 Score = 45.1 bits (105), Expect = 9e-05,   Method: Compositional matrix adjust.
 Identities = 51/217 (23%), Positives = 80/217 (36%), Gaps = 58/217 (26%)

Query: 382 SDSVLSVDSYQKVIVSGSADKTVKVWHVESRTCYTLRGHTEWVNCVKLHPKSFSCFSCSD 441
           SD   S DS  + I + S D T+++ H+     + L GHT  V  +    K     S S 
Sbjct: 60  SDICWSPDS--QCIATASDDFTIEINHITYGRLHRLVGHTAPVLSLVYTSKGNLLCSASM 117

Query: 442 DTTIRMWDIRTNSCLKVFRGHVGQVQKIIPLTIKDVENLATDNTSDGSSPQDDPTMTDGA 501
           D +I++WD+ T + LK    H                                       
Sbjct: 118 DESIKIWDVLTGTLLKTISAH--------------------------------------- 138

Query: 502 DESDTPSNEQETVLDENIPYPTHLLSCGLDNTIKLWDVKTGKCIRT-----QFGHVEGVW 556
                  +E    +D  +  P+ L S   D  I+++D  TG C++T      +    GV 
Sbjct: 139 -------SEPVVSIDMPVCDPSILSSGSYDGLIRIFDTTTGHCLKTLTYDKDWKSENGVV 191

Query: 557 DIAADNFRI-----ISGSHDGSIKVWDLQSGKCMHTF 588
            I+   F +     +  S DG +K+WD   G  + TF
Sbjct: 192 PISQVKFSVNGKYLLVKSLDGVLKIWDFIRGSVVRTF 228

>Scas_700.27*
          Length = 433

 Score = 58.5 bits (140), Expect = 7e-09,   Method: Compositional matrix adjust.
 Identities = 75/293 (25%), Positives = 121/293 (41%), Gaps = 38/293 (12%)

Query: 322 STIGIWDLFTGKLIRRLSGH-SDGVKTLYFDDRKLITGSLDKTIRVWN-------YITGE 373
           +TI I DL  GKL+  L+ H  D  +TL F +  + T      IR+++       ++   
Sbjct: 143 TTIKICDLAKGKLLVTLACHIHDRNETLPFPN-DIPTYFQPLNIRLYHAGTWKKIWLLEI 201

Query: 374 CISTYRGHSDSVLSVDSYQKVIVSGSADKTVKVWHVESRTC-YTLRGHTEWVNCVKLHPK 432
            ++TY  +   +  +     +I +   D  V++W + +R    TL GH   +N V   P 
Sbjct: 202 TMATYHEYIQMIFIL--LLNLIATAGRDSVVRLWDIRARVAVMTLIGHKNPINKVHCLPV 259

Query: 433 SFSCFSCSDDTTIRMWDIRTNSCLKVFRGHVGQVQKI-IPLTIKDVENLATDNTSDGSSP 491
                SCS D TIR+WDI     +KV   H   V+ I    T   + + + ++      P
Sbjct: 260 DPQIVSCSTDATIRLWDIVAGKSMKVITHHKKSVRNIAFHPTEFSMSSCSANDIRSWKLP 319

Query: 492 QDDPTM---TDGADESDTPSNEQETVLDENIPYPTHLLSCGLDN-TIKLWDVKTGKCIRT 547
           +        +DG    +T S  Q+ V           L  G DN  +  +D K+G   ++
Sbjct: 320 EGGLLTNFNSDGLGIINTLSINQDDV-----------LFAGSDNGMLSFYDYKSGHKYQS 368

Query: 548 QF-----GHVEGVWDIAADNF-----RIISGSHDGSIKVWDLQSGKCMHTFNG 590
                  G +E    I    F     R+++G  D SIK+W + S     T  G
Sbjct: 369 MMTKEIPGSLESERGILCSTFDRTGLRLLTGETDKSIKIWSMDSDATPETDPG 421

 Score = 40.4 bits (93), Expect = 0.004,   Method: Compositional matrix adjust.
 Identities = 22/93 (23%), Positives = 46/93 (49%), Gaps = 4/93 (4%)

Query: 298 FKGHMDGVLTLQFNYRLLFTGSYDSTIGIWDLFTGKLIRRLSGHSDGVKTLY--FDDRKL 355
           +  ++  +  L  N  L+ T   DS + +WD+     +  L GH + +  ++    D ++
Sbjct: 206 YHEYIQMIFILLLN--LIATAGRDSVVRLWDIRARVAVMTLIGHKNPINKVHCLPVDPQI 263

Query: 356 ITGSLDKTIRVWNYITGECISTYRGHSDSVLSV 388
           ++ S D TIR+W+ + G+ +     H  SV ++
Sbjct: 264 VSCSTDATIRLWDIVAGKSMKVITHHKKSVRNI 296

 Score = 33.5 bits (75), Expect = 0.56,   Method: Compositional matrix adjust.
 Identities = 33/149 (22%), Positives = 62/149 (41%), Gaps = 15/149 (10%)

Query: 319 SYDSTIGIWDLFTGKLIRRLSGHSDGVKTLYFDDRKLITGSLDKT-IRVWNYITGECIST 377
           S D+TI +WD+  GK ++ ++ H   V+ + F   +    S     IR W    G  ++ 
Sbjct: 267 STDATIRLWDIVAGKSMKVITHHKKSVRNIAFHPTEFSMSSCSANDIRSWKLPEGGLLTN 326

Query: 378 YRGHSDSVLSVDSYQK--VIVSGSADKTVKVWHVESRTCYTLRGHTEWVNCVKLHPKSFS 435
           +      +++  S  +  V+ +GS +  +  +  +S       GH       K  P S  
Sbjct: 327 FNSDGLGIINTLSINQDDVLFAGSDNGMLSFYDYKS-------GHKYQSMMTKEIPGSLE 379

Query: 436 C---FSCS--DDTTIRMWDIRTNSCLKVF 459
                 CS  D T +R+    T+  +K++
Sbjct: 380 SERGILCSTFDRTGLRLLTGETDKSIKIW 408

>KLLA0C08976g 784536..787271 highly similar to sgd|S0000653
           Saccharomyces cerevisiae YCR057c PWP2 periodic
           tryptophan protein, start by similarity
          Length = 911

 Score = 58.9 bits (141), Expect = 8e-09,   Method: Compositional matrix adjust.
 Identities = 75/340 (22%), Positives = 136/340 (40%), Gaps = 44/340 (12%)

Query: 245 LLHMKRARIQQNSTGSSSNADIQTQTTRPWKVIYRERFKVESNWRKGHCRIQEFKGHMDG 304
             H  RA+++ ++  ++SN      +   +++     F            IQ+     + 
Sbjct: 251 FFHANRAKVKCSAFHAASNILTVGFSNGEFRLYELPEF----------IMIQQLSMGQNA 300

Query: 305 VLTLQFNYR---LLFTGSYDSTIGIWDLFTGKLIRRLSGHSDGVKTLYF--DDRKLITGS 359
           V T+  N     L F  S    + +++  +   I +  GH D +  L +  D  K++T S
Sbjct: 301 VNTVAINSSGEWLAFGSSKLGQLIVYEWQSESYILKQQGHFDTLNGLCYSPDGSKIVTAS 360

Query: 360 LDKTIRVWNYITGECISTYRGHSDSVLSVDSYQK--VIVSGSADKTVKVWHVESRTCYTL 417
            +  I++W+  +G C++T+  H+  V +V+  +K  V+ S S D TVK W +     +  
Sbjct: 361 HEGKIKIWDVASGFCLATFDEHAGGVSAVEFAKKGQVLFSASLDGTVKAWDLIRYRNFRT 420

Query: 418 RGHTEWV--NCVKLHPKS-FSCFSCSDDTTIRMWDIRTNSCLKVFRGHVGQVQKIIPLTI 474
              TE +  N + + P     C    D   I +W ++T   +    GH G +  +     
Sbjct: 421 FTATERIQFNSLAVDPSGEVVCAGSEDSFDIFVWSVQTGQLVDTLSGHEGPISCL----- 475

Query: 475 KDVENLATDNTSDGSSPQDDPTMT---DGADESDTPSNEQETVLDENI-PYPTHLLSCGL 530
               + + +N    S+  D         G  +   P      VL  ++ P    + +  L
Sbjct: 476 ----SFSNENGVLASASWDKTIRVWSLFGRSQQVEPFEVFSDVLSISMKPDGQQIAASTL 531

Query: 531 DNTIKLWDVKTGKCIRTQFGHVEGVWDIAADNFRIISGSH 570
              I  +DV  GK    Q G+++G  D       IISG H
Sbjct: 532 AGQILFFDVAEGK----QVGNIDGKRD-------IISGRH 560

 Score = 46.2 bits (108), Expect = 7e-05,   Method: Compositional matrix adjust.
 Identities = 33/107 (30%), Positives = 48/107 (44%), Gaps = 11/107 (10%)

Query: 520 PYPTHLLSCGLDNTIKLWDVKTGKCIRTQFGHVEGV--WDIAADNFRIISGSHDGSIKVW 577
           P  + +++   +  IK+WDV +G C+ T   H  GV   + A     + S S DG++K W
Sbjct: 351 PDGSKIVTASHEGKIKIWDVASGFCLATFDEHAGGVSAVEFAKKGQVLFSASLDGTVKAW 410

Query: 578 DLQSGKCMHTFNGRRLQRETQHTQTQSLGDKVAPIA-CVCIGDSECF 623
           DL   +   TF        T+  Q  SL   V P    VC G  + F
Sbjct: 411 DLIRYRNFRTFTA------TERIQFNSLA--VDPSGEVVCAGSEDSF 449

 Score = 39.7 bits (91), Expect = 0.008,   Method: Compositional matrix adjust.
 Identities = 18/56 (32%), Positives = 35/56 (62%), Gaps = 2/56 (3%)

Query: 536 LWDVKTGKCIRTQFGHVEGVWDI--AADNFRIISGSHDGSIKVWDLQSGKCMHTFN 589
           +++ ++   I  Q GH + +  +  + D  +I++ SH+G IK+WD+ SG C+ TF+
Sbjct: 325 VYEWQSESYILKQQGHFDTLNGLCYSPDGSKIVTASHEGKIKIWDVASGFCLATFD 380

 Score = 38.1 bits (87), Expect = 0.026,   Method: Compositional matrix adjust.
 Identities = 45/194 (23%), Positives = 68/194 (35%), Gaps = 58/194 (29%)

Query: 404 VKVWHVESRTCYTLR--GHTEWVNCVKLHPKSFSCFSCSDDTTIRMWDIRTNSCLKVFRG 461
           V  W  ES   Y L+  GH + +N +   P      + S +  I++WD+ +  CL  F  
Sbjct: 325 VYEWQSES---YILKQQGHFDTLNGLCYSPDGSKIVTASHEGKIKIWDVASGFCLATFDE 381

Query: 462 HVGQVQKIIPLTIKDVENLATDNTSDGSSPQDDPTMTDGADESDTPSNEQETVLDENIPY 521
           H G V  +                                               E    
Sbjct: 382 HAGGVSAV-----------------------------------------------EFAKK 394

Query: 522 PTHLLSCGLDNTIKLWDVKTGKCIRTQFGHVEGVW--DIAAD--NFRIISGSHDG-SIKV 576
              L S  LD T+K WD+   +  RT F   E +    +A D     + +GS D   I V
Sbjct: 395 GQVLFSASLDGTVKAWDLIRYRNFRT-FTATERIQFNSLAVDPSGEVVCAGSEDSFDIFV 453

Query: 577 WDLQSGKCMHTFNG 590
           W +Q+G+ + T +G
Sbjct: 454 WSVQTGQLVDTLSG 467

>KLLA0C07513g complement(656060..657379) similar to sp|P39946
           Saccharomyces cerevisiae YOR269w PAC1 singleton, start
           by similarity
          Length = 439

 Score = 58.5 bits (140), Expect = 9e-09,   Method: Compositional matrix adjust.
 Identities = 54/205 (26%), Positives = 83/205 (40%), Gaps = 44/205 (21%)

Query: 295 IQEFKGHMDGVLTLQFNYR----LLFTGSYDSTIGIWDLFTGKLIRRLSGHSDGVKTLYF 350
           I+   GH   V   QF  R    LL T S D  + IWD+  G  I+    H+  +++L+ 
Sbjct: 194 IKTLAGHEHTVSDCQFFERGADLLLATCSRDLYLKIWDISNGWCIKSFQPHTQWIRSLHV 253

Query: 351 DDRKLITGSLDKTIRVWNYITGECISTYRGHSDSVLSV-----------DSYQKV----I 395
               ++TGS D  IR+ ++ +G  +S   GH   V  V             YQ +    +
Sbjct: 254 HGEFVLTGSNDSAIRLTHWPSGNGLSMGIGHDFPVEKVLILIPDPQHLQPQYQPLGFQHV 313

Query: 396 VSGSADKTVKVWHVE------------------SRTCYTLRGHTEWVNCVKLHPKSFSCF 437
            S S D T+++W V                    +    L  H  WV    L   +   F
Sbjct: 314 ASASRDGTIRLWKVSLPKFIPHRPPRPNPLDTTFKVIAVLTDHNSWVR--DLRQFNDMLF 371

Query: 438 SCSDDTTIRMW-----DIRTNSCLK 457
           SCSDD +++ W     ++ T +C K
Sbjct: 372 SCSDDGSVKCWSLDWTNLSTTTCKK 396

 Score = 40.4 bits (93), Expect = 0.004,   Method: Compositional matrix adjust.
 Identities = 55/225 (24%), Positives = 83/225 (36%), Gaps = 51/225 (22%)

Query: 395 IVSGSADKTVKVWHVESRTCY----TLRGHTEWVNCVKLHPKSFSCF--SCSDDTTIRMW 448
           + + S D   K+W +E  +      TL GH   V+  +   +       +CS D  +++W
Sbjct: 171 LATTSKDLNTKIWELELDSTLSHIKTLAGHEHTVSDCQFFERGADLLLATCSRDLYLKIW 230

Query: 449 DIRTNSCLKVFRGHVGQVQKI-----IPLTIKDVENLATDNTSDGSSPQDDPTMTDGADE 503
           DI    C+K F+ H   ++ +       LT  +   +   +   G    +  +M  G D 
Sbjct: 231 DISNGWCIKSFQPHTQWIRSLHVHGEFVLTGSNDSAIRLTHWPSG----NGLSMGIGHDF 286

Query: 504 SDTPSNEQETVLDENIPYPTHL------------LSCGLDNTIKLWDVK----------- 540
                 E+  +L   IP P HL             S   D TI+LW V            
Sbjct: 287 ----PVEKVLIL---IPDPQHLQPQYQPLGFQHVASASRDGTIRLWKVSLPKFIPHRPPR 339

Query: 541 ------TGKCIRTQFGHVEGVWDIAADNFRIISGSHDGSIKVWDL 579
                 T K I     H   V D+   N  + S S DGS+K W L
Sbjct: 340 PNPLDTTFKVIAVLTDHNSWVRDLRQFNDMLFSCSDDGSVKCWSL 384

 Score = 37.4 bits (85), Expect = 0.030,   Method: Compositional matrix adjust.
 Identities = 24/87 (27%), Positives = 43/87 (49%), Gaps = 8/87 (9%)

Query: 525 LLSCGLDNTIKLWDVKTGKCIRTQFGHVEGVWDIAADNFRIISGSHDGSIKV--WDLQSG 582
           L +C  D  +K+WD+  G CI++   H + +  +      +++GS+D +I++  W   +G
Sbjct: 218 LATCSRDLYLKIWDISNGWCIKSFQPHTQWIRSLHVHGEFVLTGSNDSAIRLTHWPSGNG 277

Query: 583 KCM---HTFNGRR---LQRETQHTQTQ 603
             M   H F   +   L  + QH Q Q
Sbjct: 278 LSMGIGHDFPVEKVLILIPDPQHLQPQ 304

>Kwal_55.21559
          Length = 351

 Score = 57.4 bits (137), Expect = 1e-08,   Method: Compositional matrix adjust.
 Identities = 49/174 (28%), Positives = 80/174 (45%), Gaps = 25/174 (14%)

Query: 301 HMDGVLTLQF--NYRLLFTGSYDSTIGIW----------DLFTGKLIRRLSGHSDGVKTL 348
           H   V ++ F  +  +L  GS+DSTI IW          D    +L+  + GH + VK +
Sbjct: 76  HKKSVRSVSFRPHSSILAAGSFDSTISIWGKEEDADPQDDFPETELLAIIEGHENEVKAV 135

Query: 349 YFDDRK--LITGSLDKTIRVWNY----ITGECISTYRGHSDSVLSV--DSYQKVIVSGSA 400
            +      L + S DK++ +W         EC+S  + H+  V  V   S   ++ S S 
Sbjct: 136 SWSHSGYYLASCSRDKSVWIWEADELGEEYECLSVLQEHAQDVKHVVWHSEMHLLASSSY 195

Query: 401 DKTVKVWHVES---RTCYTLRGH--TEWVNCVKLHPKSFSCFSCSDDTTIRMWD 449
           D T+++W  ++        L GH  T W +  +    S    SCSDD+T+R+W+
Sbjct: 196 DDTIRLWKEDADDWECAAVLNGHKGTVWCSDFEKSESSLRLASCSDDSTVRVWN 249

 Score = 39.3 bits (90), Expect = 0.008,   Method: Compositional matrix adjust.
 Identities = 51/228 (22%), Positives = 91/228 (39%), Gaps = 40/228 (17%)

Query: 381 HSDSVLSVDSYQKVIVSGSADKTVKVWHVESRTCYTLR-----GHTEWVNCVKLHPKSFS 435
           H+D + S+D  + ++ + S+D+ +K+ ++++     +       H + V  V   P S  
Sbjct: 32  HTDKLWSIDCSKGLMATSSSDRKIKLVNLKNMDFQLVEELDDSTHKKSVRSVSFRPHSSI 91

Query: 436 CFSCSDDTTIRMW----------DIRTNSCLKVFRGHVGQVQKIIPLTIKDVENLATDNT 485
             + S D+TI +W          D      L +  GH  +V+ +         + +    
Sbjct: 92  LAAGSFDSTISIWGKEEDADPQDDFPETELLAIIEGHENEVKAV---------SWSHSGY 142

Query: 486 SDGSSPQDDPTMTDGADESDTPSNEQETVLDENIPYPTH---------LLSCGLDNTIKL 536
              S  +D       ADE      E  +VL E+     H         L S   D+TI+L
Sbjct: 143 YLASCSRDKSVWIWEADEL-GEEYECLSVLQEHAQDVKHVVWHSEMHLLASSSYDDTIRL 201

Query: 537 W--DVKTGKCIRTQFGHVEGVW----DIAADNFRIISGSHDGSIKVWD 578
           W  D    +C     GH   VW    + +  + R+ S S D +++VW+
Sbjct: 202 WKEDADDWECAAVLNGHKGTVWCSDFEKSESSLRLASCSDDSTVRVWN 249

 Score = 34.3 bits (77), Expect = 0.27,   Method: Compositional matrix adjust.
 Identities = 24/67 (35%), Positives = 33/67 (49%), Gaps = 6/67 (8%)

Query: 313 RLLFTGSYDSTIGIW--DLFTGKLIRRLSGHSDGVKTLYFDDR----KLITGSLDKTIRV 366
            LL + SYD TI +W  D    +    L+GH   V    F+      +L + S D T+RV
Sbjct: 188 HLLASSSYDDTIRLWKEDADDWECAAVLNGHKGTVWCSDFEKSESSLRLASCSDDSTVRV 247

Query: 367 WNYITGE 373
           WNY+  E
Sbjct: 248 WNYVEEE 254

>AER114W [2619] [Homologous to ScYLR429W (CRN1) - SH]
           complement(850726..850730,850789..852685) [1902 bp, 633
           aa]
          Length = 633

 Score = 57.4 bits (137), Expect = 2e-08,   Method: Compositional matrix adjust.
 Identities = 49/185 (26%), Positives = 80/185 (43%), Gaps = 25/185 (13%)

Query: 290 KGHCRIQEFKGHMDGVLTLQFN---YRLLFTGSYDSTIGIWDLFTGKLIRRLSGHSDGVK 346
           K   +I  F+GH   VL   F+    R+L +GS D  IG+W++                 
Sbjct: 69  KAPDQIPLFRGHTAQVLDTDFDPFDERMLVSGSDDGRIGVWEI---------------PA 113

Query: 347 TLYFDDRKLITGSLDKTIRVWNYITGECISTYRGHSDSVLSVDSYQKVIVSGSADKTVKV 406
           T  F + +   G+++    V  ++TG       GH   VL   + Q V+ S S D TV++
Sbjct: 114 TYSFHNAQDEDGNVEHVAPV-KFLTGHQRKV--GH---VLYHPTAQGVLASSSLDHTVRL 167

Query: 407 WHVESRTCYTLRGHTEWVNCVKLHPKSFSCFSCSDDTTIRMWDIRTNSCLKVFRGHVG-Q 465
           W+VE  T   +  H + V  +          +   D  +R+WDIR    +    GH G +
Sbjct: 168 WNVEQGTNPIVLTHPDMVTSMSFSYGGTYLATVCRDKMLRVWDIRKGEVVSEGMGHSGPK 227

Query: 466 VQKII 470
            Q+++
Sbjct: 228 NQRVV 232

 Score = 39.3 bits (90), Expect = 0.008,   Method: Compositional matrix adjust.
 Identities = 50/246 (20%), Positives = 85/246 (34%), Gaps = 79/246 (32%)

Query: 375 ISTYRGHSDSVLSVDSY---QKVIVSGSADKTVKVWHVESRTCY---------------- 415
           I  +RGH+  VL  D     ++++VSGS D  + VW + +   +                
Sbjct: 74  IPLFRGHTAQVLDTDFDPFDERMLVSGSDDGRIGVWEIPATYSFHNAQDEDGNVEHVAPV 133

Query: 416 -TLRGHTEWVNCVKLHPKSFSCFSCSD-DTTIRMWDIRTNSCLKVFRGHVGQVQKIIPLT 473
             L GH   V  V  HP +    + S  D T+R+W++                Q   P+ 
Sbjct: 134 KFLTGHQRKVGHVLYHPTAQGVLASSSLDHTVRLWNVE---------------QGTNPIV 178

Query: 474 IKDVENLATDNTSDGSSPQDDPTMTDGADESDTPSNEQETVLDENIPYPTHLLSCGLDNT 533
           +   + + + + S G                                  T+L +   D  
Sbjct: 179 LTHPDMVTSMSFSYGG---------------------------------TYLATVCRDKM 205

Query: 534 IKLWDVKTGKCIRTQFGHV-----EGVWDIAADNFRIISGSH--DGSIKVWD---LQSGK 583
           +++WD++ G+ +    GH        VW   +D       S   D  I VWD   L+ G+
Sbjct: 206 LRVWDIRKGEVVSEGMGHSGPKNQRVVWLGNSDRLATTGFSKLSDRQIAVWDAFNLEKGQ 265

Query: 584 CMHTFN 589
               +N
Sbjct: 266 LGGFYN 271

>Kwal_27.12239
          Length = 316

 Score = 56.2 bits (134), Expect = 3e-08,   Method: Compositional matrix adjust.
 Identities = 38/129 (29%), Positives = 64/129 (49%), Gaps = 15/129 (11%)

Query: 294 RIQEFKGHMDGVLTLQFNYR--LLFTGSYDSTIGIWDLFTGKLIRRLSGHSDGVKTL--- 348
            +    GH   V ++++  +  LL + S D +I IWD+ +G L+R LS HS+ V ++   
Sbjct: 91  ELHRLVGHTAPVTSVKYTMKGNLLCSCSMDESIKIWDILSGTLLRTLSAHSEPVVSIDLP 150

Query: 349 YFDDRKLITGSLDKTIRVWNYITGECISTYRGHSD-----SVLSVDSYQ-----KVIVSG 398
            FD   L +GS D  IR+++  TG C+ T     D      V+ +   +     K ++  
Sbjct: 151 PFDPSILSSGSYDGLIRIFDTATGHCLKTLTYDKDWQSENGVVPISQVKFSRNGKYLLVK 210

Query: 399 SADKTVKVW 407
           S D  +K+W
Sbjct: 211 SLDGILKIW 219

 Score = 53.9 bits (128), Expect = 2e-07,   Method: Compositional matrix adjust.
 Identities = 58/221 (26%), Positives = 84/221 (38%), Gaps = 60/221 (27%)

Query: 379 RGHSDSVLSVDSYQKVIVSGSADKTVKVWHVESRTCYTLRGHTEWVNCVKLHPKSFSCFS 438
           R  SD   S DS  + I + S D T+ + H+     + L GHT  V  VK   K     S
Sbjct: 59  RPLSDLCWSPDS--QCIATASDDFTIIITHIVFGELHRLVGHTAPVTSVKYTMKGNLLCS 116

Query: 439 CSDDTTIRMWDIRTNSCLKVFRGHVGQVQKIIPLTIKDVENLATDNTSDGSSPQDDPTMT 498
           CS D +I++WDI + + L+    H   V  I                             
Sbjct: 117 CSMDESIKIWDILSGTLLRTLSAHSEPVVSI----------------------------- 147

Query: 499 DGADESDTPSNEQETVLDENIPYPTHLLSCG-LDNTIKLWDVKTGKCIRT-----QFGHV 552
                 D P            P+   +LS G  D  I+++D  TG C++T      +   
Sbjct: 148 ------DLP------------PFDPSILSSGSYDGLIRIFDTATGHCLKTLTYDKDWQSE 189

Query: 553 EGVWDIAADNFR-----IISGSHDGSIKVWDLQSGKCMHTF 588
            GV  I+   F      ++  S DG +K+WD   GK + TF
Sbjct: 190 NGVVPISQVKFSRNGKYLLVKSLDGILKIWDFVRGKVVRTF 230

>YPR178W (PRP4) [5592] chr16 (892326..893723) U4/U6 snRNA-associated
           splicing factor, member of WD (WD-40) repeat family
           [1398 bp, 465 aa]
          Length = 465

 Score = 57.0 bits (136), Expect = 3e-08,   Method: Compositional matrix adjust.
 Identities = 63/254 (24%), Positives = 105/254 (41%), Gaps = 52/254 (20%)

Query: 333 KLIRRLSGHSDGVKTL-YFDDRKLI-TGSLDKTIRVWNYITGECISTYRGHSDSVLSVDS 390
           +L+  L GH   +  + Y    K I + S D T R+W+  T + +    GH   V S+ S
Sbjct: 256 RLLGDLVGHERRISDVKYHPSGKFIGSASHDMTWRLWDASTHQELLLQEGHDKGVFSL-S 314

Query: 391 YQ---KVIVSGSADKTVKVWHVESRT-CYTLRGHTEWVNCVKLHPKSFSCFSCSDDTTIR 446
           +Q    ++ SG  D    +W + S +   TL GH++ +  V   P  +   +   D  I 
Sbjct: 315 FQCDGSLVCSGGMDSLSMLWDIRSGSKVMTLAGHSKPIYTVAWSPNGYQVATGGGDGIIN 374

Query: 447 MWDIRTNSCLKVFRGHVGQVQKIIPLTIKDVENLATDNTSDGSSPQDDPTMTDGADESDT 506
           +WDIR            GQ+ +I+        N+ T         Q   +  DG  +   
Sbjct: 375 VWDIRKRD--------EGQLNQILAH-----RNIVT---------QVRFSKEDGGKK--- 409

Query: 507 PSNEQETVLDENIPYPTHLLSCGLDNTIKLWDVKTGKCIRTQFGHVEGV--WDIAADNFR 564
                             L+SCG DN I ++   T   + +  GH + +   DI+ ++  
Sbjct: 410 ------------------LVSCGYDNLINVYSSDTWLKMGSLAGHTDKIISLDISNNSHF 451

Query: 565 IISGSHDGSIKVWD 578
           ++SG  D SIK+W+
Sbjct: 452 LVSGGWDRSIKLWN 465

 Score = 51.2 bits (121), Expect = 2e-06,   Method: Compositional matrix adjust.
 Identities = 50/194 (25%), Positives = 79/194 (40%), Gaps = 24/194 (12%)

Query: 294 RIQEFKGHMDGVLTLQFNYRLLFTGSYDSTIGIWDLFTGKLIRRLSGHSDGVKTLYF--D 351
           RI + K H  G        + + + S+D T  +WD  T + +    GH  GV +L F  D
Sbjct: 267 RISDVKYHPSG--------KFIGSASHDMTWRLWDASTHQELLLQEGHDKGVFSLSFQCD 318

Query: 352 DRKLITGSLDKTIRVWNYITGECISTYRGHSDSVLSV----DSYQKVIVSGSADKTVKVW 407
              + +G +D    +W+  +G  + T  GHS  + +V    + YQ  + +G  D  + VW
Sbjct: 319 GSLVCSGGMDSLSMLWDIRSGSKVMTLAGHSKPIYTVAWSPNGYQ--VATGGGDGIINVW 376

Query: 408 HVESRTCYTLR---GHTEWVNCVKLHPKSFS--CFSCSDDTTIRMWDIRTNSCLKVFRGH 462
            +  R    L     H   V  V+   +       SC  D  I ++   T   +    GH
Sbjct: 377 DIRKRDEGQLNQILAHRNIVTQVRFSKEDGGKKLVSCGYDNLINVYSSDTWLKMGSLAGH 436

Query: 463 VGQVQKIIPLTIKD 476
                KII L I +
Sbjct: 437 ---TDKIISLDISN 447

 Score = 46.6 bits (109), Expect = 4e-05,   Method: Compositional matrix adjust.
 Identities = 54/245 (22%), Positives = 98/245 (40%), Gaps = 58/245 (23%)

Query: 347 TLYFDDRKLITGSLDKTIRVWNYITGECIS-TYRGHSDSVLSVDSY---QKVIVSGSADK 402
           +L  DD  + TGS    ++V N  T + ++     H   + ++D +      ++S + D 
Sbjct: 182 SLSTDDMVVATGSWAGDLQVLNSQTLQPLTQKLDSHVGKIGAIDWHPDSNNQMISCAEDG 241

Query: 403 TVKVWHVES-----RTCYTLRGHTEWVNCVKLHPKSFSCFSCSDDTTIRMWDIRTNSCLK 457
            +K +   +     R    L GH   ++ VK HP      S S D T R+WD  T+  L 
Sbjct: 242 LIKNFQYSNEEGGLRLLGDLVGHERRISDVKYHPSGKFIGSASHDMTWRLWDASTHQELL 301

Query: 458 VFRGHVGQVQKIIPLTIKDVENLATDNTSDGSSPQDDPTMTDGADESDTPSNEQETVLDE 517
           +     G  + +  L+ +           DGS                            
Sbjct: 302 L---QEGHDKGVFSLSFQ----------CDGSL--------------------------- 321

Query: 518 NIPYPTHLLSCGLDNTIKLWDVKTGKCIRTQFGHVEGVWDIA--ADNFRIISGSHDGSIK 575
                  + S G+D+   LWD+++G  + T  GH + ++ +A   + +++ +G  DG I 
Sbjct: 322 -------VCSGGMDSLSMLWDIRSGSKVMTLAGHSKPIYTVAWSPNGYQVATGGGDGIIN 374

Query: 576 VWDLQ 580
           VWD++
Sbjct: 375 VWDIR 379

 Score = 45.8 bits (107), Expect = 8e-05,   Method: Compositional matrix adjust.
 Identities = 41/162 (25%), Positives = 77/162 (47%), Gaps = 11/162 (6%)

Query: 299 KGHMDGVLTLQF--NYRLLFTGSYDSTIGIWDLFTGKLIRRLSGHSDGVKTLYF--DDRK 354
           +GH  GV +L F  +  L+ +G  DS   +WD+ +G  +  L+GHS  + T+ +  +  +
Sbjct: 304 EGHDKGVFSLSFQCDGSLVCSGGMDSLSMLWDIRSGSKVMTLAGHSKPIYTVAWSPNGYQ 363

Query: 355 LITGSLDKTIRVWNYITGE--CISTYRGHSDSVLSV----DSYQKVIVSGSADKTVKVWH 408
           + TG  D  I VW+    +   ++    H + V  V    +   K +VS   D  + V+ 
Sbjct: 364 VATGGGDGIINVWDIRKRDEGQLNQILAHRNIVTQVRFSKEDGGKKLVSCGYDNLINVYS 423

Query: 409 VES-RTCYTLRGHTEWVNCVKLHPKSFSCFSCSDDTTIRMWD 449
            ++     +L GHT+ +  + +   S    S   D +I++W+
Sbjct: 424 SDTWLKMGSLAGHTDKIISLDISNNSHFLVSGGWDRSIKLWN 465

 Score = 37.4 bits (85), Expect = 0.030,   Method: Compositional matrix adjust.
 Identities = 23/73 (31%), Positives = 36/73 (49%), Gaps = 2/73 (2%)

Query: 520 PYPTHLLSCGLDNTIKLWDVKTGKCIRTQFGHVEGVWDIA--ADNFRIISGSHDGSIKVW 577
           P    + S   D T +LWD  T + +  Q GH +GV+ ++   D   + SG  D    +W
Sbjct: 275 PSGKFIGSASHDMTWRLWDASTHQELLLQEGHDKGVFSLSFQCDGSLVCSGGMDSLSMLW 334

Query: 578 DLQSGKCMHTFNG 590
           D++SG  + T  G
Sbjct: 335 DIRSGSKVMTLAG 347

>ACR166W [1213] [Homologous to ScYKL021C (MAK11) - SH]
           complement(647933..649102) [1170 bp, 389 aa]
          Length = 388

 Score = 56.2 bits (134), Expect = 3e-08,   Method: Compositional matrix adjust.
 Identities = 43/137 (31%), Positives = 70/137 (51%), Gaps = 16/137 (11%)

Query: 329 LFTGKLIRRLSGHSDGVKTLYFDDRKLITGSLDKTIRVWNYITGECISTYRGHSDSVLSV 388
           LFT   I     H+  VKTL    R L++GS D+ IR+++    + + T   H+ S+ S+
Sbjct: 30  LFTP--IFHFQAHALSVKTLDISRRYLVSGSNDEHIRIYDLQKRKELGTLLNHNGSITSL 87

Query: 389 ---------DSYQ---KVIVSGSADKTVKVWHVESRTCY-TLRGHTEWVNCVKLHPKSFS 435
                    D  Q   K ++S S D T+ +W V+    +  L+GH   +N + +HP S  
Sbjct: 88  RFSRATTDKDGKQQGNKWLLSASEDHTIIIWRVKDWENFGKLKGHNARINDLDIHP-SNR 146

Query: 436 CFSCSDDTTIRMWDIRT 452
             S S+D +IR+W++ T
Sbjct: 147 VASVSEDHSIRLWNLMT 163

 Score = 45.8 bits (107), Expect = 7e-05,   Method: Compositional matrix adjust.
 Identities = 34/128 (26%), Positives = 59/128 (46%), Gaps = 13/128 (10%)

Query: 295 IQEFKGHMDGVLTLQFNYRLLFTGSYDSTIGIWDLFTGKLIRRLSGHSDGVKTLYFD--- 351
           I  F+ H   V TL  + R L +GS D  I I+DL   K +  L  H+  + +L F    
Sbjct: 34  IFHFQAHALSVKTLDISRRYLVSGSNDEHIRIYDLQKRKELGTLLNHNGSITSLRFSRAT 93

Query: 352 ---------DRKLITGSLDKTIRVWNYITGECISTYRGHSDSVLSVDSY-QKVIVSGSAD 401
                    ++ L++ S D TI +W     E     +GH+  +  +D +    + S S D
Sbjct: 94  TDKDGKQQGNKWLLSASEDHTIIIWRVKDWENFGKLKGHNARINDLDIHPSNRVASVSED 153

Query: 402 KTVKVWHV 409
            ++++W++
Sbjct: 154 HSIRLWNL 161

 Score = 32.7 bits (73), Expect = 0.86,   Method: Compositional matrix adjust.
 Identities = 22/106 (20%), Positives = 49/106 (46%), Gaps = 11/106 (10%)

Query: 375 ISTYRGHSDSVLSVDSYQKVIVSGSADKTVKVWHVESR-TCYTLRGHTEWVNCVKLHPKS 433
           I  ++ H+ SV ++D  ++ +VSGS D+ ++++ ++ R    TL  H   +  ++    +
Sbjct: 34  IFHFQAHALSVKTLDISRRYLVSGSNDEHIRIYDLQKRKELGTLLNHNGSITSLRFSRAT 93

Query: 434 FS----------CFSCSDDTTIRMWDIRTNSCLKVFRGHVGQVQKI 469
                         S S+D TI +W ++        +GH  ++  +
Sbjct: 94  TDKDGKQQGNKWLLSASEDHTIIIWRVKDWENFGKLKGHNARINDL 139

 Score = 30.4 bits (67), Expect = 5.1,   Method: Compositional matrix adjust.
 Identities = 22/59 (37%), Positives = 31/59 (52%), Gaps = 3/59 (5%)

Query: 525 LLSCGLDNTIKLWDVKTGKCIRTQFGHVEGV--WDIAADNFRIISGSHDGSIKVWDLQS 581
           LLS   D+TI +W VK  +      GH   +   DI   N R+ S S D SI++W+L +
Sbjct: 106 LLSASEDHTIIIWRVKDWENFGKLKGHNARINDLDIHPSN-RVASVSEDHSIRLWNLMT 163

>CAGL0M08646g 861488..862501 similar to tr|Q05583 Saccharomyces
           cerevisiae YDR267c, start by similarity
          Length = 337

 Score = 55.5 bits (132), Expect = 5e-08,   Method: Compositional matrix adjust.
 Identities = 53/158 (33%), Positives = 75/158 (47%), Gaps = 23/158 (14%)

Query: 314 LLFTGSYDSTIGIW-----DLFTG-----KLIRRLSGHSDGVKTLYF--DDRKLITGSLD 361
           LL  GS+DSTI IW     DL  G     +L+  + GH + VK + +  D   L T S D
Sbjct: 73  LLAAGSFDSTISIWTQSDLDLEEGAKLEMELLAIIEGHENEVKGISWSQDGCLLATCSRD 132

Query: 362 KTIRVWNYITG----ECISTYRGHSDSVLSVDSYQK--VIVSGSADKTVKVW--HVESRT 413
           K++ +W         ECIS  + HS  V  V  + K  ++ S S D TV++W  + +   
Sbjct: 133 KSVWIWETDEAGEEYECISVLQEHSQDVKHVVWHTKHNLLASSSYDDTVRIWKDYDDDWE 192

Query: 414 CYT-LRGH--TEWVNCVKLHPKSFSCFSCSDDTTIRMW 448
           C   L GH  T W +            S SDD+T+R+W
Sbjct: 193 CAAVLTGHEGTIWCSDFSKEEDPIRLCSGSDDSTVRVW 230

 Score = 43.5 bits (101), Expect = 3e-04,   Method: Compositional matrix adjust.
 Identities = 66/271 (24%), Positives = 101/271 (37%), Gaps = 73/271 (26%)

Query: 296 QEFKGHMDGVLTLQFN--YRLLFTGSYDSTIGIWDLFTGK--------------LIRRLS 339
           +  K H D V ++ F     LL TGS D  I +  L  GK               +R ++
Sbjct: 7   KSLKLHNDKVWSIDFEPVRGLLATGSTDRAIKVLQLKNGKENLLDVLDDTVHKKAVRSVA 66

Query: 340 G--HSDGVKTLYFDDRKLITGSLDKTIRVWNY----------ITGECISTYRGHSDSVLS 387
              HSD +            GS D TI +W            +  E ++   GH + V  
Sbjct: 67  WRPHSDLLA----------AGSFDSTISIWTQSDLDLEEGAKLEMELLAIIEGHENEVKG 116

Query: 388 VDSYQK--VIVSGSADKTVKVWHV----ESRTCYT-LRGHTEWVNCVKLHPKSFSCFSCS 440
           +   Q   ++ + S DK+V +W      E   C + L+ H++ V  V  H K     S S
Sbjct: 117 ISWSQDGCLLATCSRDKSVWIWETDEAGEEYECISVLQEHSQDVKHVVWHTKHNLLASSS 176

Query: 441 DDTTIRMWDIRTN--SCLKVFRGHVGQVQKIIPLTIKDVENLATDNTSDGSSPQDDPTMT 498
            D T+R+W    +   C  V  GH G +                   SD S  +D   + 
Sbjct: 177 YDDTVRIWKDYDDDWECAAVLTGHEGTIW-----------------CSDFSKEEDPIRLC 219

Query: 499 DGADES---------DTPSNEQETVLDENIP 520
            G+D+S         D   ++QE V +  +P
Sbjct: 220 SGSDDSTVRVWKYIGDDEDDQQEWVCESTLP 250

 Score = 34.3 bits (77), Expect = 0.31,   Method: Compositional matrix adjust.
 Identities = 61/300 (20%), Positives = 105/300 (35%), Gaps = 85/300 (28%)

Query: 333 KLIRRLSGHSDGVKTLYFDDRK--LITGSLDKTIRVWNYITGEC----ISTYRGHSDSVL 386
           +L + L  H+D V ++ F+  +  L TGS D+ I+V     G+     +     H  +V 
Sbjct: 4   QLAKSLKLHNDKVWSIDFEPVRGLLATGSTDRAIKVLQLKNGKENLLDVLDDTVHKKAVR 63

Query: 387 SVD--SYQKVIVSGSADKTVKVW-----------HVESRTCYTLRGHTEWVNCVKLHPKS 433
           SV    +  ++ +GS D T+ +W            +E      + GH   V  +      
Sbjct: 64  SVAWRPHSDLLAAGSFDSTISIWTQSDLDLEEGAKLEMELLAIIEGHENEVKGISWSQDG 123

Query: 434 FSCFSCSDDTTIRMWDI----RTNSCLKVFRGHVGQVQKIIPLTIKDVENLATDNTSDGS 489
               +CS D ++ +W+         C+ V + H   V+ ++  T  ++            
Sbjct: 124 CLLATCSRDKSVWIWETDEAGEEYECISVLQEHSQDVKHVVWHTKHNL------------ 171

Query: 490 SPQDDPTMTDGADESDTPSNEQETVLDENIPYPTHLLSCGLDNTIKLWDV--KTGKCIRT 547
                                              L S   D+T+++W       +C   
Sbjct: 172 -----------------------------------LASSSYDDTVRIWKDYDDDWECAAV 196

Query: 548 QFGHVEGVW--DIA--ADNFRIISGSHDGSIKVW--------DLQSGKCMHTF-NGRRLQ 594
             GH   +W  D +   D  R+ SGS D +++VW        D Q   C  T  N  R Q
Sbjct: 197 LTGHEGTIWCSDFSKEEDPIRLCSGSDDSTVRVWKYIGDDEDDQQEWVCESTLPNAHRSQ 256

>KLLA0E21879g complement(1944865..1945866) similar to sgd|S0002675
           Saccharomyces cerevisiae YDR267c, start by similarity
          Length = 333

 Score = 55.5 bits (132), Expect = 5e-08,   Method: Compositional matrix adjust.
 Identities = 50/160 (31%), Positives = 75/160 (46%), Gaps = 25/160 (15%)

Query: 313 RLLFTGSYDSTIGIW-----------DLFTGKLIRRLSGHSDGVKTLYF--DDRKLITGS 359
            +L  GS+DST+ IW           DL T +L+  + GH + +K + +  D   L T S
Sbjct: 70  NILAAGSFDSTVSIWGKDDDGYNDENDLET-ELLAIIEGHENEIKCVAWSHDGELLATCS 128

Query: 360 LDKTIRVWNYITG----ECISTYRGHSDSVLSVDSYQK--VIVSGSADKTVKVWH---VE 410
            DK++ +W         ECIS  + HS  V  V  +Q   ++ S S D TV++W     +
Sbjct: 129 RDKSVWIWEADEMGEEFECISVLQEHSQDVKHVIWHQSLPLLASSSYDDTVRIWKDCDDD 188

Query: 411 SRTCYTLRGH--TEWVNCVKLHPKSFSCFSCSDDTTIRMW 448
              C  L GH  T W +  +    +    S SDD T+R+W
Sbjct: 189 WECCAVLNGHEGTVWSSDFEKSNSNVRLCSGSDDGTVRIW 228

 Score = 44.3 bits (103), Expect = 2e-04,   Method: Compositional matrix adjust.
 Identities = 59/294 (20%), Positives = 110/294 (37%), Gaps = 79/294 (26%)

Query: 333 KLIRRLSGHSDGVKTLYFDDRKLI-TGSLDKTIRVWNYITGECISTY--RGHSDSVLSVD 389
           KL++ L+ H D   ++  ++  ++ TGS D+ I++ +  + + I       H  +V SV 
Sbjct: 5   KLLKSLALHDDKCWSVDVNNGGIMATGSTDRKIKLVDIRSFQIIEELDDTAHKKTVRSVA 64

Query: 390 --SYQKVIVSGSADKTVKVW-----------HVESRTCYTLRGHTEWVNCVKLHPKSFSC 436
              +  ++ +GS D TV +W            +E+     + GH   + CV         
Sbjct: 65  WRPHSNILAAGSFDSTVSIWGKDDDGYNDENDLETELLAIIEGHENEIKCVAWSHDGELL 124

Query: 437 FSCSDDTTIRMWDI----RTNSCLKVFRGHVGQVQKIIPLTIKDVENLATDNTSDGSSPQ 492
            +CS D ++ +W+         C+ V + H   V+ +I                      
Sbjct: 125 ATCSRDKSVWIWEADEMGEEFECISVLQEHSQDVKHVI---------------------- 162

Query: 493 DDPTMTDGADESDTPSNEQETVLDENIPYPTHLLSCGLDNTIKLWDV--KTGKCIRTQFG 550
                                   +++P    L S   D+T+++W       +C     G
Sbjct: 163 ----------------------WHQSLPL---LASSSYDDTVRIWKDCDDDWECCAVLNG 197

Query: 551 HVEGVW----DIAADNFRIISGSHDGSIKVWDLQSGKCMHTFNGRRLQRETQHT 600
           H   VW    + +  N R+ SGS DG++++W      C+   NG   Q   Q +
Sbjct: 198 HEGTVWSSDFEKSNSNVRLCSGSDDGTVRIW------CLEDDNGEYEQEWIQES 245

>YDR267C (YDR267C) [1100] chr4 complement(1002502..1003494) Protein
           containing seven WD domains (WD-40 repeat), which may
           mediate protein-protein interactions, has moderate
           similarity to WD40 protein Ciao1 (human CIAO1), which
           binds and inhibits Wilms tumor suppressor protein (human
           WT1) transactivation activity [993 bp, 330 aa]
          Length = 330

 Score = 55.1 bits (131), Expect = 6e-08,   Method: Compositional matrix adjust.
 Identities = 50/155 (32%), Positives = 73/155 (47%), Gaps = 20/155 (12%)

Query: 314 LLFTGSYDSTIGIWD-------LFTGKLIRRLSGHSDGVKTLYF--DDRKLITGSLDKTI 364
           LL  GS+DST+ IW         F   L+  + GH + VK + +  D   L T S DK++
Sbjct: 72  LLAAGSFDSTVSIWAKEESADRTFEMDLLAIIEGHENEVKGVAWSNDGYYLATCSRDKSV 131

Query: 365 RVWNYITG----ECISTYRGHSDSVLSVDSY--QKVIVSGSADKTVKVW--HVESRTCYT 416
            +W         ECIS  + HS  V  V  +  + ++ S S D TV++W  + +   C  
Sbjct: 132 WIWETDESGEEYECISVLQEHSQDVKHVIWHPSEALLASSSYDDTVRIWKDYDDDWECVA 191

Query: 417 -LRGH--TEWVNCVKLHPKSFSCFSCSDDTTIRMW 448
            L GH  T W +        F   S SDD+T+R+W
Sbjct: 192 VLNGHEGTVWSSDFDKTEGVFRLCSGSDDSTVRVW 226

 Score = 40.0 bits (92), Expect = 0.005,   Method: Compositional matrix adjust.
 Identities = 52/231 (22%), Positives = 95/231 (41%), Gaps = 39/231 (16%)

Query: 375 ISTYRGHSDSVLSVDSYQKVIVSGSADKTVKVWHVESRTCYTL------RGHTEWVNCVK 428
           I + + + + + S D  Q ++ +GS D+ +K+  V+    +TL        H + +  V 
Sbjct: 7   IKSLKLYKEKIWSFDFSQGILATGSTDRKIKLVSVKYDD-FTLIDVLDETAHKKAIRSVA 65

Query: 429 LHPKSFSCFSCSDDTTIRMWDIRTNS-------CLKVFRGHVGQVQKIIPLTIKDVENLA 481
             P +    + S D+T+ +W    ++        L +  GH  +V+ +           +
Sbjct: 66  WRPHTSLLAAGSFDSTVSIWAKEESADRTFEMDLLAIIEGHENEVKGVA---------WS 116

Query: 482 TDNTSDGSSPQDDPTMTDGADESDTPSNEQETVLDEN-------IPYPTHLL--SCGLDN 532
            D     +  +D        DES     E  +VL E+       I +P+  L  S   D+
Sbjct: 117 NDGYYLATCSRDKSVWIWETDES-GEEYECISVLQEHSQDVKHVIWHPSEALLASSSYDD 175

Query: 533 TIKLWDV--KTGKCIRTQFGHVEGVWDIAADN----FRIISGSHDGSIKVW 577
           T+++W       +C+    GH   VW    D     FR+ SGS D +++VW
Sbjct: 176 TVRIWKDYDDDWECVAVLNGHEGTVWSSDFDKTEGVFRLCSGSDDSTVRVW 226

 Score = 35.4 bits (80), Expect = 0.10,   Method: Compositional matrix adjust.
 Identities = 23/63 (36%), Positives = 34/63 (53%), Gaps = 6/63 (9%)

Query: 314 LLFTGSYDSTIGIWDLFTG--KLIRRLSGHSDGVKTLYFDDR----KLITGSLDKTIRVW 367
           LL + SYD T+ IW  +    + +  L+GH   V +  FD      +L +GS D T+RVW
Sbjct: 167 LLASSSYDDTVRIWKDYDDDWECVAVLNGHEGTVWSSDFDKTEGVFRLCSGSDDSTVRVW 226

Query: 368 NYI 370
            Y+
Sbjct: 227 KYM 229

>Kwal_14.884
          Length = 395

 Score = 55.5 bits (132), Expect = 7e-08,   Method: Compositional matrix adjust.
 Identities = 46/160 (28%), Positives = 72/160 (45%), Gaps = 22/160 (13%)

Query: 295 IQEFKGHMDGVLTLQFNYRLLFTGSYDSTIGIWDLFTGKLIRRLSGHSDGVKTLYFDD-R 353
           I  F+ H   V  L  + R L +GS D  I I+DL   K +  L  H   +  L F    
Sbjct: 34  IFHFQAHSLSVKCLDISKRYLVSGSNDEHIRIYDLQKRKELGTLLSHQGSITALKFSKGT 93

Query: 354 KLITGSLDKTIRVWNYITGECISTYRGHSDSVLSVDSYQKVIVSGSADKTVKVWHVESRT 413
           K+   + D T           ++T RG+S          K ++S S D  + +W V+   
Sbjct: 94  KIEDKNEDDT----------GLTTGRGNS----------KWLISASDDHNLVIWRVKDWE 133

Query: 414 CY-TLRGHTEWVNCVKLHPKSFSCFSCSDDTTIRMWDIRT 452
            + TL+GH   +N   +HP +    S S+D +IR+W++ T
Sbjct: 134 NFGTLKGHASRINDFDIHPSNRIAISVSEDHSIRLWNLMT 173

 Score = 37.4 bits (85), Expect = 0.031,   Method: Compositional matrix adjust.
 Identities = 40/171 (23%), Positives = 67/171 (39%), Gaps = 32/171 (18%)

Query: 415 YTLRGHTEWVNCVKLHPKSFSCFSCSDDTTIRMWDIRTNSCLKVFRGHVGQVQKIIPLTI 474
           +  + H+  V C+ +  +     S S+D  IR++D++    L     H G +  +     
Sbjct: 35  FHFQAHSLSVKCLDISKRYL--VSGSNDEHIRIYDLQKRKELGTLLSHQGSITAL----- 87

Query: 475 KDVENLATDNTSDGSSPQDDPTMTDGADESDTPSNEQETVLDENIPYPTHLLSCGLDNTI 534
                      S G+  +D               NE +T L         L+S   D+ +
Sbjct: 88  ---------KFSKGTKIED--------------KNEDDTGLTTGRGNSKWLISASDDHNL 124

Query: 535 KLWDVKTGKCIRTQFGHVEGV--WDIAADNFRIISGSHDGSIKVWDLQSGK 583
            +W VK  +   T  GH   +  +DI   N   IS S D SI++W+L + K
Sbjct: 125 VIWRVKDWENFGTLKGHASRINDFDIHPSNRIAISVSEDHSIRLWNLMTVK 175

>ACR091W [1138] [Homologous to ScYDR267C - SH]
           complement(520609..521595) [987 bp, 328 aa]
          Length = 328

 Score = 55.1 bits (131), Expect = 7e-08,   Method: Compositional matrix adjust.
 Identities = 78/326 (23%), Positives = 132/326 (40%), Gaps = 46/326 (14%)

Query: 295 IQEFKGHMDGVLTLQFNYRLLFTGSYDSTIGIWDLFTGKLIRRL--SGHSDGVKTLYFDD 352
           ++  K H D   ++  +  LL TGS D  I + D+   KL+  L  + H   V+++ +  
Sbjct: 7   VRSLKLHGDRCWSVDISKGLLATGSADRKIKLVDVRNFKLVEELDDTAHKKAVRSVAWRP 66

Query: 353 R--KLITGSLDKTIRVWNY----ITG--ECISTYRGHSDSVLSVDSYQ--KVIVSGSADK 402
               L  GS D T+ +W       +G  E ++   GH + V SV        + + S DK
Sbjct: 67  HCNVLAAGSFDTTVSIWGRDDDDYSGETELLAVIEGHENEVKSVAWSHDGAYLATCSRDK 126

Query: 403 TVKVWHV----ESRTCYT-LRGHTEWVNCVKLHPKSFSCFSCSDDTTIRMWDIRTN--SC 455
           +V +W      E   C + L+ H++ V  +  H       S S D T+R+W  + +   C
Sbjct: 127 SVWIWEADELSEEFECNSVLQEHSQDVKHIVWHASRLLLASSSYDDTVRIWAEQDDDWEC 186

Query: 456 LKVFRGHVGQVQKIIPLTIKDVENLATD----NTSDGSSPQDDPTMTDGAD--------E 503
             V  GH G V         D E   T     + SD ++ +    +TD AD        E
Sbjct: 187 AAVLSGHGGTVW------CSDFERAETGIRLCSGSDDTTVRIWRCLTDDADVFDKEWIQE 240

Query: 504 SDTPSNEQETVLDENIPYPTHLLSCGLDNTIKLW-DVKTGK--------CIRTQFGHVEG 554
           +  P+     V   +      + S G D  + ++ +V+ G+        C  T +     
Sbjct: 241 TVLPAVHTRAVYSVSWSADGLIASVGSDGVLAVYKEVQAGRWEVVARVDCAHTVYEINVV 300

Query: 555 VWDIAADNFRIISGSHDGSIKVWDLQ 580
            W        +++G  DG + VW+L+
Sbjct: 301 KWLALDGRVLLVTGGDDGCVNVWELR 326

 Score = 33.9 bits (76), Expect = 0.36,   Method: Compositional matrix adjust.
 Identities = 37/152 (24%), Positives = 61/152 (40%), Gaps = 15/152 (9%)

Query: 334 LIRRLSGHSDGVKTLYFDDRKLITGSLDKTIRVWNYITGECISTY--RGHSDSVLSVD-- 389
           L+R L  H D   ++      L TGS D+ I++ +    + +       H  +V SV   
Sbjct: 6   LVRSLKLHGDRCWSVDISKGLLATGSADRKIKLVDVRNFKLVEELDDTAHKKAVRSVAWR 65

Query: 390 SYQKVIVSGSADKTVKVW-------HVESRTCYTLRGHTEWVNCVKLHPKSFSCFSCSDD 442
            +  V+ +GS D TV +W         E+     + GH   V  V          +CS D
Sbjct: 66  PHCNVLAAGSFDTTVSIWGRDDDDYSGETELLAVIEGHENEVKSVAWSHDGAYLATCSRD 125

Query: 443 TTIRMWDIRTNS----CLKVFRGHVGQVQKII 470
            ++ +W+    S    C  V + H   V+ I+
Sbjct: 126 KSVWIWEADELSEEFECNSVLQEHSQDVKHIV 157

>KLLA0E18986g 1680775..1683747 similar to sgd|S0006104 Saccharomyces
           cerevisiae YPL183c, start by similarity
          Length = 990

 Score = 55.5 bits (132), Expect = 1e-07,   Method: Compositional matrix adjust.
 Identities = 45/132 (34%), Positives = 69/132 (52%), Gaps = 11/132 (8%)

Query: 294 RIQEFKGHMDGV--LTLQFNYRLLFTGSYDSTIGIWDLFTGKLIRRLSGHSDGVKTLYF- 350
           +I   +GH   +  +T   N +LL + S D +I IWD+ +GKL+ R  GH+  +  L F 
Sbjct: 173 KIHTLRGHEGSIFYVTTSNNGKLLASCSDDRSIIIWDMVSGKLLSRAWGHTARIWNLKFF 232

Query: 351 -DDRKLITGSLDKTIRVWNYITGECI--STYRGH-SDSVLSVDSYQK--VIVSGSADKTV 404
            DD +LI+ S D T RVWNY   E      +  H + +V  VD  +   + +SG  D  +
Sbjct: 233 NDDTQLISVSEDCTCRVWNYKNDELTIKDIFESHLTKNVWGVDVEETNLIAISGGNDGRL 292

Query: 405 KVWHV--ESRTC 414
           KV  +   +R+C
Sbjct: 293 KVTELVPHNRSC 304

 Score = 43.1 bits (100), Expect = 7e-04,   Method: Compositional matrix adjust.
 Identities = 57/234 (24%), Positives = 95/234 (40%), Gaps = 57/234 (24%)

Query: 352 DRKLITGSLDKTIRVWNYITGECISTYRGHSDSVLSVDSYQKVIVSGSADKTVKVWHVES 411
           +R LI    + T++  +++ GE    Y G     + V  ++ ++ +G+    + VW ++S
Sbjct: 115 NRVLIIDPDNFTVKSTHFVEGERSILYSGS----IKVLRHKVLVNAGTIMNGIIVWELDS 170

Query: 412 RT-CYTLRGHTEWVNCVKLHPKSFSCFSCSDDTTIRMWDIRTNSCLKVFRGHVGQVQKII 470
           +   +TLRGH   +  V          SCSDD +I +WD+ +   L    GH  ++    
Sbjct: 171 KKKIHTLRGHEGSIFYVTTSNNGKLLASCSDDRSIIIWDMVSGKLLSRAWGHTARIW--- 227

Query: 471 PLTIKDVENLATDNTSDGSSPQDDPTMTDGADESDTPSNEQETVLDENIPYPTHLLSCGL 530
                   NL   N        DD                            T L+S   
Sbjct: 228 --------NLKFFN--------DD----------------------------TQLISVSE 243

Query: 531 DNTIKLWDVKTGKC-IRTQF-GHV-EGVW--DIAADNFRIISGSHDGSIKVWDL 579
           D T ++W+ K  +  I+  F  H+ + VW  D+   N   ISG +DG +KV +L
Sbjct: 244 DCTCRVWNYKNDELTIKDIFESHLTKNVWGVDVEETNLIAISGGNDGRLKVTEL 297

 Score = 40.4 bits (93), Expect = 0.004,   Method: Compositional matrix adjust.
 Identities = 19/59 (32%), Positives = 36/59 (61%), Gaps = 2/59 (3%)

Query: 525 LLSCGLDNTIKLWDVKTGKCIRTQFGHVEGVWDIA--ADNFRIISGSHDGSIKVWDLQS 581
           L SC  D +I +WD+ +GK +   +GH   +W++    D+ ++IS S D + +VW+ ++
Sbjct: 196 LASCSDDRSIIIWDMVSGKLLSRAWGHTARIWNLKFFNDDTQLISVSEDCTCRVWNYKN 254

 Score = 38.1 bits (87), Expect = 0.027,   Method: Compositional matrix adjust.
 Identities = 26/102 (25%), Positives = 55/102 (53%), Gaps = 4/102 (3%)

Query: 314 LLFTGSYDSTIGIWDLFTGKLIRRLSGHSDGV--KTLYFDDRKLITGSLDKTIRVWNYIT 371
           L+  G+  + I +W+L + K I  L GH   +   T   + + L + S D++I +W+ ++
Sbjct: 153 LVNAGTIMNGIIVWELDSKKKIHTLRGHEGSIFYVTTSNNGKLLASCSDDRSIIIWDMVS 212

Query: 372 GECISTYRGHSDSVLSVDSYQ--KVIVSGSADKTVKVWHVES 411
           G+ +S   GH+  + ++  +     ++S S D T +VW+ ++
Sbjct: 213 GKLLSRAWGHTARIWNLKFFNDDTQLISVSEDCTCRVWNYKN 254

 Score = 32.3 bits (72), Expect = 1.6,   Method: Compositional matrix adjust.
 Identities = 19/56 (33%), Positives = 30/56 (53%), Gaps = 2/56 (3%)

Query: 532 NTIKLWDVKTGKCIRTQFGHVEGVWDIAADNF--RIISGSHDGSIKVWDLQSGKCM 585
           N I +W++ + K I T  GH   ++ +   N    + S S D SI +WD+ SGK +
Sbjct: 161 NGIIVWELDSKKKIHTLRGHEGSIFYVTTSNNGKLLASCSDDRSIIIWDMVSGKLL 216

>Scas_717.68
          Length = 908

 Score = 54.7 bits (130), Expect = 2e-07,   Method: Compositional matrix adjust.
 Identities = 28/82 (34%), Positives = 44/82 (53%), Gaps = 2/82 (2%)

Query: 374 CISTYRGHSDSVLSVD-SYQKVIVSGSADKTVKVWHVESRTCYTLRGHTEWVNCVKLHPK 432
           C   ++ H+  VL +D S    +++ S D+TVK+WH+E +T      H ++V CV+ HP 
Sbjct: 320 CFKIFKEHTADVLDLDWSKNNFLITSSMDRTVKLWHLERQTSLKTFQHQDFVTCVRFHPT 379

Query: 433 SFSCF-SCSDDTTIRMWDIRTN 453
               F S   D  +R+W I  N
Sbjct: 380 DDRFFISGCLDHKVRLWSILEN 401

 Score = 46.6 bits (109), Expect = 5e-05,   Method: Compositional matrix adjust.
 Identities = 52/192 (27%), Positives = 78/192 (40%), Gaps = 30/192 (15%)

Query: 298 FKGHMDGVLTLQFNYR-LLFTGSYDSTIGIWDLFTGKLIRRLSGHSDGVKTLYF---DDR 353
           FK H   VL L ++    L T S D T+ +W L     ++    H D V  + F   DDR
Sbjct: 324 FKEHTADVLDLDWSKNNFLITSSMDRTVKLWHLERQTSLKTFQ-HQDFVTCVRFHPTDDR 382

Query: 354 KLITGSLDKTIRVW--------------NYITGECISTYRGHSDSVLSVDSYQKVIVSGS 399
             I+G LD  +R+W              + IT   +S   G    V + + Y  V+++  
Sbjct: 383 FFISGCLDHKVRLWSILENEITFEFDCQDLITSLTLSPGDGKYTIVGTFNGYVHVLLTKG 442

Query: 400 ADKTVKVWHV------ESRTCYTLRGHTEWV---NCVKLHP-KSFSCFSCSDDTTIRMWD 449
            ++ V  +HV      E  T  T   H   V    C K  P  S      S D+ IR++D
Sbjct: 443 LEQ-VSSFHVVDKNTQERNTASTKIHHGPRVTGLECFKYEPDNSLRIVVTSSDSRIRIFD 501

Query: 450 IRTNSCLKVFRG 461
           +     L+  +G
Sbjct: 502 LEKKKLLEYLKG 513

>KLLA0D02530g complement(212703..214826) gi|5679595|emb|CAB51777.1
           Kluyveromyces lactis CRN1 homologue, start by similarity
          Length = 707

 Score = 54.7 bits (130), Expect = 2e-07,   Method: Compositional matrix adjust.
 Identities = 46/143 (32%), Positives = 68/143 (47%), Gaps = 25/143 (17%)

Query: 298 FKGHMDGVLTLQF---NYRLLFTGSYDSTIGIWDLFTG----------------KLIRRL 338
           F+GH   VL   F   N  ++ +GS D  IGIW++                   K +R L
Sbjct: 89  FRGHTAQVLDTDFSPFNDHIVASGSDDGKIGIWEIPEDYGLHEYVDEEGNPKDLKPVRML 148

Query: 339 SGHSDGVKTLYF---DDRKLITGSLDKTIRVWNYITGECISTYRGHSDSVLSVD-SYQ-K 393
           SGHS  V  L F    +  L + SLD T+++W+ I+ E +     H D V S+  SY  K
Sbjct: 149 SGHSRKVGHLLFHPLAENILASSSLDYTVKIWD-ISQEEVKFTLKHPDMVTSMSFSYDGK 207

Query: 394 VIVSGSADKTVKVWHVESRTCYT 416
            +V+ S DK ++VW V +    +
Sbjct: 208 HLVTVSRDKKLRVWDVRAEKIVS 230

 Score = 34.7 bits (78), Expect = 0.30,   Method: Compositional matrix adjust.
 Identities = 44/184 (23%), Positives = 73/184 (39%), Gaps = 34/184 (18%)

Query: 301 HMDGVLTLQFNY--RLLFTGSYDSTIGIWDLFTGKLIRRLSGHSDGVKTLYF----DDRK 354
           H D V ++ F+Y  + L T S D  + +WD+   K++     HS G K        D  K
Sbjct: 193 HPDMVTSMSFSYDGKHLVTVSRDKKLRVWDVRAEKIVSEGPAHS-GAKNQRVVWLGDTDK 251

Query: 355 LITGSL----DKTIRVW---NYITGECISTYRGHSDSVLSV----DSYQKVIVSGSADKT 403
           + T       D+ I VW   N   G     Y     S + +    DS + + V+G  D  
Sbjct: 252 VATTGFSRLSDRQIGVWDAFNLEKGNLGGFYNVDQSSGILMPFYDDSNRILYVAGKGDGN 311

Query: 404 VKVWHVESRTCYTLRGH--TEWVNCVKLHPKSFSCFSCSDDTTIRMWDIRTNSCLKVFRG 461
           ++ +  ++   Y L  +  TE      + PK             R  +++ N  LK ++ 
Sbjct: 312 IRYFEFQNDELYELSEYQSTEPQRGFAVAPK-------------RSVNVKENEVLKAYKA 358

Query: 462 HVGQ 465
            VG+
Sbjct: 359 -VGE 361

 Score = 33.5 bits (75), Expect = 0.55,   Method: Compositional matrix adjust.
 Identities = 24/86 (27%), Positives = 44/86 (51%), Gaps = 11/86 (12%)

Query: 515 LDENIPYPTHLLSCGLDNTIKLWDVKTGKCIRTQFGHVEGV--WDIAADNFRIISGSHDG 572
           L ENI     L S  LD T+K+WD+ + + ++    H + V     + D   +++ S D 
Sbjct: 163 LAENI-----LASSSLDYTVKIWDI-SQEEVKFTLKHPDMVTSMSFSYDGKHLVTVSRDK 216

Query: 573 SIKVWDLQSGKCMH---TFNGRRLQR 595
            ++VWD+++ K +      +G + QR
Sbjct: 217 KLRVWDVRAEKIVSEGPAHSGAKNQR 242

>YGL004C (RPN14) [1968] chr7 complement(490705..491958) Protein
           containing three WD domains (WD-40 repeat), which may
           mediate protein-protein interactions, has a region of
           weak similarity to a region of S. pombe Cwf1p, which is
           a putative spliceosomal subunit and component of a 40S
           snRNP-containing complex [1254 bp, 417 aa]
          Length = 417

 Score = 53.5 bits (127), Expect = 3e-07,   Method: Compositional matrix adjust.
 Identities = 33/90 (36%), Positives = 47/90 (52%), Gaps = 6/90 (6%)

Query: 519 IPYPTHLLSCGLDNTIKLWDVKTGKCIRTQFGHVEGVWDIAA-DNFR-IISGSHDGSIKV 576
            P    L+S   D  +K+W VK G   RT  GH   V DIA  D  R ++S S DG+I++
Sbjct: 145 FPSGEALISSSQDMQLKIWSVKDGSNPRTLIGHRATVTDIAIIDRGRNVLSASLDGTIRL 204

Query: 577 WDLQSGKCMHTFNGRRLQRETQHTQTQSLG 606
           W+  +G  +HTFN    ++E  H    S+ 
Sbjct: 205 WECGTGTTIHTFN----RKENPHDGVNSIA 230

 Score = 39.3 bits (90), Expect = 0.008,   Method: Compositional matrix adjust.
 Identities = 46/192 (23%), Positives = 75/192 (39%), Gaps = 37/192 (19%)

Query: 299 KGHMDGVLTLQF--NYRLLFTGSYDSTIGIWDLFTGKLIRRLSGHSDGVKTLYFDD--RK 354
           + H+  +  L+F  +   L + S D  + IW +  G   R L GH   V  +   D  R 
Sbjct: 133 QAHVSEITKLKFFPSGEALISSSQDMQLKIWSVKDGSNPRTLIGHRATVTDIAIIDRGRN 192

Query: 355 LITGSLDKTIRVWNYITGECISTY---RGHSDSVLSVDSYQKVIVSGSADKTVKVWHVES 411
           +++ SLD TIR+W   TG  I T+       D V S+  +           T K  ++E 
Sbjct: 193 VLSASLDGTIRLWECGTGTTIHTFNRKENPHDGVNSIALFVGTDRQLHEISTSKKNNLEF 252

Query: 412 RTC--YTLRGHTEWVNCVKLH-----------PKSFSC---------------FSCSDDT 443
            T   Y + GH   V  + +H           P  F+C               ++  ++ 
Sbjct: 253 GTYGKYVIAGHVSGV--ITVHNVFSKEQTIQLPSKFTCSCNSLTVDGNNANYIYAGYENG 310

Query: 444 TIRMWDIRTNSC 455
            +  WD+R+  C
Sbjct: 311 MLAQWDLRSPEC 322

 Score = 37.0 bits (84), Expect = 0.048,   Method: Compositional matrix adjust.
 Identities = 28/119 (23%), Positives = 51/119 (42%), Gaps = 3/119 (2%)

Query: 344 GVKTLYFDDRKLITGSLDKTIRVWNYITGECISTYRGHSDSVLSVDSYQ--KVIVSGSAD 401
            V T     R+ I G+ +  I+V +          + H   +  +  +   + ++S S D
Sbjct: 98  AVDTAKLQMRRFILGTTEGDIKVLDSNFNLQREIDQAHVSEITKLKFFPSGEALISSSQD 157

Query: 402 KTVKVWHV-ESRTCYTLRGHTEWVNCVKLHPKSFSCFSCSDDTTIRMWDIRTNSCLKVF 459
             +K+W V +     TL GH   V  + +  +  +  S S D TIR+W+  T + +  F
Sbjct: 158 MQLKIWSVKDGSNPRTLIGHRATVTDIAIIDRGRNVLSASLDGTIRLWECGTGTTIHTF 216

>YNL317W (PFS2) [4296] chr14 (40618..42015) Polyadenylation factor I
           subunit 2 required for mRNA 3'-end processing, bridges
           two mRNA 3'-end processing factors, has WD (WD-40)
           repeats [1398 bp, 465 aa]
          Length = 465

 Score = 52.8 bits (125), Expect = 5e-07,   Method: Compositional matrix adjust.
 Identities = 41/162 (25%), Positives = 74/162 (45%), Gaps = 8/162 (4%)

Query: 298 FKGHMDGVLTLQFNYR--LLFTGSYDSTIGIWDLFTGKLIRRLSGHSDGVKTLYF--DDR 353
            + H   V T+++++    + +G  D  I IW      +    + H++ ++ + F  +D 
Sbjct: 131 MQAHDSAVTTMKYSHDSDWMISGDADGMIKIWQPNFSMVKEIDAAHTESIRDMAFSSNDS 190

Query: 354 KLITGSLDKTIRVWNYITGECISTYRGHSDSVLSVDSYQK--VIVSGSADKTVKVWHVES 411
           K +T S D  +++WN+  G+      GH   V S D + +  +I S S D  VK+W   S
Sbjct: 191 KFVTCSDDNILKIWNFSNGKQERVLSGHHWDVKSCDWHPEMGLIASASKDNLVKLWDPRS 250

Query: 412 RTCY-TLRGHTEWVNCVKLHP-KSFSCFSCSDDTTIRMWDIR 451
             C  ++      V   +  P K     + S D + R++DIR
Sbjct: 251 GNCISSILKFKHTVLKTRFQPTKGNLLMAISKDKSCRVFDIR 292

 Score = 52.0 bits (123), Expect = 9e-07,   Method: Compositional matrix adjust.
 Identities = 34/149 (22%), Positives = 63/149 (42%), Gaps = 5/149 (3%)

Query: 313 RLLFTGSYDSTIGIWDLFTGKLIRRLSGHSDGVKTLYF--DDRKLITGSLDKTIRVWNYI 370
           R L   +Y     +W+  +      +  H   V T+ +  D   +I+G  D  I++W   
Sbjct: 106 RRLVVATYSGEFSLWNASSFTFETLMQAHDSAVTTMKYSHDSDWMISGDADGMIKIWQPN 165

Query: 371 TGECISTYRGHSDSV--LSVDSYQKVIVSGSADKTVKVWHVES-RTCYTLRGHTEWVNCV 427
                     H++S+  ++  S     V+ S D  +K+W+  + +    L GH   V   
Sbjct: 166 FSMVKEIDAAHTESIRDMAFSSNDSKFVTCSDDNILKIWNFSNGKQERVLSGHHWDVKSC 225

Query: 428 KLHPKSFSCFSCSDDTTIRMWDIRTNSCL 456
             HP+     S S D  +++WD R+ +C+
Sbjct: 226 DWHPEMGLIASASKDNLVKLWDPRSGNCI 254

 Score = 42.4 bits (98), Expect = 8e-04,   Method: Compositional matrix adjust.
 Identities = 22/66 (33%), Positives = 35/66 (53%), Gaps = 8/66 (12%)

Query: 525 LLSCGLDNTIKLWDVKTGKCIRTQFGHVEGVWDIAADNFR-----IISGSHDGSIKVWDL 579
            ++C  DN +K+W+   GK  R   GH    WD+ + ++      I S S D  +K+WD 
Sbjct: 192 FVTCSDDNILKIWNFSNGKQERVLSGHH---WDVKSCDWHPEMGLIASASKDNLVKLWDP 248

Query: 580 QSGKCM 585
           +SG C+
Sbjct: 249 RSGNCI 254

 Score = 33.1 bits (74), Expect = 0.73,   Method: Compositional matrix adjust.
 Identities = 16/68 (23%), Positives = 32/68 (47%), Gaps = 2/68 (2%)

Query: 525 LLSCGLDNTIKLWDVKTGKCIRTQFGHVEGVWDIA--ADNFRIISGSHDGSIKVWDLQSG 582
           ++S   D  IK+W             H E + D+A  +++ + ++ S D  +K+W+  +G
Sbjct: 150 MISGDADGMIKIWQPNFSMVKEIDAAHTESIRDMAFSSNDSKFVTCSDDNILKIWNFSNG 209

Query: 583 KCMHTFNG 590
           K     +G
Sbjct: 210 KQERVLSG 217

 Score = 30.4 bits (67), Expect = 5.1,   Method: Compositional matrix adjust.
 Identities = 40/207 (19%), Positives = 74/207 (35%), Gaps = 54/207 (26%)

Query: 351 DDRKLITGSLDKTIRVWNYITGECISTYRGHSDSVLSVDSYQK---VIVSGSADKTVKVW 407
           + R+L+  +      +WN  +    +  + H DS ++   Y      ++SG AD  +K+W
Sbjct: 104 EGRRLVVATYSGEFSLWNASSFTFETLMQAH-DSAVTTMKYSHDSDWMISGDADGMIKIW 162

Query: 408 HVESRTCYTL-RGHTEWVNCVKLHPKSFSCFSCSDDTTIRMWDIRTNSCLKVFRGHVGQV 466
                    +   HTE +  +          +CSDD           + LK++    G+ 
Sbjct: 163 QPNFSMVKEIDAAHTESIRDMAFSSNDSKFVTCSDD-----------NILKIWNFSNGKQ 211

Query: 467 QKIIPLTIKDVENLATDNTSDGSSPQDDPTMTDGADESDTPSNEQETVLDENIPYPTHLL 526
           ++++           + +  D  S    P M                           + 
Sbjct: 212 ERVL-----------SGHHWDVKSCDWHPEMG-------------------------LIA 235

Query: 527 SCGLDNTIKLWDVKTGKCIRT--QFGH 551
           S   DN +KLWD ++G CI +  +F H
Sbjct: 236 SASKDNLVKLWDPRSGNCISSILKFKH 262

>Kwal_26.8628
          Length = 422

 Score = 52.8 bits (125), Expect = 5e-07,   Method: Compositional matrix adjust.
 Identities = 51/259 (19%), Positives = 111/259 (42%), Gaps = 21/259 (8%)

Query: 333 KLIRRLSGHSDGVKTL-YFDDRKLITGSLDKTIRVWNYITGECISTYRGHSDSVLSV--- 388
           +++    GH+  V  + +F++  +IT S D T  +W+    + I+ +  H   VL++   
Sbjct: 166 QIVSMFKGHTCYVSQVEFFENNSIITASGDMTCALWDIPKAKRIAEFSDHLGDVLALALP 225

Query: 389 ----DSYQKVIVSGSADKTVKVWHVESRTCYTLRGHTEW-VNCVKLHPKSFSCFSCSDDT 443
                +   +  SG +D  V +W   +R        +E  ++ +K     ++  + +DD 
Sbjct: 226 PPHAQTSSPIFASGGSDGYVYIWDTRARAAAQSFFVSESDISTLKFFNNGYAIVTGADDG 285

Query: 444 TIRMWDIRTNSCLKVFR-GHVGQVQKIIPLTIKDVENLATDNTSDGSSPQDDPTMTDGAD 502
             RM+D+R++  +  +      Q Q   P  + +   L  D T   +S      +T  + 
Sbjct: 286 VARMFDMRSDCAVASYSLSQNLQQQANSPTRLYNSSPLEYDVTPSNAS------LTKTSR 339

Query: 503 ESDTPSNEQETVLDENIPYPTHLL-SCGLDNTIKLWDVKTGKCIRTQFGH---VEGVWDI 558
            +++   + + ++  +      L+ +C  D    +WD    + +    GH   + GV   
Sbjct: 340 SANSTYLDNQGIVSLDFSGSGRLMHACYTDYGCVIWDTLRAEIVGKLEGHSSRISGV-KT 398

Query: 559 AADNFRIISGSHDGSIKVW 577
           + D   + +GS D ++K+W
Sbjct: 399 SPDGMAVCTGSWDATLKLW 417

 Score = 37.4 bits (85), Expect = 0.034,   Method: Compositional matrix adjust.
 Identities = 26/74 (35%), Positives = 40/74 (54%), Gaps = 8/74 (10%)

Query: 304 GVLTLQFNY--RLLFTGSYDSTIGIWDLFTGKLIRRLSGHS---DGVKTLYFDDRKLITG 358
           G+++L F+   RL+     D    IWD    +++ +L GHS    GVKT   D   + TG
Sbjct: 350 GIVSLDFSGSGRLMHACYTDYGCVIWDTLRAEIVGKLEGHSSRISGVKT-SPDGMAVCTG 408

Query: 359 SLDKTIRVW--NYI 370
           S D T+++W  NY+
Sbjct: 409 SWDATLKLWSPNYM 422

>Scas_585.8
          Length = 460

 Score = 52.8 bits (125), Expect = 6e-07,   Method: Compositional matrix adjust.
 Identities = 42/162 (25%), Positives = 75/162 (46%), Gaps = 8/162 (4%)

Query: 298 FKGHMDGVLTLQFNYR--LLFTGSYDSTIGIWDLFTGKLIRRLSGHSDGVKTLYF--DDR 353
            + H   V  +Q+++    + +G  D  I IW      +    + H++ ++ + F  +D 
Sbjct: 127 MQAHDSAVSCIQYSHAGDWMCSGDADGGIKIWQPNFNMVKEFENAHTECIRDISFSNNDS 186

Query: 354 KLITGSLDKTIRVWNYITGECISTYRGHSDSVLSVDSYQK--VIVSGSADKTVKVWHVES 411
           K +T S D  +++WN+  G+   T  GH   + S D + +  +IVS S D  VK+W   S
Sbjct: 187 KFVTCSDDNVLKIWNFSNGQVERTLSGHHWDIKSCDWHPEMGLIVSASKDNLVKLWDPRS 246

Query: 412 RTCY-TLRGHTEWVNCVKLHPKSFSCFSC-SDDTTIRMWDIR 451
             C  T+      V   +  P   +  +  S D + R++DIR
Sbjct: 247 GQCISTIIKFKHTVLKTRFQPTRGNLLAAISKDKSCRVFDIR 288

 Score = 47.4 bits (111), Expect = 3e-05,   Method: Compositional matrix adjust.
 Identities = 24/68 (35%), Positives = 39/68 (57%), Gaps = 8/68 (11%)

Query: 525 LLSCGLDNTIKLWDVKTGKCIRTQFGHVEGVWDIAADNFR-----IISGSHDGSIKVWDL 579
            ++C  DN +K+W+   G+  RT  GH    WDI + ++      I+S S D  +K+WD 
Sbjct: 188 FVTCSDDNVLKIWNFSNGQVERTLSGHH---WDIKSCDWHPEMGLIVSASKDNLVKLWDP 244

Query: 580 QSGKCMHT 587
           +SG+C+ T
Sbjct: 245 RSGQCIST 252

 Score = 37.4 bits (85), Expect = 0.030,   Method: Compositional matrix adjust.
 Identities = 43/207 (20%), Positives = 75/207 (36%), Gaps = 55/207 (26%)

Query: 351 DDRKLITGSLDKTIRVWNYITGECISTYRGHSDSVLSVDSYQKV---IVSGSADKTVKVW 407
           + R+L+  + +    +WN  T    S  + H DS +S   Y      + SG AD  +K+W
Sbjct: 101 EGRRLVVATYNGEFSLWNG-TSFNESLMQAH-DSAVSCIQYSHAGDWMCSGDADGGIKIW 158

Query: 408 HVESRTCYTLR-GHTEWVNCVKLHPKSFSCFSCSDDTTIRMWDIRTNSCLKVFRGHVGQV 466
                        HTE +  +          +CSDD  +++W+              GQV
Sbjct: 159 QPNFNMVKEFENAHTECIRDISFSNNDSKFVTCSDDNVLKIWNFSN-----------GQV 207

Query: 467 QKIIPLTIKDVENLATDNTSDGSSPQDDPTMTDGADESDTPSNEQETVLDENIPYPTHLL 526
           ++ +     D+++                                     +  P    ++
Sbjct: 208 ERTLSGHHWDIKSC------------------------------------DWHPEMGLIV 231

Query: 527 SCGLDNTIKLWDVKTGKCIRT--QFGH 551
           S   DN +KLWD ++G+CI T  +F H
Sbjct: 232 SASKDNLVKLWDPRSGQCISTIIKFKH 258

>YLR429W (CRN1) [3804] chr12 (990773..992728) Coronin, actin-binding
           protein, inhibits ARP2/3-stimulated actin nucleation,
           contains WD (WD-40) repeats [1956 bp, 651 aa]
          Length = 651

 Score = 52.8 bits (125), Expect = 6e-07,   Method: Compositional matrix adjust.
 Identities = 56/208 (26%), Positives = 91/208 (43%), Gaps = 42/208 (20%)

Query: 290 KGHCRIQEFKGHMDGVLTLQF---NYRLLFTGSYDSTIGIWDLFTG-------------- 332
           K   ++  F+GH   VL   F   N   + +GS DS IGIWD+                 
Sbjct: 69  KAPDQVPLFRGHTAQVLDTDFDPFNDHRIASGSDDSKIGIWDIPENYKFHDHVDEDGEPI 128

Query: 333 --KLIRRLSGHSDGVKTLYF---DDRKLITGSLDKTIRVWNYITGECISTYRGHSDSVLS 387
             K ++ L+GH+  V  + +    +  L + S D T+++WN  TG+ + T + H D V S
Sbjct: 129 DIKPVKFLTGHARKVGHVLYHPVAENVLASSSGDYTVKLWNVETGKDMITLK-HPDMVTS 187

Query: 388 VD-SYQ-KVIVSGSADKTVKVWHV-ESRTCYTLRGHTE-------WV-NCVKLHPKSFSC 436
           +  SY    + + + DK ++VW++ E +       HT        W+ N  +L    FS 
Sbjct: 188 MSFSYDGNYLATVARDKKLRVWNIREEKIVSEGPAHTGAKNQRVVWLGNSDRLATTGFSK 247

Query: 437 FSCSDDTTIRMWDIRTNSCLKVFRGHVG 464
            S   D  I +WD        + +G +G
Sbjct: 248 LS---DRQIGIWD-----AFNIEKGDLG 267

 Score = 35.0 bits (79), Expect = 0.20,   Method: Compositional matrix adjust.
 Identities = 47/176 (26%), Positives = 69/176 (39%), Gaps = 42/176 (23%)

Query: 417 LRGHTEWVNCVKLHP-KSFSCFSCSDDTTIRMWDIRTNSCLKVFRGHVGQVQKIIPLTIK 475
            RGHT  V      P       S SDD+ I +WDI  N     F  HV +  +  P+ IK
Sbjct: 77  FRGHTAQVLDTDFDPFNDHRIASGSDDSKIGIWDIPENYK---FHDHVDEDGE--PIDIK 131

Query: 476 DVENLATDNTSDGSSPQDDPTMTDGADESDTPSNEQETVL----DENIPYPTHLLSCGLD 531
            V+ L       G                         VL     EN+     L S   D
Sbjct: 132 PVKFLTGHARKVGH------------------------VLYHPVAENV-----LASSSGD 162

Query: 532 NTIKLWDVKTGKCIRTQFGHVEGV--WDIAADNFRIISGSHDGSIKVWDLQSGKCM 585
            T+KLW+V+TGK + T   H + V     + D   + + + D  ++VW+++  K +
Sbjct: 163 YTVKLWNVETGKDMIT-LKHPDMVTSMSFSYDGNYLATVARDKKLRVWNIREEKIV 217

 Score = 31.2 bits (69), Expect = 3.3,   Method: Compositional matrix adjust.
 Identities = 25/97 (25%), Positives = 45/97 (46%), Gaps = 23/97 (23%)

Query: 514 VLDENI-PYPTHLLSCGLDNT-IKLWDVKTG----------------KCIRTQFGHVEGV 555
           VLD +  P+  H ++ G D++ I +WD+                   K ++   GH   V
Sbjct: 84  VLDTDFDPFNDHRIASGSDDSKIGIWDIPENYKFHDHVDEDGEPIDIKPVKFLTGHARKV 143

Query: 556 WDI----AADNFRIISGSHDGSIKVWDLQSGKCMHTF 588
             +     A+N  + S S D ++K+W++++GK M T 
Sbjct: 144 GHVLYHPVAENV-LASSSGDYTVKLWNVETGKDMITL 179

>KLLA0F16038g complement(1487475..1490063) weakly similar to
           ca|CA1657|IPF16022 Candida albicans unknown function,
           hypothetical start
          Length = 862

 Score = 52.8 bits (125), Expect = 6e-07,   Method: Compositional matrix adjust.
 Identities = 33/112 (29%), Positives = 56/112 (50%), Gaps = 8/112 (7%)

Query: 306 LTLQFNYRLLFTGSYDSTIGIWDLF---TGKLIRRLSGHSDGVKTLYF-----DDRKLIT 357
           L LQ     +     D T+ I+D     T +L+R L    DG+   +F      D+ L +
Sbjct: 607 LRLQLTNSDIIVSRSDKTMQIFDKTSNSTPRLLRLLDDQGDGILVNHFYVNADSDQILCS 666

Query: 358 GSLDKTIRVWNYITGECISTYRGHSDSVLSVDSYQKVIVSGSADKTVKVWHV 409
            SLDKTIR ++Y TG+C++ Y  H+D V+ + +     V+ + +  +  W +
Sbjct: 667 SSLDKTIRCFSYTTGKCLNQYYAHADPVVGMTTVANKFVTVTGNGCLFSWEI 718

 Score = 32.7 bits (73), Expect = 1.1,   Method: Compositional matrix adjust.
 Identities = 15/67 (22%), Positives = 33/67 (49%)

Query: 525 LLSCGLDNTIKLWDVKTGKCIRTQFGHVEGVWDIAADNFRIISGSHDGSIKVWDLQSGKC 584
           L S  LD TI+ +   TGKC+   + H + V  +     + ++ + +G +  W+++  + 
Sbjct: 664 LCSSSLDKTIRCFSYTTGKCLNQYYAHADPVVGMTTVANKFVTVTGNGCLFSWEIRPEEE 723

Query: 585 MHTFNGR 591
               +G+
Sbjct: 724 ADEISGK 730

>Kwal_56.24163
          Length = 729

 Score = 52.4 bits (124), Expect = 8e-07,   Method: Compositional matrix adjust.
 Identities = 41/123 (33%), Positives = 60/123 (48%), Gaps = 16/123 (13%)

Query: 321 DSTIGIWDLFTGKLIRRLSGH-SDGVKTLYF----DDRKLITGSLDKTIRVWNYITGECI 375
           D T+ IW L        L  H + GV  + +    D   LIT S D+T+++W+Y T  C+
Sbjct: 19  DHTVKIWSLGQPTANFTLQAHETRGVNYVDYYPLQDKPYLITSSDDRTVKIWDYQTKSCV 78

Query: 376 STYRGHSDSVLSVDSYQ------KVIVSGSADKTVKVWHVES-RTCYTLRGHTEWVNCVK 428
           +T  GH  +V    SY        +I+SGS D T+KVW+  + +   TL    E   C+ 
Sbjct: 79  ATLEGHMANV----SYAVFHPSLPIILSGSEDGTLKVWNSNTYKLEKTLNLGLERSWCIA 134

Query: 429 LHP 431
            HP
Sbjct: 135 THP 137

 Score = 51.2 bits (121), Expect = 2e-06,   Method: Compositional matrix adjust.
 Identities = 31/108 (28%), Positives = 54/108 (50%), Gaps = 6/108 (5%)

Query: 351 DDRKLITGSLDKTIRVWNYITGECISTYRGH-SDSVLSVDSY----QKVIVSGSADKTVK 405
           D     +  LD T+++W+        T + H +  V  VD Y    +  +++ S D+TVK
Sbjct: 9   DPSTFASACLDHTVKIWSLGQPTANFTLQAHETRGVNYVDYYPLQDKPYLITSSDDRTVK 68

Query: 406 VWHVESRTCY-TLRGHTEWVNCVKLHPKSFSCFSCSDDTTIRMWDIRT 452
           +W  ++++C  TL GH   V+    HP      S S+D T+++W+  T
Sbjct: 69  IWDYQTKSCVATLEGHMANVSYAVFHPSLPIILSGSEDGTLKVWNSNT 116

 Score = 49.3 bits (116), Expect = 8e-06,   Method: Compositional matrix adjust.
 Identities = 27/80 (33%), Positives = 41/80 (51%), Gaps = 4/80 (5%)

Query: 395 IVSGSADKTVKVWHVESRTC-YTLRGH-TEWVNCVKLHPKSFSCF--SCSDDTTIRMWDI 450
             S   D TVK+W +   T  +TL+ H T  VN V  +P     +  + SDD T+++WD 
Sbjct: 13  FASACLDHTVKIWSLGQPTANFTLQAHETRGVNYVDYYPLQDKPYLITSSDDRTVKIWDY 72

Query: 451 RTNSCLKVFRGHVGQVQKII 470
           +T SC+    GH+  V   +
Sbjct: 73  QTKSCVATLEGHMANVSYAV 92

 Score = 46.6 bits (109), Expect = 6e-05,   Method: Compositional matrix adjust.
 Identities = 25/68 (36%), Positives = 40/68 (58%), Gaps = 2/68 (2%)

Query: 524 HLLSCGLDNTIKLWDVKTGKCIRTQFGHVEGV-WDIAADNFRII-SGSHDGSIKVWDLQS 581
           +L++   D T+K+WD +T  C+ T  GH+  V + +   +  II SGS DG++KVW+  +
Sbjct: 57  YLITSSDDRTVKIWDYQTKSCVATLEGHMANVSYAVFHPSLPIILSGSEDGTLKVWNSNT 116

Query: 582 GKCMHTFN 589
            K   T N
Sbjct: 117 YKLEKTLN 124

 Score = 35.4 bits (80), Expect = 0.14,   Method: Compositional matrix adjust.
 Identities = 21/56 (37%), Positives = 28/56 (50%), Gaps = 2/56 (3%)

Query: 315 LFTGSYDSTIGIWDLFTGKLIRRLSGHSDGVKTLYFDDRK--LITGSLDKTIRVWN 368
           L T S D T+ IWD  T   +  L GH   V    F      +++GS D T++VWN
Sbjct: 58  LITSSDDRTVKIWDYQTKSCVATLEGHMANVSYAVFHPSLPIILSGSEDGTLKVWN 113

 Score = 34.7 bits (78), Expect = 0.26,   Method: Compositional matrix adjust.
 Identities = 22/74 (29%), Positives = 35/74 (47%), Gaps = 5/74 (6%)

Query: 522 PTHLLSCGLDNTIKLWDVKTGKCIRTQFGH-VEGV----WDIAADNFRIISGSHDGSIKV 576
           P+   S  LD+T+K+W +       T   H   GV    +    D   +I+ S D ++K+
Sbjct: 10  PSTFASACLDHTVKIWSLGQPTANFTLQAHETRGVNYVDYYPLQDKPYLITSSDDRTVKI 69

Query: 577 WDLQSGKCMHTFNG 590
           WD Q+  C+ T  G
Sbjct: 70  WDYQTKSCVATLEG 83

>Scas_719.52
          Length = 628

 Score = 52.0 bits (123), Expect = 1e-06,   Method: Compositional matrix adjust.
 Identities = 57/194 (29%), Positives = 84/194 (43%), Gaps = 39/194 (20%)

Query: 291 GHC--RIQEFKGHMDGVLTLQF---NYRLLFTGSYDSTIGIWDLFTG------------- 332
           G C  ++  F+GH   VL   F   N  ++ + S DS IGIW +                
Sbjct: 68  GKCPDQVPLFRGHTAQVLDTDFDPFNDHIIASSSDDSKIGIWKIPEDYSFQHYLDPDGEP 127

Query: 333 ---KLIRRLSGHSDGVKTLYF---DDRKLITGSLDKTIRVWNYITGECISTYRGHSDSVL 386
              K ++ LSGHS  V  + F    +  L + SLD T+++WN  TGE + T + H D V 
Sbjct: 128 KNIKPVKFLSGHSRKVGHVLFHPVAENVLASSSLDYTVKLWNIETGEAVITLK-HPDMVT 186

Query: 387 SVD-SY-QKVIVSGSADKTVKVWHV-ESRTCYTLRGHTE-------WV-NCVKLHPKSFS 435
           S+  SY    + +   DK ++VW + E +       H         W+ N  +L    FS
Sbjct: 187 SMSFSYGGNHLATVCRDKKLRVWDIREGKIVSEGPAHAGAKNQRVVWLGNSDRLATTGFS 246

Query: 436 CFSCSDDTTIRMWD 449
             S   D  I +WD
Sbjct: 247 RLS---DRQIGIWD 257

 Score = 35.4 bits (80), Expect = 0.13,   Method: Compositional matrix adjust.
 Identities = 21/67 (31%), Positives = 36/67 (53%), Gaps = 11/67 (16%)

Query: 525 LLSCGLDNTIKLWDVKTGKCIRTQFGHVEGVWDIAADNFRIISGSH------DGSIKVWD 578
           L S  LD T+KLW+++TG+ + T   H + V  ++        G+H      D  ++VWD
Sbjct: 156 LASSSLDYTVKLWNIETGEAVIT-LKHPDMVTSMSFS----YGGNHLATVCRDKKLRVWD 210

Query: 579 LQSGKCM 585
           ++ GK +
Sbjct: 211 IREGKIV 217

>Sklu_2430.9 YMR102C, Contig c2430 15497-18397
          Length = 966

 Score = 52.0 bits (123), Expect = 1e-06,   Method: Compositional matrix adjust.
 Identities = 27/76 (35%), Positives = 41/76 (53%), Gaps = 2/76 (2%)

Query: 377 TYRGHSDSVLSVD-SYQKVIVSGSADKTVKVWHVESRTCYTLRGHTEWVNCVKLHPKSFS 435
           ++ GH+  +L +D S    +++GS DKTVK+WH + +       H ++V CVK HP    
Sbjct: 391 SFLGHNQDILDIDWSKNNFVLTGSMDKTVKLWHCDRKQLLKNFPHPDFVTCVKFHPNDDR 450

Query: 436 CF-SCSDDTTIRMWDI 450
            F S   D   R+W I
Sbjct: 451 FFISGCLDHKARLWSI 466

 Score = 40.4 bits (93), Expect = 0.004,   Method: Compositional matrix adjust.
 Identities = 46/211 (21%), Positives = 88/211 (41%), Gaps = 40/211 (18%)

Query: 296 QEFKGHMDGVLTLQFNYR-LLFTGSYDSTIGIWDLFTGKLIRRLSGHSDGVKTLYF---D 351
           + F GH   +L + ++    + TGS D T+ +W     +L++    H D V  + F   D
Sbjct: 390 RSFLGHNQDILDIDWSKNNFVLTGSMDKTVKLWHCDRKQLLKNFP-HPDFVTCVKFHPND 448

Query: 352 DRKLITGSLDKTIRVWNYITGEC------------------------ISTYRGHSDSVLS 387
           DR  I+G LD   R+W+ +  E                         + T+ G+   +L+
Sbjct: 449 DRFFISGCLDHKARLWSILDDEVSFEFDCGDLITSLEVSPGDSKYTILGTFNGYVIVLLT 508

Query: 388 --VDSYQKVIVSGSADKTVKVWHVESRTCYTLRGHTE------WVNCVK-LHPKSFSCFS 438
             ++      +S   DK  K   V +R   T R +T        + C + ++  +     
Sbjct: 509 RGLEHVYSFHLSDKQDKKGK--DVTTRDLPTSRTNTHHGPKVTGIECFRAVNDMTLKLLV 566

Query: 439 CSDDTTIRMWDIRTNSCLKVFRGHVGQVQKI 469
            S+D+ IR+++++ N   +V +G   +  +I
Sbjct: 567 TSNDSKIRVFNLKDNILQEVLKGFENESSQI 597

>Kwal_33.15136
          Length = 473

 Score = 51.6 bits (122), Expect = 1e-06,   Method: Compositional matrix adjust.
 Identities = 71/319 (22%), Positives = 130/319 (40%), Gaps = 54/319 (16%)

Query: 300 GHMDGVLTLQFNYRLL---FTGSYDSTIGIWDLFTGKLIRRLSGHSDGVKTLYF------ 350
           GH DGV T+  NY +L    T S D  +  W++ T + +     H   +  L        
Sbjct: 65  GHRDGVYTIAKNYHVLNKLATASADGVVKYWNMSTREEVCSFKAHYGLIHGLCVTPQHLS 124

Query: 351 ---DDRKLITGSLDKTIRVWNYITGE----------------CISTYRGHSDSVLSVDSY 391
              ++  +++   D+T+++W+  T +                 I T+ G   + L +D +
Sbjct: 125 QNKNENYMLSCGDDRTVKLWSVNTDDFSSERGDEEVIKSGNGLIKTFHG-EHAFLGIDHH 183

Query: 392 QKV--IVSGSADKTVKVW-HVESRTCYTLRGHTEWVNCVKLHPKSFSCF-SCSDDTTIRM 447
           +     V+G A+  + +W    SR    L    + V+ VK +      F S   D ++ +
Sbjct: 184 RSNSNFVTGGAE--INLWDSTRSRPITNLSWGADNVSTVKFNQNETDIFASAGSDNSVVL 241

Query: 448 WDIRTNSCLKVFRGHVGQVQKIIPLTI----KDVENLATDNTSDGSSPQDDPTMTDGADE 503
           +D+RTNS  + F      VQK+    +     +  N    N    +   D   M + +  
Sbjct: 242 YDLRTNSPTQKF------VQKMRTNALCWNPMEAYNFVVANEDHNAYYYD---MRNLSRA 292

Query: 504 SDTPSNEQETVLDENI-PYPTHLLSCGLDNTIKLWDVKTGKCIR----TQFGHVEGVWDI 558
                +    V+D +  P    +++   D TI+++ VK G         +  HV  V   
Sbjct: 293 LHVFKDHVSAVMDVDFSPTGDEIVTGSYDKTIRIYQVKHGHSREIYHTKRMQHVFQV-KY 351

Query: 559 AADNFRIISGSHDGSIKVW 577
             D+  I+SGS DG++++W
Sbjct: 352 TMDSRYIVSGSDDGNVRMW 370

 Score = 33.1 bits (74), Expect = 0.78,   Method: Compositional matrix adjust.
 Identities = 20/63 (31%), Positives = 33/63 (52%), Gaps = 7/63 (11%)

Query: 354 KLITGSLDKTIRVWNYITGECISTYRGHSDSVLSVDSYQ-----KVIVSGSADKTVKVWH 408
           +++TGS DKTIR++    G     Y  H+  +  V   +     + IVSGS D  V++W 
Sbjct: 314 EIVTGSYDKTIRIYQVKHGHSREIY--HTKRMQHVFQVKYTMDSRYIVSGSDDGNVRMWR 371

Query: 409 VES 411
            ++
Sbjct: 372 AKA 374

>KLLA0A08866g 776960..778231 weakly similar to sp|P53196
           Saccharomyces cerevisiae YGL004c singleton, hypothetical
           start
          Length = 423

 Score = 51.2 bits (121), Expect = 1e-06,   Method: Compositional matrix adjust.
 Identities = 28/73 (38%), Positives = 38/73 (52%), Gaps = 2/73 (2%)

Query: 519 IPYPTHLLSCGLDNTIKLWDVKTGKCIRTQFGHVEGVWDIA-ADNFR-IISGSHDGSIKV 576
            P     LS  +D  +K+WD  TG  +RT  GH   V D A  D  R  +S S DGS+K+
Sbjct: 167 FPNGHGFLSSSIDMRLKIWDASTGTELRTFIGHTRSVNDFAMVDRGRNFVSASSDGSLKL 226

Query: 577 WDLQSGKCMHTFN 589
           W+  +  C+ T N
Sbjct: 227 WECSTSACVFTLN 239

 Score = 44.7 bits (104), Expect = 2e-04,   Method: Compositional matrix adjust.
 Identities = 25/101 (24%), Positives = 53/101 (52%), Gaps = 4/101 (3%)

Query: 333 KLIRRLSGHSDGV-KTLYF-DDRKLITGSLDKTIRVWNYITGECISTYRGHSDSV--LSV 388
           ++I+    H+  + KT +F +    ++ S+D  +++W+  TG  + T+ GH+ SV   ++
Sbjct: 149 EVIKLPEAHASHITKTQFFPNGHGFLSSSIDMRLKIWDASTGTELRTFIGHTRSVNDFAM 208

Query: 389 DSYQKVIVSGSADKTVKVWHVESRTCYTLRGHTEWVNCVKL 429
               +  VS S+D ++K+W   +  C       + +NC+ L
Sbjct: 209 VDRGRNFVSASSDGSLKLWECSTSACVFTLNSNDGINCISL 249

 Score = 38.1 bits (87), Expect = 0.020,   Method: Compositional matrix adjust.
 Identities = 26/99 (26%), Positives = 44/99 (44%), Gaps = 5/99 (5%)

Query: 299 KGHMDGVLTLQF--NYRLLFTGSYDSTIGIWDLFTGKLIRRLSGHSDGVKTLYFDD--RK 354
           + H   +   QF  N     + S D  + IWD  TG  +R   GH+  V      D  R 
Sbjct: 155 EAHASHITKTQFFPNGHGFLSSSIDMRLKIWDASTGTELRTFIGHTRSVNDFAMVDRGRN 214

Query: 355 LITGSLDKTIRVWNYITGECISTYRGHSD-SVLSVDSYQ 392
            ++ S D ++++W   T  C+ T   +   + +S+ +YQ
Sbjct: 215 FVSASSDGSLKLWECSTSACVFTLNSNDGINCISLANYQ 253

 Score = 34.7 bits (78), Expect = 0.22,   Method: Compositional matrix adjust.
 Identities = 19/71 (26%), Positives = 35/71 (49%), Gaps = 1/71 (1%)

Query: 395 IVSGSADKTVKVWHVESRT-CYTLRGHTEWVNCVKLHPKSFSCFSCSDDTTIRMWDIRTN 453
            +S S D  +K+W   + T   T  GHT  VN   +  +  +  S S D ++++W+  T+
Sbjct: 173 FLSSSIDMRLKIWDASTGTELRTFIGHTRSVNDFAMVDRGRNFVSASSDGSLKLWECSTS 232

Query: 454 SCLKVFRGHVG 464
           +C+     + G
Sbjct: 233 ACVFTLNSNDG 243

>Scas_720.45
          Length = 755

 Score = 51.6 bits (122), Expect = 2e-06,   Method: Compositional matrix adjust.
 Identities = 42/124 (33%), Positives = 61/124 (49%), Gaps = 10/124 (8%)

Query: 317 TGSYDSTIGIWDLFTGKLIRRL-SGHSDGVKTL-YF---DDRKLITGSLDKTIRVWNYIT 371
           +G  D T+ +W L        L SG   GV  + Y+   D   LIT S D T +VW+Y T
Sbjct: 15  SGCLDRTVKVWSLGQATPNFTLNSGQEKGVNYVDYYPLPDKPYLITSSDDLTCKVWDYQT 74

Query: 372 GECISTYRGHSDSVLSVDSYQ---KVIVSGSADKTVKVWHVES-RTCYTLRGHTEWVNCV 427
             C++T  GH  +V S   +     +I+SGS D T+K+W+  + +   TL    E   C+
Sbjct: 75  KSCVATLEGHMANV-SFAVFHPTLPIIISGSEDGTLKIWNSATYKVEKTLSLGLERSWCI 133

Query: 428 KLHP 431
             HP
Sbjct: 134 ATHP 137

 Score = 51.2 bits (121), Expect = 2e-06,   Method: Compositional matrix adjust.
 Identities = 33/110 (30%), Positives = 54/110 (49%), Gaps = 10/110 (9%)

Query: 351 DDRKLITGSLDKTIRVWNYITGECISTY---RGHSDSVLSVDSY----QKVIVSGSADKT 403
           D     +G LD+T++VW+   G+    +    G    V  VD Y    +  +++ S D T
Sbjct: 9   DPNTFASGCLDRTVKVWS--LGQATPNFTLNSGQEKGVNYVDYYPLPDKPYLITSSDDLT 66

Query: 404 VKVWHVESRTCY-TLRGHTEWVNCVKLHPKSFSCFSCSDDTTIRMWDIRT 452
            KVW  ++++C  TL GH   V+    HP      S S+D T+++W+  T
Sbjct: 67  CKVWDYQTKSCVATLEGHMANVSFAVFHPTLPIIISGSEDGTLKIWNSAT 116

 Score = 47.8 bits (112), Expect = 3e-05,   Method: Compositional matrix adjust.
 Identities = 29/77 (37%), Positives = 41/77 (53%), Gaps = 6/77 (7%)

Query: 395 IVSGSADKTVKVWHVESRT-CYTLR-GHTEWVNCVKLHP---KSFSCFSCSDDTTIRMWD 449
             SG  D+TVKVW +   T  +TL  G  + VN V  +P   K +   + SDD T ++WD
Sbjct: 13  FASGCLDRTVKVWSLGQATPNFTLNSGQEKGVNYVDYYPLPDKPY-LITSSDDLTCKVWD 71

Query: 450 IRTNSCLKVFRGHVGQV 466
            +T SC+    GH+  V
Sbjct: 72  YQTKSCVATLEGHMANV 88

 Score = 41.6 bits (96), Expect = 0.002,   Method: Compositional matrix adjust.
 Identities = 24/76 (31%), Positives = 41/76 (53%), Gaps = 8/76 (10%)

Query: 519 IPYPTHLLSCGLDNTIKLWDVKTGKCIRTQFGHVEGVWDIAADNFR-----IISGSHDGS 573
           +P   +L++   D T K+WD +T  C+ T  GH+    +++   F      IISGS DG+
Sbjct: 52  LPDKPYLITSSDDLTCKVWDYQTKSCVATLEGHMA---NVSFAVFHPTLPIIISGSEDGT 108

Query: 574 IKVWDLQSGKCMHTFN 589
           +K+W+  + K   T +
Sbjct: 109 LKIWNSATYKVEKTLS 124

 Score = 33.1 bits (74), Expect = 0.77,   Method: Compositional matrix adjust.
 Identities = 21/59 (35%), Positives = 28/59 (47%), Gaps = 2/59 (3%)

Query: 315 LFTGSYDSTIGIWDLFTGKLIRRLSGHSDGVKTLYFDDRK--LITGSLDKTIRVWNYIT 371
           L T S D T  +WD  T   +  L GH   V    F      +I+GS D T+++WN  T
Sbjct: 58  LITSSDDLTCKVWDYQTKSCVATLEGHMANVSFAVFHPTLPIIISGSEDGTLKIWNSAT 116

>ABL024W [568] [Homologous to ScYMR102C - SH; ScYKL121W - SH]
           complement(353684..355888) [2205 bp, 734 aa]
          Length = 734

 Score = 51.2 bits (121), Expect = 2e-06,   Method: Compositional matrix adjust.
 Identities = 46/194 (23%), Positives = 79/194 (40%), Gaps = 23/194 (11%)

Query: 298 FKGHMDGVLTLQFNYR-LLFTGSYDSTIGIWDLFTGKLIRRLSGHSDGVKTLYF---DDR 353
           F  H+  +L   ++    L T S D T+ +W +     ++    H D V  + F   DDR
Sbjct: 210 FGEHLQDILDCDWSKNSFLLTASMDKTVKLWHINRTTSLKTFV-HPDFVTCVRFHPHDDR 268

Query: 354 KLITGSLDKTIRVWNYITGECISTYR-GHSDSVLSVDSYQKVIVSGSADKTVKVWHVES- 411
              +G LD T+R W+ + GE    +  G     L V      ++ G+ +  V V H    
Sbjct: 269 FFFSGCLDHTVRTWSILEGEVAEAFNCGDLIMALDVSPDGNWLLIGTFNGYVHVLHTNGL 328

Query: 412 ---RTCYTLRGHTEWVNCVKLHPKS-------------FSCFSCSDDTTIRMWDIRTNSC 455
               + + L+   E  N  +  PK                    S+D+ +R++D+ T   
Sbjct: 329 KLLHSFHLLQKPNETENRPRHGPKITGVEFIRHKAYPWLGLLITSNDSRVRLFDMSTTRL 388

Query: 456 LKVFRGHVGQVQKI 469
           L++FRG   +  +I
Sbjct: 389 LEIFRGFSNESSRI 402

 Score = 33.5 bits (75), Expect = 0.61,   Method: Compositional matrix adjust.
 Identities = 19/68 (27%), Positives = 33/68 (48%), Gaps = 4/68 (5%)

Query: 525 LLSCGLDNTIKLWDVKTGKCIRTQFGHVEGVWDI---AADNFRIISGSHDGSIKVWDLQS 581
           LL+  +D T+KLW +     ++T F H + V  +     D+    SG  D +++ W +  
Sbjct: 228 LLTASMDKTVKLWHINRTTSLKT-FVHPDFVTCVRFHPHDDRFFFSGCLDHTVRTWSILE 286

Query: 582 GKCMHTFN 589
           G+    FN
Sbjct: 287 GEVAEAFN 294

>KLLA0E07073g 645766..647124 similar to sp|P42841 Saccharomyces
           cerevisiae YNL317w PFS2 polyadenylation factor I subunit
           2 required for mRNA 3 -end processing, bridges two mRNA
           3 -end processing factors singleton, start by similarity
          Length = 452

 Score = 50.4 bits (119), Expect = 3e-06,   Method: Compositional matrix adjust.
 Identities = 30/116 (25%), Positives = 53/116 (45%), Gaps = 5/116 (4%)

Query: 351 DDRKLITGSLDKTIRVWNYITGECISTYRGHSDSVLSVDSYQKV---IVSGSADKTVKVW 407
           + R+L+  + +    +W+  +    S  + H DS ++V +Y      +VSGSAD  +K+W
Sbjct: 92  EGRRLVVATYNGEFSLWSGSSFNFESIMQAH-DSAVTVMTYSHTGDWMVSGSADGELKIW 150

Query: 408 HVESRTCYTL-RGHTEWVNCVKLHPKSFSCFSCSDDTTIRMWDIRTNSCLKVFRGH 462
                    + + H E V  +   P      SCSDD  +++W+       +V  GH
Sbjct: 151 QPNFNMVKVMDQAHMECVREISFSPTDQKFVSCSDDNVLKIWNFSNGQQERVLSGH 206

 Score = 50.1 bits (118), Expect = 3e-06,   Method: Compositional matrix adjust.
 Identities = 39/166 (23%), Positives = 65/166 (39%), Gaps = 5/166 (3%)

Query: 301 HMDGVLTLQFNYRLLFTGSYDSTIGIWDLFTGKLIRRLSGHSDGVKTLYFDDRK--LITG 358
           H+   LT     R L   +Y+    +W   +      +  H   V  + +      +++G
Sbjct: 82  HVIPALTWTPEGRRLVVATYNGEFSLWSGSSFNFESIMQAHDSAVTVMTYSHTGDWMVSG 141

Query: 359 SLDKTIRVWNYITGECISTYRGHSDSV--LSVDSYQKVIVSGSADKTVKVWHVES-RTCY 415
           S D  +++W           + H + V  +S     +  VS S D  +K+W+  + +   
Sbjct: 142 SADGELKIWQPNFNMVKVMDQAHMECVREISFSPTDQKFVSCSDDNVLKIWNFSNGQQER 201

Query: 416 TLRGHTEWVNCVKLHPKSFSCFSCSDDTTIRMWDIRTNSCLKVFRG 461
            L GH   V     HPK     S S D  I+ WD R+ SC+    G
Sbjct: 202 VLSGHHWDVKSCDWHPKMGLIVSGSKDNLIKFWDPRSGSCVSTMLG 247

 Score = 48.1 bits (113), Expect = 2e-05,   Method: Compositional matrix adjust.
 Identities = 27/78 (34%), Positives = 40/78 (51%), Gaps = 8/78 (10%)

Query: 520 PYPTHLLSCGLDNTIKLWDVKTGKCIRTQFGHVEGVWDIAADNFR-----IISGSHDGSI 574
           P     +SC  DN +K+W+   G+  R   GH    WD+ + ++      I+SGS D  I
Sbjct: 175 PTDQKFVSCSDDNVLKIWNFSNGQQERVLSGHH---WDVKSCDWHPKMGLIVSGSKDNLI 231

Query: 575 KVWDLQSGKCMHTFNGRR 592
           K WD +SG C+ T  G +
Sbjct: 232 KFWDPRSGSCVSTMLGFK 249

>Kwal_55.21450
          Length = 503

 Score = 50.4 bits (119), Expect = 3e-06,   Method: Compositional matrix adjust.
 Identities = 45/181 (24%), Positives = 81/181 (44%), Gaps = 24/181 (13%)

Query: 295 IQEFKGHMDG---VLTLQFNYRLLFTGSYDSTIGIWDLFTGK-LIRRLSGHSDGVKTLYF 350
           I  + GH +G   +L L  +  L  +   D+ + IWDL+  + L+R   GHS  V+ + F
Sbjct: 203 IHTYPGHKNGTNSILLLPKSGHLCLSAGNDNQVKIWDLYRDRELLRDYRGHSKAVRGISF 262

Query: 351 DDR--KLITGSLDKTIRVWNYITGECISTYRGHSDSVLSVDSYQKVIVSGSADKTVKVWH 408
           +    + ++ S D+ I++W+  TG+    Y     S   + +  +   S S +  V + +
Sbjct: 263 NSEGSEFLSVSFDQQIKIWDTETGKVRHQY-----SYSCIPNCAEFRPSNSNEFIVGLSN 317

Query: 409 VESRTCYTLRG------------HTEWVNCVKLHPKSFSCFSCSDDTTIRMWDIRTNSCL 456
            E R  Y LR             H   +  +K  P      S S+D ++R+W+ + N  +
Sbjct: 318 SEIRH-YDLRTSHKNGLVQVYDHHLSSIIALKYFPDGSKFVSSSEDKSMRIWENQINIPI 376

Query: 457 K 457
           K
Sbjct: 377 K 377

 Score = 45.8 bits (107), Expect = 8e-05,   Method: Compositional matrix adjust.
 Identities = 26/74 (35%), Positives = 42/74 (56%), Gaps = 4/74 (5%)

Query: 519 IPYPTHL-LSCGLDNTIKLWDV-KTGKCIRTQFGHVEGVWDIA--ADNFRIISGSHDGSI 574
           +P   HL LS G DN +K+WD+ +  + +R   GH + V  I+  ++    +S S D  I
Sbjct: 219 LPKSGHLCLSAGNDNQVKIWDLYRDRELLRDYRGHSKAVRGISFNSEGSEFLSVSFDQQI 278

Query: 575 KVWDLQSGKCMHTF 588
           K+WD ++GK  H +
Sbjct: 279 KIWDTETGKVRHQY 292

 Score = 39.7 bits (91), Expect = 0.007,   Method: Compositional matrix adjust.
 Identities = 24/89 (26%), Positives = 42/89 (47%), Gaps = 5/89 (5%)

Query: 369 YITGECISTYRGH---SDSVLSVDSYQKVIVSGSADKTVKVWHV--ESRTCYTLRGHTEW 423
           Y+  + I TY GH   ++S+L +     + +S   D  VK+W +  +       RGH++ 
Sbjct: 197 YLPKKLIHTYPGHKNGTNSILLLPKSGHLCLSAGNDNQVKIWDLYRDRELLRDYRGHSKA 256

Query: 424 VNCVKLHPKSFSCFSCSDDTTIRMWDIRT 452
           V  +  + +     S S D  I++WD  T
Sbjct: 257 VRGISFNSEGSEFLSVSFDQQIKIWDTET 285

>AFL056C [3137] [Homologous to ScYPL183C - SH] (329216..332146)
           [2931 bp, 976 aa]
          Length = 976

 Score = 50.1 bits (118), Expect = 5e-06,   Method: Compositional matrix adjust.
 Identities = 39/143 (27%), Positives = 67/143 (46%), Gaps = 10/143 (6%)

Query: 317 TGSYDSTIGIWDLFTGKLIRRLSGHSDGVK-TLYFDDRKLITG-SLDKTIRVWNYITGEC 374
            G+    + +W+L TG +++RL GH   +   +  DD +L+   S D++IRVW+  TGE 
Sbjct: 156 AGTVMGGVVVWELHTGAVVQRLEGHEGSIFCAVVSDDGRLVASCSDDRSIRVWSLETGEQ 215

Query: 375 ISTYRGHSDSV--LSVDSYQKVIVSGSADKTVKVWHV-----ESRTCYTLRGHTEWVNCV 427
           +    GH+  +  L        +VS S D T +VW V     +    Y +   T+ V  V
Sbjct: 216 VGIAWGHTARIWDLRFLRVADKLVSVSEDCTCRVWAVGAERMQEEAVYDVH-QTKSVWAV 274

Query: 428 KLHPKSFSCFSCSDDTTIRMWDI 450
            +        +  +D  +R+ D+
Sbjct: 275 DVQEDDMVAVTAGNDGRLRLVDL 297

 Score = 37.7 bits (86), Expect = 0.034,   Method: Compositional matrix adjust.
 Identities = 24/85 (28%), Positives = 43/85 (50%), Gaps = 17/85 (20%)

Query: 527 SCGLDNTIKLWDVKTGKCIRTQFGHVEGVWDI----AADNFRIISGSHDGSIKVWDLQSG 582
           SC  D +I++W ++TG+ +   +GH   +WD+     AD  +++S S D + +VW     
Sbjct: 198 SCSDDRSIRVWSLETGEQVGIAWGHTARIWDLRFLRVAD--KLVSVSEDCTCRVW----- 250

Query: 583 KCMHTFNGRRLQRETQHT--QTQSL 605
                    R+Q E  +   QT+S+
Sbjct: 251 ----AVGAERMQEEAVYDVHQTKSV 271

 Score = 37.4 bits (85), Expect = 0.037,   Method: Compositional matrix adjust.
 Identities = 21/83 (25%), Positives = 37/83 (44%), Gaps = 1/83 (1%)

Query: 395 IVSGSADKTVKVWHVESRTCYT-LRGHTEWVNCVKLHPKSFSCFSCSDDTTIRMWDIRTN 453
           + +G+    V VW + +      L GH   + C  +        SCSDD +IR+W + T 
Sbjct: 154 VCAGTVMGGVVVWELHTGAVVQRLEGHEGSIFCAVVSDDGRLVASCSDDRSIRVWSLETG 213

Query: 454 SCLKVFRGHVGQVQKIIPLTIKD 476
             + +  GH  ++  +  L + D
Sbjct: 214 EQVGIAWGHTARIWDLRFLRVAD 236

 Score = 31.6 bits (70), Expect = 2.6,   Method: Compositional matrix adjust.
 Identities = 24/77 (31%), Positives = 39/77 (50%), Gaps = 4/77 (5%)

Query: 295 IQEFKGHMDGVL--TLQFNYRLLFTGSYDSTIGIWDLFTGKLIRRLSGHSDGVKTLYF-- 350
           +Q  +GH   +    +  + RL+ + S D +I +W L TG+ +    GH+  +  L F  
Sbjct: 174 VQRLEGHEGSIFCAVVSDDGRLVASCSDDRSIRVWSLETGEQVGIAWGHTARIWDLRFLR 233

Query: 351 DDRKLITGSLDKTIRVW 367
              KL++ S D T RVW
Sbjct: 234 VADKLVSVSEDCTCRVW 250

>CAGL0G03399g complement(325879..326988) highly similar to sp|P40066
           Saccharomyces cerevisiae YER107c GLE2, start by
           similarity
          Length = 369

 Score = 48.9 bits (115), Expect = 6e-06,   Method: Compositional matrix adjust.
 Identities = 29/105 (27%), Positives = 64/105 (60%), Gaps = 8/105 (7%)

Query: 315 LFTGSYDSTIGIWDLFTGKLIRRLSGHSDGVKTLYF------DDRKLITGSLDKTIRVWN 368
           + +G  D+T+ ++D+ +G+  +++  H+D VK+L F      +   L+TGS DKTI+ W+
Sbjct: 94  IASGGCDNTVKLYDVASGQS-QQIGSHNDAVKSLRFVQCGPTNTECLVTGSWDKTIKFWD 152

Query: 369 YITGECISTYRGHSDSVLSVDSYQKVIVSGSADKTVKVWHVESRT 413
               + I+T     + V ++D+ Q+++V G+A++ + + ++ + T
Sbjct: 153 TRQPQPITTI-AMPERVYTMDNKQQLLVVGTAERHIAIINLANPT 196

 Score = 32.7 bits (73), Expect = 0.88,   Method: Compositional matrix adjust.
 Identities = 23/79 (29%), Positives = 38/79 (48%), Gaps = 7/79 (8%)

Query: 296 QEFKGHMDGVLTLQF------NYRLLFTGSYDSTIGIWDLFTGKLIRRLSGHSDGVKTLY 349
           Q+   H D V +L+F      N   L TGS+D TI  WD    + I  ++   + V T+ 
Sbjct: 114 QQIGSHNDAVKSLRFVQCGPTNTECLVTGSWDKTIKFWDTRQPQPITTIA-MPERVYTMD 172

Query: 350 FDDRKLITGSLDKTIRVWN 368
              + L+ G+ ++ I + N
Sbjct: 173 NKQQLLVVGTAERHIAIIN 191

 Score = 30.4 bits (67), Expect = 4.4,   Method: Compositional matrix adjust.
 Identities = 21/61 (34%), Positives = 33/61 (54%), Gaps = 9/61 (14%)

Query: 525 LLSCGLDNTIKLWDVKTGKCIRTQFG-HVEGVWDI------AADNFRIISGSHDGSIKVW 577
           + S G DNT+KL+DV +G+    Q G H + V  +        +   +++GS D +IK W
Sbjct: 94  IASGGCDNTVKLYDVASGQS--QQIGSHNDAVKSLRFVQCGPTNTECLVTGSWDKTIKFW 151

Query: 578 D 578
           D
Sbjct: 152 D 152

>Scas_659.9
          Length = 475

 Score = 49.3 bits (116), Expect = 7e-06,   Method: Compositional matrix adjust.
 Identities = 63/300 (21%), Positives = 120/300 (40%), Gaps = 43/300 (14%)

Query: 329 LFTGKLIRRLS-GHSDGVKTL---YFDDRKLITGSLDKTIRVWNYITGECISTYRGHSDS 384
           +F    + +L  GH DGV  +   Y +  KL TGS D  ++ WN  T E + +++ H   
Sbjct: 53  MFAKPFVGQLGYGHRDGVYVIAKNYKNLNKLATGSADGVVKYWNMSTREELCSFKAHYGL 112

Query: 385 V---------LSVDSYQKVIVSGSADKTVKVWHVESRTCYTLRGHTEWVNCVKLHPKSFS 435
           +         LS    +  ++S S DKTVK+W V S     L+   +      L    +S
Sbjct: 113 ITGLCVTPEHLSKQKNENFMLSCSDDKTVKLWSVNSEDYANLKNAEDINTASGLLKTYYS 172

Query: 436 CFS-------------CSDDTTIRMWDIRTNSCLKVFRGHVGQVQKIIPLTIKDVENLAT 482
            F+              +    I++WD   +  L         +      T+K  +N   
Sbjct: 173 DFAFQGIDHHRSKSNFVTGGAKIQLWDSNRSKPLTDLSWGADNIS-----TVKFNQNETD 227

Query: 483 DNTSDGSSPQDDPTMTDGADESDTPSNEQETVLDENI----PYPT-HLLSCGLDNTIKLW 537
              S GS    D ++      +++P+ +    +  N     P    + +    D+    +
Sbjct: 228 ILASAGS----DNSLVLYDLRTNSPTQKIVQTMRTNAICWNPMEAFNFVVANEDHNAYYY 283

Query: 538 DVKT-GKCIRTQFGHVEGVWDI--AADNFRIISGSHDGSIKVWDLQSGKCMHTFNGRRLQ 594
           D++   + +     HV  V D+  +     I++GS+D +I++++   G     ++ +R+Q
Sbjct: 284 DMRNMSRALNVFKDHVSAVMDVDFSPTGDEIVTGSYDKTIRIFNTTHGHSREIYHTKRMQ 343

 Score = 43.9 bits (102), Expect = 3e-04,   Method: Compositional matrix adjust.
 Identities = 68/315 (21%), Positives = 128/315 (40%), Gaps = 47/315 (14%)

Query: 300 GHMDGVLTLQFNYR---LLFTGSYDSTIGIWDLFTGKLIRRLSGHSDGVKTL-----YFD 351
           GH DGV  +  NY+    L TGS D  +  W++ T + +     H   +  L     +  
Sbjct: 65  GHRDGVYVIAKNYKNLNKLATGSADGVVKYWNMSTREELCSFKAHYGLITGLCVTPEHLS 124

Query: 352 DRK----LITGSLDKTIRVW--------NYITGECISTYRGHSDSVLSVDSYQKV----- 394
            +K    +++ S DKT+++W        N    E I+T  G   +  S  ++Q +     
Sbjct: 125 KQKNENFMLSCSDDKTVKLWSVNSEDYANLKNAEDINTASGLLKTYYSDFAFQGIDHHRS 184

Query: 395 ---IVSGSADKTVKVWHV-ESRTCYTLRGHTEWVNCVKLHPKSFSCF-SCSDDTTIRMWD 449
               V+G A   +++W    S+    L    + ++ VK +        S   D ++ ++D
Sbjct: 185 KSNFVTGGA--KIQLWDSNRSKPLTDLSWGADNISTVKFNQNETDILASAGSDNSLVLYD 242

Query: 450 IRTNSCLKVFRGHVGQVQKIIPLTIKDVE--NLATDNTSDGSSPQDDPTMTDGADESDTP 507
           +RTNS  +     + Q  +   +    +E  N    N    +   D   M+      +  
Sbjct: 243 LRTNSPTQ----KIVQTMRTNAICWNPMEAFNFVVANEDHNAYYYDMRNMSRAL---NVF 295

Query: 508 SNEQETVLDENI-PYPTHLLSCGLDNTIKLWDVKTGKCIR----TQFGHVEGVWDIAADN 562
            +    V+D +  P    +++   D TI++++   G         +  HV  V   + D 
Sbjct: 296 KDHVSAVMDVDFSPTGDEIVTGSYDKTIRIFNTTHGHSREIYHTKRMQHVFQV-KFSMDA 354

Query: 563 FRIISGSHDGSIKVW 577
             I+SGS DG++++W
Sbjct: 355 KYIVSGSDDGNVRLW 369

 Score = 32.0 bits (71), Expect = 1.5,   Method: Compositional matrix adjust.
 Identities = 22/77 (28%), Positives = 40/77 (51%), Gaps = 9/77 (11%)

Query: 298 FKGHMDGVLTLQFNYR--LLFTGSYDSTIGIWDLFTGKLIRRLSGHSDGVKTLY-----F 350
           FK H+  V+ + F+     + TGSYD TI I++   G    R   H+  ++ ++      
Sbjct: 295 FKDHVSAVMDVDFSPTGDEIVTGSYDKTIRIFNTTHGH--SREIYHTKRMQHVFQVKFSM 352

Query: 351 DDRKLITGSLDKTIRVW 367
           D + +++GS D  +R+W
Sbjct: 353 DAKYIVSGSDDGNVRLW 369

 Score = 31.2 bits (69), Expect = 3.0,   Method: Compositional matrix adjust.
 Identities = 25/105 (23%), Positives = 46/105 (43%), Gaps = 11/105 (10%)

Query: 496 TMTDGADESDTPSNEQETVLDENIPYPTHLLSCGLDNTIKLWDVKTGKCIRTQF------ 549
           T+   AD+     + QE+ L  N+    H      + T  L   K  +     F      
Sbjct: 5   TIKRSADDYVPVKSTQESQLPRNLNPELHPFERAREYTKALNATKMERMFAKPFVGQLGY 64

Query: 550 GHVEGVWDIAADNFR----IISGSHDGSIKVWDLQSGKCMHTFNG 590
           GH +GV+ + A N++    + +GS DG +K W++ + + + +F  
Sbjct: 65  GHRDGVY-VIAKNYKNLNKLATGSADGVVKYWNMSTREELCSFKA 108

>Kwal_26.7655
          Length = 743

 Score = 49.3 bits (116), Expect = 7e-06,   Method: Compositional matrix adjust.
 Identities = 27/80 (33%), Positives = 41/80 (51%), Gaps = 2/80 (2%)

Query: 378 YRGHSDSVLSVD-SYQKVIVSGSADKTVKVWHVESRTCYTLRGHTEWVNCVKLHPKSFSC 436
           Y+ H+  +L +D S    I++ S DKT ++WH +      +  H ++V C K HP     
Sbjct: 268 YQEHTQDILDLDWSKNGFILTTSMDKTARLWHCDRPKALKVFTHPDFVTCAKFHPNDDRF 327

Query: 437 F-SCSDDTTIRMWDIRTNSC 455
           F S   D T+R+W I  NS 
Sbjct: 328 FISGCLDHTLRLWSILDNSV 347

 Score = 38.5 bits (88), Expect = 0.018,   Method: Compositional matrix adjust.
 Identities = 43/189 (22%), Positives = 78/189 (41%), Gaps = 27/189 (14%)

Query: 298 FKGHMDGVLTLQFNYR-LLFTGSYDSTIGIWDLFTGKLIRRLSGHSDGVKTLYF---DDR 353
           ++ H   +L L ++    + T S D T  +W     K ++  + H D V    F   DDR
Sbjct: 268 YQEHTQDILDLDWSKNGFILTTSMDKTARLWHCDRPKALKVFT-HPDFVTCAKFHPNDDR 326

Query: 354 KLITGSLDKTIRVWNYITGECISTYRGHSDSVLSVDSYQK--------------VIVSGS 399
             I+G LD T+R+W+ +       Y    D + ++D+  +              +I+   
Sbjct: 327 FFISGCLDHTLRLWSILDNSVSFDYYC-GDIITAIDTSPRDGKYTAAGTFNGHIIILYTR 385

Query: 400 ADKTVKVWHVESRTCYTLRGHTE------WVNCVKLHPKS-FSCFSCSDDTTIRMWDIRT 452
             + V  +HV  +   T +   E       +   K  P +       S+D+ IR++ I+ 
Sbjct: 386 GLEMVSTFHVLEKPNGTTKKVPESGPKITGIEFFKSAPDNDLRIMVTSNDSRIRIFRIKG 445

Query: 453 NSCLKVFRG 461
            S L+V +G
Sbjct: 446 QSLLEVLKG 454

>KLLA0F22000g complement(2044973..2047354) similar to sp|P42935
           Saccharomyces cerevisiae YGR200c ELP2 90 kDa subunit of
           elongator and elongating RNA polymerase II holoenzyme
           singleton, start by similarity
          Length = 793

 Score = 49.3 bits (116), Expect = 8e-06,   Method: Compositional matrix adjust.
 Identities = 36/135 (26%), Positives = 62/135 (45%), Gaps = 11/135 (8%)

Query: 337 RLSGHSDGVKTLYF-----DDRKLITGSLDKTIRVWNYITGECISTYRGHSDSVLSVDSY 391
           +L GH D +K+L F      D  L +GS D+ IR+W   T E I T     +  L++ S 
Sbjct: 196 KLEGHEDWIKSLVFRETVPGDYLLASGSQDRYIRLWRIRTNEKIDTSE-EDEKKLTLLSN 254

Query: 392 QKVIVSGSADKTVKVWHVESRTCYTLRGHTEWVNCVKLHPKSFSCFSCSDDTTIRMWDIR 451
           +      SAD      HV       + GH +W++ ++ H       + + DT + +W+  
Sbjct: 255 KIYKFDISADV-----HVAINFEALIMGHDDWISSLQWHKTKLQLLTSTADTAVMVWEPD 309

Query: 452 TNSCLKVFRGHVGQV 466
           T S + +    +G++
Sbjct: 310 TISGIWICSSRLGEL 324

 Score = 36.6 bits (83), Expect = 0.061,   Method: Compositional matrix adjust.
 Identities = 23/79 (29%), Positives = 40/79 (50%), Gaps = 9/79 (11%)

Query: 395 IVSGSADKTVKVWHVESRTCY----TLRGHTEWVNCVKLHPKSFSCFSCSDDTTIRMWDI 450
           +V+  A KT+ +W     + +    TL+GHT  V CV+    +    S S+D  +R+W+ 
Sbjct: 26  VVAYGAGKTIALWKSMDTSHHGVFKTLKGHTAEVTCVRFVKGTDMMVSASEDFEVRVWNF 85

Query: 451 RTNSCLKVFRGHVGQVQKI 469
                 K+  GH+ +V+ I
Sbjct: 86  P-----KLREGHMDEVECI 99

 Score = 35.8 bits (81), Expect = 0.10,   Method: Compositional matrix adjust.
 Identities = 42/203 (20%), Positives = 67/203 (33%), Gaps = 72/203 (35%)

Query: 323 TIGIW---DLFTGKLIRRLSGHSDGVKTLYF--DDRKLITGSLDKTIRVWNYI------- 370
           TI +W   D     + + L GH+  V  + F      +++ S D  +RVWN+        
Sbjct: 34  TIALWKSMDTSHHGVFKTLKGHTAEVTCVRFVKGTDMMVSASEDFEVRVWNFPKLREGHM 93

Query: 371 -TGECISTYRGHSDSVLSVDSYQKVIVSGSADKTVKVW---------------------- 407
              ECI   + H  ++      + ++V G AD ++ VW                      
Sbjct: 94  DEVECIQVIKHHKHTITVFAVLKNLLVVGCADGSISVWSFIEDQYVLQEEFSVQKGVFPL 153

Query: 408 ----HVESRTCYTL------------------------------RGHTEWVNCVKLH--- 430
               H   +T + L                               GH +W+  +      
Sbjct: 154 CLSMHEIEKTQFILAIGGTNVNVFIYSLVSNSEGVSKLEFATKLEGHEDWIKSLVFRETV 213

Query: 431 PKSFSCFSCSDDTTIRMWDIRTN 453
           P  +   S S D  IR+W IRTN
Sbjct: 214 PGDYLLASGSQDRYIRLWRIRTN 236

>Kwal_34.15818
          Length = 349

 Score = 48.5 bits (114), Expect = 1e-05,   Method: Compositional matrix adjust.
 Identities = 59/266 (22%), Positives = 105/266 (39%), Gaps = 51/266 (19%)

Query: 338 LSGHSDGVKTLYFDDRK--LITGSLDKTIRVWNYITGECISTYRGHSDSVLS--VDSYQK 393
           L GH   +  + F+     + T + D    VW  I GE + T+ GH  ++ S  VD + +
Sbjct: 6   LKGHERSLTQVKFNREGDLIFTCAKDNVASVWYSINGERLGTFEGHQGTIWSIDVDQFTQ 65

Query: 394 VIVSGSADKTVKVWHVESRT-CYTLRGHTEWVNCVKLHPKSFSCFSCSDDTTIRMWDIRT 452
             V+GSAD ++K+W V+  T  +T +  T  V  V+  P                     
Sbjct: 66  YAVTGSADFSIKLWKVQDGTNVFTWKTKTP-VRRVQFSPSG------------------- 105

Query: 453 NSCLKVFRGHVGQVQKIIPLTIKDVENLATDNTSDGSSPQDDPTMTDGADESDTPSNEQE 512
           +  L V  G +G    +   T++                  DP   D  D S+ P+    
Sbjct: 106 DKILAVLDGVMGYPGSVTVYTVR-----------------RDPETKDIVDISEEPTFNIL 148

Query: 513 TVLDENIPY-------PTHLLSCGLDNTIKLWDVKTGKCIRTQFGHVEGVWDI--AADNF 563
           T     I          T++++   D  +  ++  +G+ I +   H + V DI  + D  
Sbjct: 149 TREGFEIAAVAAWSFNDTYIVAGHKDGRVSKYEGHSGEYIDSAALHTQNVSDIQFSPDGT 208

Query: 564 RIISGSHDGSIKVWDLQSGKCMHTFN 589
             I+ S D + K+ D ++ + + T+ 
Sbjct: 209 YFITSSRDSAAKLVDTETLEVLKTYE 234

 Score = 47.4 bits (111), Expect = 2e-05,   Method: Compositional matrix adjust.
 Identities = 28/96 (29%), Positives = 46/96 (47%), Gaps = 5/96 (5%)

Query: 525 LLSCGLDNTIKLWDVKTGKCIRTQFGHVEGVWDIAADNF--RIISGSHDGSIKVWDLQSG 582
           + +C  DN   +W    G+ + T  GH   +W I  D F    ++GS D SIK+W +Q G
Sbjct: 25  IFTCAKDNVASVWYSINGERLGTFEGHQGTIWSIDVDQFTQYAVTGSADFSIKLWKVQDG 84

Query: 583 KCMHTFNGRRLQRETQHTQTQSLGDKVAPIACVCIG 618
             + T+  +   R  Q + +   GDK+  +    +G
Sbjct: 85  TNVFTWKTKTPVRRVQFSPS---GDKILAVLDGVMG 117

 Score = 38.5 bits (88), Expect = 0.012,   Method: Compositional matrix adjust.
 Identities = 35/141 (24%), Positives = 63/141 (44%), Gaps = 16/141 (11%)

Query: 298 FKGHMDGVLTLQFNYR--LLFTGSYDSTIGIWDLFTGKLIRRLSGHSDGVKTLYFDD--R 353
            KGH   +  ++FN    L+FT + D+   +W    G+ +    GH   + ++  D   +
Sbjct: 6   LKGHERSLTQVKFNREGDLIFTCAKDNVASVWYSINGERLGTFEGHQGTIWSIDVDQFTQ 65

Query: 354 KLITGSLDKTIRVWNYITGECISTYRGHSDSVLSVDSYQKVIVSGSADKTVKVW-----H 408
             +TGS D +I++W    G  + T++  +         ++V  S S DK + V      +
Sbjct: 66  YAVTGSADFSIKLWKVQDGTNVFTWKTKT-------PVRRVQFSPSGDKILAVLDGVMGY 118

Query: 409 VESRTCYTLRGHTEWVNCVKL 429
             S T YT+R   E  + V +
Sbjct: 119 PGSVTVYTVRRDPETKDIVDI 139

>CAGL0L06952g complement(780793..781836) highly similar to sp|P40217
           Saccharomyces cerevisiae YMR146c TIF34 translation
           initiation factor eIF3, start by similarity
          Length = 347

 Score = 48.1 bits (113), Expect = 1e-05,   Method: Compositional matrix adjust.
 Identities = 23/67 (34%), Positives = 40/67 (59%), Gaps = 2/67 (2%)

Query: 525 LLSCGLDNTIKLWDVKTGKCIRTQFGHVEGVWDIAADNFRI--ISGSHDGSIKVWDLQSG 582
           L +C  D +  +W    G+ + T  GH+  +W I +D+  +  ++GS D +IKVW L +G
Sbjct: 25  LFTCSKDISASVWYSNNGERLGTLDGHMGSIWSIDSDHTSLYCVTGSADYTIKVWTLMNG 84

Query: 583 KCMHTFN 589
           +C+ T+N
Sbjct: 85  QCVQTWN 91

 Score = 45.4 bits (106), Expect = 8e-05,   Method: Compositional matrix adjust.
 Identities = 27/83 (32%), Positives = 44/83 (53%), Gaps = 4/83 (4%)

Query: 300 GHMDGVLTLQFNYR--LLFTGSYDSTIGIWDLFTGKLIRRLSGHSDGVKTLYFDDRKL-- 355
           GH   +  +++N    LLFT S D +  +W    G+ +  L GH   + ++  D   L  
Sbjct: 8   GHERPLTQVKYNREGDLLFTCSKDISASVWYSNNGERLGTLDGHMGSIWSIDSDHTSLYC 67

Query: 356 ITGSLDKTIRVWNYITGECISTY 378
           +TGS D TI+VW  + G+C+ T+
Sbjct: 68  VTGSADYTIKVWTLMNGQCVQTW 90

 Score = 41.2 bits (95), Expect = 0.002,   Method: Compositional matrix adjust.
 Identities = 50/211 (23%), Positives = 88/211 (41%), Gaps = 20/211 (9%)

Query: 355 LITGSLDKTIRVWNYITGECISTYRGHSDSVLSVDSYQKVI--VSGSADKTVKVWHVESR 412
           L T S D +  VW    GE + T  GH  S+ S+DS    +  V+GSAD T+KVW + + 
Sbjct: 25  LFTCSKDISASVWYSNNGERLGTLDGHMGSIWSIDSDHTSLYCVTGSADYTIKVWTLMNG 84

Query: 413 TCYTLRGHTEWVNCVKLHPKSFSCFSCSDDT-----TIRMWDIRTNSCLKVFRGHVGQ-V 466
            C         V  V+  P      +  D+      +I +++++ N         V + +
Sbjct: 85  QCVQTWNCPVPVKRVEFSPCGKYILAILDNVMKKPGSIEIYEVKRNPETNEITEFVEEPI 144

Query: 467 QKIIPLTIKDVENLA---------TDNTSDGSSPQDDPTMTDGADESDTPSNEQETVLDE 517
             I+     D  ++A              DG   + D    DG    ++    +++V D 
Sbjct: 145 HSIVTHEGLDAASVAGWSGEGKYIIAGHKDGKISKYD--TQDGYKLVESQQVHKDSVSDL 202

Query: 518 NI-PYPTHLLSCGLDNTIKLWDVKTGKCIRT 547
              P  T+ ++C  D+   + D++T K ++T
Sbjct: 203 QFSPDRTYFITCSRDSNAHIIDIETFKVLKT 233

>ADL322C [1419] [Homologous to ScYBR103W (SIF2) - SH]
           (128830..130335) [1506 bp, 501 aa]
          Length = 501

 Score = 48.5 bits (114), Expect = 1e-05,   Method: Compositional matrix adjust.
 Identities = 34/145 (23%), Positives = 68/145 (46%), Gaps = 10/145 (6%)

Query: 321 DSTIGIWDLFTGKLIRRLS------GHSDGVKTLYFDDRKLITGSLDKTIRVWNYITGEC 374
           D+   +W++ +G  ++  S        S GV   + D  K     +  +I V+N    + 
Sbjct: 256 DNMTIVWNVLSGTAVQHFSFKEAGTEESLGVDATWIDQDKFAIPGIQGSILVFNIGISKP 315

Query: 375 ISTYRGHSDSVLSV--DSYQKVIVSGSADKTVKVWHVES-RTCYTLRGHTEWVNCVKLHP 431
           I   RGHS ++ ++  + + K+++S S D T++VW   +    +   GH++ +       
Sbjct: 316 IGKLRGHSKTLTTIAYNEHNKLLLSASDDNTLRVWRGGNLNPSHVFYGHSQSITSAHWVD 375

Query: 432 KSFSCFSCSDDTTIRMWDIRTNSCL 456
              +  S S D +IR+W + +NS +
Sbjct: 376 DD-TIISTSMDGSIRVWSLASNSTV 399

 Score = 42.0 bits (97), Expect = 0.001,   Method: Compositional matrix adjust.
 Identities = 30/121 (24%), Positives = 60/121 (49%), Gaps = 5/121 (4%)

Query: 295 IQEFKGHMDGVLTLQFNY--RLLFTGSYDSTIGIWDLFTGKLIRRLSGHSDGVKTLYF-D 351
           I + +GH   + T+ +N   +LL + S D+T+ +W            GHS  + + ++ D
Sbjct: 316 IGKLRGHSKTLTTIAYNEHNKLLLSASDDNTLRVWRGGNLNPSHVFYGHSQSITSAHWVD 375

Query: 352 DRKLITGSLDKTIRVWNYITGECI--STYRGHSDSVLSVDSYQKVIVSGSADKTVKVWHV 409
           D  +I+ S+D +IRVW+  +   +  +T  G  +   ++   Q    +G+ D  V V+ +
Sbjct: 376 DDTIISTSMDGSIRVWSLASNSTVASATVDGVPNFTGALSPDQGKFATGTLDGEVMVYDI 435

Query: 410 E 410
           +
Sbjct: 436 Q 436

 Score = 42.0 bits (97), Expect = 0.001,   Method: Compositional matrix adjust.
 Identities = 39/158 (24%), Positives = 71/158 (44%), Gaps = 12/158 (7%)

Query: 315 LFTGSYDSTIGIWDLFTGKLIRRLSGHSDGVKTLYF--DDRKLITGSLDKTIRVWNYITG 372
           L TG     + +W +  GKL   LS H   +  + +  D+  ++T   D    VWN ++G
Sbjct: 209 LLTGVESGELRLWSV-EGKLQNILSYHRAPIVCIKWNSDETHVLTCDADNMTIVWNVLSG 267

Query: 373 ECISTY---RGHSDSVLSVDS----YQKVIVSGSADKTVKVWHVE-SRTCYTLRGHTEWV 424
             +  +      ++  L VD+      K  + G    ++ V+++  S+    LRGH++ +
Sbjct: 268 TAVQHFSFKEAGTEESLGVDATWIDQDKFAIPG-IQGSILVFNIGISKPIGKLRGHSKTL 326

Query: 425 NCVKLHPKSFSCFSCSDDTTIRMWDIRTNSCLKVFRGH 462
             +  +  +    S SDD T+R+W     +   VF GH
Sbjct: 327 TTIAYNEHNKLLLSASDDNTLRVWRGGNLNPSHVFYGH 364

 Score = 40.4 bits (93), Expect = 0.004,   Method: Compositional matrix adjust.
 Identities = 45/200 (22%), Positives = 81/200 (40%), Gaps = 18/200 (9%)

Query: 395 IVSGSADKTVKVWHVESRTCYTLRGHTEWVNCVKLHPKSFSCFSCSDDTTIRMWDIRTNS 454
           +++G     +++W VE +    L  H   + C+K +       +C  D    +W++ + +
Sbjct: 209 LLTGVESGELRLWSVEGKLQNILSYHRAPIVCIKWNSDETHVLTCDADNMTIVWNVLSGT 268

Query: 455 CLKVFRGHVGQVQKIIPL--TIKDVENLATDNTSDGSSPQDDPTMTDGADESDTPSNEQE 512
            ++ F       ++ + +  T  D +  A      GS    +  ++    +    S    
Sbjct: 269 AVQHFSFKEAGTEESLGVDATWIDQDKFAIPGI-QGSILVFNIGISKPIGKLRGHSKTLT 327

Query: 513 TVLDENIPYPTH---LLSCGLDNTIKLWDVKTGKCIRTQFGHVEGV----WDIAADNFRI 565
           T     I Y  H   LLS   DNT+++W           +GH + +    W    D+  I
Sbjct: 328 T-----IAYNEHNKLLLSASDDNTLRVWRGGNLNPSHVFYGHSQSITSAHW---VDDDTI 379

Query: 566 ISGSHDGSIKVWDLQSGKCM 585
           IS S DGSI+VW L S   +
Sbjct: 380 ISTSMDGSIRVWSLASNSTV 399

>KLLA0F15598g 1439610..1441046 highly similar to sp|P33750
           Saccharomyces cerevisiae YLL011w SOF1 involved in 18S
           pre-rRNA production singleton, start by similarity
          Length = 478

 Score = 48.1 bits (113), Expect = 1e-05,   Method: Compositional matrix adjust.
 Identities = 69/315 (21%), Positives = 127/315 (40%), Gaps = 48/315 (15%)

Query: 300 GHMDGVLTLQFNYRLL---FTGSYDSTIGIWDLFTGKLIRRLSGHSDGVKTL-----YFD 351
           GH DGV T+  NY +L    T S D  I  W++ T + +     H   V  L     Y  
Sbjct: 65  GHRDGVYTIAKNYNVLNKLATASGDGVIKYWNMSTREELSSFKAHYGMVTGLCVTPSYLS 124

Query: 352 DRK---LITGSLDKTIRVWNYITGE---------------CISTYRG-HSDSVLSVDSYQ 392
            ++   +++   DKT+++W+  + +                I T+ G H+   L     +
Sbjct: 125 PQRENFMLSCGDDKTVKLWSVNSDDFSNVKDDTRLNTDEGIIKTFHGEHAFQSLDHHRQK 184

Query: 393 KVIVSGSADKTVKVWHV-ESRTCYTLRGHTEWVNCVKLHPKSFSCF-SCSDDTTIRMWDI 450
              V+G A   +++W    S+    L    + +N V+ +        S   D ++ ++D+
Sbjct: 185 SNFVTGGAQ--IELWDTNRSKPISNLSWGADNINHVRFNQNEVDILASTGSDNSVVLYDL 242

Query: 451 RTNSCLKVFRGHVGQVQKIIPLTIKDVE--NLATDNTSDGSSPQDDPTMTDGADESDTPS 508
           RTNS  +     + Q  +   +    VE  N    N    +   D   M+          
Sbjct: 243 RTNSPTQ----KIVQTMRTNSICWNPVEAFNFVIANEDHNAYYYDMRNMSKALH---VFK 295

Query: 509 NEQETVLDENI-PYPTHLLSCGLDNTIKLWDVKTGKCIRTQFGHVEGVWDI-----AADN 562
           +    V+D +  P    +++   D TI+++ VK G     +  H + +  I       D+
Sbjct: 296 DHVSAVMDVDFSPTGDEVVTGSYDKTIRIYQVKHGHS--REIYHTKRMQHIFQVKYTMDS 353

Query: 563 FRIISGSHDGSIKVW 577
             I+SGS DG++++W
Sbjct: 354 KYIVSGSDDGNVRLW 368

 Score = 33.9 bits (76), Expect = 0.45,   Method: Compositional matrix adjust.
 Identities = 22/65 (33%), Positives = 35/65 (53%), Gaps = 11/65 (16%)

Query: 354 KLITGSLDKTIRVWNYITGECISTYRGHSDSV-------LSVDSYQKVIVSGSADKTVKV 406
           +++TGS DKTIR++    G     Y  H+  +        ++DS  K IVSGS D  V++
Sbjct: 312 EVVTGSYDKTIRIYQVKHGHSREIY--HTKRMQHIFQVKYTMDS--KYIVSGSDDGNVRL 367

Query: 407 WHVES 411
           W  ++
Sbjct: 368 WRAKA 372

>CAGL0J06512g complement(620516..622153) similar to sp|Q04199
           Saccharomyces cerevisiae YML102w CAC2, start by
           similarity
          Length = 545

 Score = 48.1 bits (113), Expect = 1e-05,   Method: Compositional matrix adjust.
 Identities = 26/89 (29%), Positives = 49/89 (55%), Gaps = 5/89 (5%)

Query: 351 DDRKLITGSLDKTIRVWNYITGECISTYRGHSDSVLSV--DSYQKVIVSGSADKTVKVWH 408
           DD+ L+T S+D +++V+N  TG C++  + H+  V  V  D   + I+S S D+++ ++ 
Sbjct: 163 DDKYLVTASMDNSLKVFNVDTGNCVAFAKDHNHYVQGVTWDPLNQYIISQSVDRSINIYE 222

Query: 409 VESRTCYTLRG---HTEWVNCVKLHPKSF 434
           +E R    +      TE +  +KL  + F
Sbjct: 223 IELRDSKDITSSTTSTELIKRLKLKNRIF 251

 Score = 38.1 bits (87), Expect = 0.019,   Method: Compositional matrix adjust.
 Identities = 23/65 (35%), Positives = 39/65 (60%), Gaps = 6/65 (9%)

Query: 520 PYPTHLLSCGLDNTIKLWDVKTGKCIRTQFGH---VEGV-WDIAADNFRIISGSHDGSIK 575
           P   +L++  +DN++K+++V TG C+     H   V+GV WD    N  IIS S D SI 
Sbjct: 162 PDDKYLVTASMDNSLKVFNVDTGNCVAFAKDHNHYVQGVTWDPL--NQYIISQSVDRSIN 219

Query: 576 VWDLQ 580
           +++++
Sbjct: 220 IYEIE 224

>Sklu_2416.5 YNL317W, Contig c2416 8692-10071
          Length = 459

 Score = 47.8 bits (112), Expect = 2e-05,   Method: Compositional matrix adjust.
 Identities = 46/204 (22%), Positives = 72/204 (35%), Gaps = 52/204 (25%)

Query: 351 DDRKLITGSLDKTIRVWNYITGECISTYRGHSDSVLSVDSYQKV---IVSGSADKTVKVW 407
           + R+L+  +      +WN  T    S  + H DS ++   Y      ++SG +D  +K+W
Sbjct: 92  EGRRLVVATYSGEFSLWNGSTFNFESIMQAH-DSAVTTMEYSHAGDWLISGDSDGIIKIW 150

Query: 408 HVESRTCYTL-RGHTEWVNCVKLHPKSFSCFSCSDDTTIRMWDIRTNSCLKVFRGHVGQV 466
                    L + H E V  V          +CSDD  +++W+       +V  GH   V
Sbjct: 151 QPNFNMVKVLDQAHMECVRDVSFSGTDSKFVTCSDDNILKIWNFSNGQQERVLSGHHWDV 210

Query: 467 QKIIPLTIKDVENLATDNTSDGSSPQDDPTMTDGADESDTPSNEQETVLDENIPYPTHLL 526
           +                      S    PTM                           ++
Sbjct: 211 K----------------------SCDWHPTM-------------------------GLIV 223

Query: 527 SCGLDNTIKLWDVKTGKCIRTQFG 550
           S   DN IKLWD ++G+CI T  G
Sbjct: 224 SGSKDNLIKLWDPRSGQCISTILG 247

 Score = 47.4 bits (111), Expect = 3e-05,   Method: Compositional matrix adjust.
 Identities = 25/73 (34%), Positives = 41/73 (56%), Gaps = 8/73 (10%)

Query: 525 LLSCGLDNTIKLWDVKTGKCIRTQFGHVEGVWDIAADNFR-----IISGSHDGSIKVWDL 579
            ++C  DN +K+W+   G+  R   GH    WD+ + ++      I+SGS D  IK+WD 
Sbjct: 180 FVTCSDDNILKIWNFSNGQQERVLSGHH---WDVKSCDWHPTMGLIVSGSKDNLIKLWDP 236

Query: 580 QSGKCMHTFNGRR 592
           +SG+C+ T  G +
Sbjct: 237 RSGQCISTILGFK 249

 Score = 47.0 bits (110), Expect = 3e-05,   Method: Compositional matrix adjust.
 Identities = 37/154 (24%), Positives = 59/154 (38%), Gaps = 5/154 (3%)

Query: 313 RLLFTGSYDSTIGIWDLFTGKLIRRLSGHSDGVKTLYFDDRK--LITGSLDKTIRVWNYI 370
           R L   +Y     +W+  T      +  H   V T+ +      LI+G  D  I++W   
Sbjct: 94  RRLVVATYSGEFSLWNGSTFNFESIMQAHDSAVTTMEYSHAGDWLISGDSDGIIKIWQPN 153

Query: 371 TGECISTYRGHSDSV--LSVDSYQKVIVSGSADKTVKVWHVES-RTCYTLRGHTEWVNCV 427
                   + H + V  +S        V+ S D  +K+W+  + +    L GH   V   
Sbjct: 154 FNMVKVLDQAHMECVRDVSFSGTDSKFVTCSDDNILKIWNFSNGQQERVLSGHHWDVKSC 213

Query: 428 KLHPKSFSCFSCSDDTTIRMWDIRTNSCLKVFRG 461
             HP      S S D  I++WD R+  C+    G
Sbjct: 214 DWHPTMGLIVSGSKDNLIKLWDPRSGQCISTILG 247

 Score = 44.3 bits (103), Expect = 3e-04,   Method: Compositional matrix adjust.
 Identities = 38/162 (23%), Positives = 82/162 (50%), Gaps = 11/162 (6%)

Query: 299 KGHMDGVLTLQFNY--RLLFTGSYDSTIGIWDLFTGKLIRRLSGHSDGVKTLYFDDRK-- 354
           + HM+ V  + F+       T S D+ + IW+   G+  R LSGH   VK+  +      
Sbjct: 162 QAHMECVRDVSFSGTDSKFVTCSDDNILKIWNFSNGQQERVLSGHHWDVKSCDWHPTMGL 221

Query: 355 LITGSLDKTIRVWNYITGECISTYRGHSDSVLSVD---SYQKVIVSGSADKTVKVWHVES 411
           +++GS D  I++W+  +G+CIST  G   +++      +   ++   + DK+ K++ +  
Sbjct: 222 IVSGSKDNLIKLWDPRSGQCISTILGFKHTIIKTKFQPTKGNLLAVVAKDKSCKIFDIRQ 281

Query: 412 --RTCYTLRGHTEWVNCVKLHPKSFSCFSCS-DDTTIRMWDI 450
             +   + R  +++++ +  HP + S F+    D +++ +D+
Sbjct: 282 NMKELKSFRDESDYMS-LTWHPINESIFTVGCYDGSLKHFDL 322

>CAGL0J04818g 455846..457810 highly similar to sp|Q06440
           Saccharomyces cerevisiae YLR429w CRN1, start by
           similarity
          Length = 654

 Score = 48.1 bits (113), Expect = 2e-05,   Method: Compositional matrix adjust.
 Identities = 49/190 (25%), Positives = 84/190 (44%), Gaps = 30/190 (15%)

Query: 298 FKGHMDGVLTLQFNY---RLLFTGSYDSTIGIWDLFTGKLIRRLSGHSDGVKTLYFDDRK 354
           F+GH   VL   F+      + + S D  IGIWD+     I + SG ++ +K +  +  K
Sbjct: 77  FRGHTAQVLDTDFDPFDDNRVASSSDDGKIGIWDIPQDYSILK-SGDNEEIKDI--EPTK 133

Query: 355 LITGSLDKTIRVWNYITGECISTYRGHSDSVLSVDSYQKVIVSGSADKTVKVWHVES-RT 413
            +TG   K                 GH   +L   + + V+ S S D TV++W+VE+   
Sbjct: 134 FLTGHSRKV----------------GH---ILYHPTAKDVLASSSLDYTVRIWNVETGED 174

Query: 414 CYTLRGHTEWVNCVKLHPKSFSCFSCSDDTTIRMWDIRTNSCLKVFRGHVG-QVQKIIPL 472
            Y L+ H + V  +          + + D  +R+W++R    +     H G + Q+++ L
Sbjct: 175 IYKLK-HPDMVTSMSFSYDGTHLATVARDKKLRVWNVREEKVVSEGAAHAGAKNQRVVWL 233

Query: 473 TIKDVENLAT 482
              + E LAT
Sbjct: 234 G--NSERLAT 241

 Score = 31.6 bits (70), Expect = 2.1,   Method: Compositional matrix adjust.
 Identities = 17/63 (26%), Positives = 35/63 (55%), Gaps = 3/63 (4%)

Query: 525 LLSCGLDNTIKLWDVKTGKCIRTQFGHVEGV--WDIAADNFRIISGSHDGSIKVWDLQSG 582
           L S  LD T+++W+V+TG+ I  +  H + V     + D   + + + D  ++VW+++  
Sbjct: 155 LASSSLDYTVRIWNVETGEDIY-KLKHPDMVTSMSFSYDGTHLATVARDKKLRVWNVREE 213

Query: 583 KCM 585
           K +
Sbjct: 214 KVV 216

>YMR146C (TIF34) [4102] chr13 complement(557480..558523) Translation
           initiation factor eIF3, p39 subunit, contains two WD
           (WD-40) repeats [1044 bp, 347 aa]
          Length = 347

 Score = 47.4 bits (111), Expect = 2e-05,   Method: Compositional matrix adjust.
 Identities = 24/66 (36%), Positives = 38/66 (57%), Gaps = 2/66 (3%)

Query: 525 LLSCGLDNTIKLWDVKTGKCIRTQFGHVEGVWDIAADNF--RIISGSHDGSIKVWDLQSG 582
           L SC  D++  +W    G+ + T  GH   +W I  D F    ++GS D SIK+WD+ +G
Sbjct: 25  LFSCSKDSSASVWYSLNGERLGTLDGHTGTIWSIDVDCFTKYCVTGSADYSIKLWDVSNG 84

Query: 583 KCMHTF 588
           +C+ T+
Sbjct: 85  QCVATW 90

 Score = 45.4 bits (106), Expect = 7e-05,   Method: Compositional matrix adjust.
 Identities = 24/84 (28%), Positives = 48/84 (57%), Gaps = 4/84 (4%)

Query: 300 GHMDGVLTLQFNYR--LLFTGSYDSTIGIWDLFTGKLIRRLSGHSDGVKTLYFD--DRKL 355
           GH   +  +++N    LLF+ S DS+  +W    G+ +  L GH+  + ++  D   +  
Sbjct: 8   GHERPLTQVKYNKEGDLLFSCSKDSSASVWYSLNGERLGTLDGHTGTIWSIDVDCFTKYC 67

Query: 356 ITGSLDKTIRVWNYITGECISTYR 379
           +TGS D +I++W+   G+C++T++
Sbjct: 68  VTGSADYSIKLWDVSNGQCVATWK 91

 Score = 45.1 bits (105), Expect = 1e-04,   Method: Compositional matrix adjust.
 Identities = 26/82 (31%), Positives = 45/82 (54%), Gaps = 4/82 (4%)

Query: 337 RLSGHSDGVKTLYFDDRK--LITGSLDKTIRVWNYITGECISTYRGHSDSVLS--VDSYQ 392
           +L+GH   +  + ++     L + S D +  VW  + GE + T  GH+ ++ S  VD + 
Sbjct: 5   KLTGHERPLTQVKYNKEGDLLFSCSKDSSASVWYSLNGERLGTLDGHTGTIWSIDVDCFT 64

Query: 393 KVIVSGSADKTVKVWHVESRTC 414
           K  V+GSAD ++K+W V +  C
Sbjct: 65  KYCVTGSADYSIKLWDVSNGQC 86

 Score = 34.3 bits (77), Expect = 0.26,   Method: Compositional matrix adjust.
 Identities = 21/86 (24%), Positives = 40/86 (46%), Gaps = 10/86 (11%)

Query: 394 VIVSGSADKTVKVWH-VESRTCYTLRGHTEWVNCVKLHPKSFSCFSCSDDTTIRMWDIRT 452
           ++ S S D +  VW+ +      TL GHT  +  + +   +  C + S D +I++WD+  
Sbjct: 24  LLFSCSKDSSASVWYSLNGERLGTLDGHTGTIWSIDVDCFTKYCVTGSADYSIKLWDVSN 83

Query: 453 NSCLKVFRGHVGQVQKIIPLTIKDVE 478
             C+  ++          P+ +K VE
Sbjct: 84  GQCVATWKS---------PVPVKRVE 100

 Score = 29.6 bits (65), Expect = 7.4,   Method: Compositional matrix adjust.
 Identities = 16/53 (30%), Positives = 23/53 (43%)

Query: 417 LRGHTEWVNCVKLHPKSFSCFSCSDDTTIRMWDIRTNSCLKVFRGHVGQVQKI 469
           L GH   +  VK + +    FSCS D++  +W       L    GH G +  I
Sbjct: 6   LTGHERPLTQVKYNKEGDLLFSCSKDSSASVWYSLNGERLGTLDGHTGTIWSI 58

>KLLA0E04741g 428278..429657 similar to sp|P20053 Saccharomyces
           cerevisiae YPR178w PRP4 U4/U6 snRNP 52 KD protein, start
           by similarity
          Length = 459

 Score = 47.8 bits (112), Expect = 2e-05,   Method: Compositional matrix adjust.
 Identities = 22/64 (34%), Positives = 40/64 (62%), Gaps = 2/64 (3%)

Query: 527 SCGLDNTIKLWDVKTGKCIRTQFGHVEGVW--DIAADNFRIISGSHDGSIKVWDLQSGKC 584
           + GLD    +WD+++GK I +  GH + ++  D + + +++ SGS DG+IKVWD++    
Sbjct: 322 TAGLDAIALIWDIRSGKNIMSLQGHSKPIYSVDWSQNGYQLASGSGDGTIKVWDIRKKGN 381

Query: 585 MHTF 588
           + T 
Sbjct: 382 VETI 385

 Score = 46.6 bits (109), Expect = 4e-05,   Method: Compositional matrix adjust.
 Identities = 36/153 (23%), Positives = 65/153 (42%), Gaps = 15/153 (9%)

Query: 332 GKLIRRLSGHSDGVKTLYFDDRKLI------------TGSLDKTIRVWNYITGECISTYR 379
           G+++   SG    VK LY +D +              + S DKT  + + +    I    
Sbjct: 243 GRIVIYDSGDETTVKILYKNDARFAQVRCHPCNSFIGSTSFDKTWILIDTVKQAPILIQE 302

Query: 380 GHSDSVLSVDSYQ--KVIVSGSADKTVKVWHVES-RTCYTLRGHTEWVNCVKLHPKSFSC 436
           GHS  V S+  +    ++ +   D    +W + S +   +L+GH++ +  V      +  
Sbjct: 303 GHSAEVFSLSFHNDGSLVSTAGLDAIALIWDIRSGKNIMSLQGHSKPIYSVDWSQNGYQL 362

Query: 437 FSCSDDTTIRMWDIRTNSCLKVFRGHVGQVQKI 469
            S S D TI++WDIR    ++    H   V ++
Sbjct: 363 ASGSGDGTIKVWDIRKKGNVETILAHNSIVSQV 395

 Score = 43.5 bits (101), Expect = 5e-04,   Method: Compositional matrix adjust.
 Identities = 33/122 (27%), Positives = 57/122 (46%), Gaps = 9/122 (7%)

Query: 295 IQEFKGHMDGVLTLQF--NYRLLFTGSYDSTIGIWDLFTGKLIRRLSGHSDGVKTLYFDD 352
           I   +GH   + ++ +  N   L +GS D TI +WD+     +  +  H+  V  + F+ 
Sbjct: 340 IMSLQGHSKPIYSVDWSQNGYQLASGSGDGTIKVWDIRKKGNVETILAHNSIVSQVKFNK 399

Query: 353 RK---LITGSLDKTIRVWNYITGECIS--TYRGHSDSVLSVDSYQKVIVSGSADKTVKVW 407
           +    L++   DK + ++N   G  I   +  GH D V+S+D     I S   D++V  W
Sbjct: 400 QNGGYLVSSGYDKKVNIFN--DGNWIKERSLEGHLDKVMSIDIVGPDIYSAGWDRSVNKW 457

Query: 408 HV 409
            V
Sbjct: 458 GV 459

>Scas_660.7*
          Length = 603

 Score = 47.8 bits (112), Expect = 2e-05,   Method: Compositional matrix adjust.
 Identities = 34/126 (26%), Positives = 63/126 (50%), Gaps = 15/126 (11%)

Query: 321 DSTIGIWDLFTGKLIRRLSGHSDGVKTLYF-----DDRKLITGSLDKTIRVWNYITGECI 375
           D  I  +D  TG+ ++ +   S+ ++   F     D+ K +T S D TIRVW+  + +C+
Sbjct: 214 DRKINCFDSKTGEFVKSIVDESEPIQGGIFALSWIDENKFVTASADATIRVWDVNSSKCV 273

Query: 376 STY---RGHSDSVLS------VDSYQKVIVSGSADKTVKVWHVESRTCYT-LRGHTEWVN 425
             +       D+VL       V S +  IVS S D T+ ++ +E     T ++GH++ + 
Sbjct: 274 QKWVVTSSSDDNVLRDQQVGVVASQEGRIVSLSLDGTLNIFQLEQDNIITSIKGHSKGIT 333

Query: 426 CVKLHP 431
            + ++P
Sbjct: 334 ALAVNP 339

 Score = 36.6 bits (83), Expect = 0.067,   Method: Compositional matrix adjust.
 Identities = 19/66 (28%), Positives = 37/66 (56%), Gaps = 5/66 (7%)

Query: 526 LSCGLDNTIKLWDVKTGKCIRTQFGHVE----GVWDIA-ADNFRIISGSHDGSIKVWDLQ 580
           ++ G D  I  +D KTG+ +++     E    G++ ++  D  + ++ S D +I+VWD+ 
Sbjct: 209 ITVGSDRKINCFDSKTGEFVKSIVDESEPIQGGIFALSWIDENKFVTASADATIRVWDVN 268

Query: 581 SGKCMH 586
           S KC+ 
Sbjct: 269 SSKCVQ 274

 Score = 35.0 bits (79), Expect = 0.20,   Method: Compositional matrix adjust.
 Identities = 19/57 (33%), Positives = 33/57 (57%), Gaps = 2/57 (3%)

Query: 314 LLFTGSYDSTIGIWDL-FTGKLIRRLSGHSDGVKTLYFDDRK-LITGSLDKTIRVWN 368
           L+ TGS D+ I ++ +    K+I+RL+ H DG+  L ++D   L++   D  I+ W 
Sbjct: 543 LVATGSLDTNIFVYSIKRPMKIIKRLNAHKDGISALLWEDASTLVSTGADACIKKWG 599

 Score = 34.7 bits (78), Expect = 0.28,   Method: Compositional matrix adjust.
 Identities = 24/111 (21%), Positives = 54/111 (48%), Gaps = 11/111 (9%)

Query: 315 LFTGSYDSTIGIWDLFTGKLIRR--LSGHSDG-------VKTLYFDDRKLITGSLDKTIR 365
             T S D+TI +WD+ + K +++  ++  SD        V  +   + ++++ SLD T+ 
Sbjct: 253 FVTASADATIRVWDVNSSKCVQKWVVTSSSDDNVLRDQQVGVVASQEGRIVSLSLDGTLN 312

Query: 366 VWNYITGECISTYRGHSDSVLSVDSYQKVIVSGSADKTVKVWHVESRTCYT 416
           ++       I++ +GHS  + ++      +++GS D  +  W  +    +T
Sbjct: 313 IFQLEQDNIITSIKGHSKGITAL--AVNPLITGSYDGKIMDWSNKPEVAHT 361

 Score = 33.5 bits (75), Expect = 0.52,   Method: Compositional matrix adjust.
 Identities = 26/88 (29%), Positives = 43/88 (48%), Gaps = 10/88 (11%)

Query: 319 SYDSTIGIWDLFTGKLIRRLSGHSDGVKTLYFDDRKLITGSLDKTIRVWNYITGECISTY 378
           S D T+ I+ L    +I  + GHS G+  L  +   LITGS D  I  W   + +    +
Sbjct: 306 SLDGTLNIFQLEQDNIITSIKGHSKGITALAVN--PLITGSYDGKIMDW---SNKPEVAH 360

Query: 379 RGHSDSVLSVDSYQKVIVSGSADKTVKV 406
             H++ ++S+D     + +G AD+   V
Sbjct: 361 TKHNNLIVSID-----VQTGKADQISSV 383

 Score = 32.7 bits (73), Expect = 0.92,   Method: Compositional matrix adjust.
 Identities = 33/140 (23%), Positives = 58/140 (41%), Gaps = 42/140 (30%)

Query: 438 SCSDDTTIRMWDIRTNSCLKVFRGHVGQVQKIIPLTIKDVENLATDNTSDGSSPQDDPTM 497
           + S D TIR+WD+ ++ C          VQK +                  +S  DD  +
Sbjct: 255 TASADATIRVWDVNSSKC----------VQKWVV-----------------TSSSDDNVL 287

Query: 498 TDGADESDTPSNEQETVLDENIPYPTHLLSCGLDNTIKLWDVKTGKCIRTQFGHVEGVWD 557
            D          +Q  V+         ++S  LD T+ ++ ++    I +  GH +G+  
Sbjct: 288 RD----------QQVGVVASQ---EGRIVSLSLDGTLNIFQLEQDNIITSIKGHSKGITA 334

Query: 558 IAADNFRIISGSHDGSIKVW 577
           +A +   +I+GS+DG I  W
Sbjct: 335 LAVN--PLITGSYDGKIMDW 352

 Score = 32.7 bits (73), Expect = 1.1,   Method: Compositional matrix adjust.
 Identities = 21/85 (24%), Positives = 40/85 (47%), Gaps = 14/85 (16%)

Query: 515 LDENIPYPTHLLSCGLDNTIKLWDVKTGKCIRT---------QFGHVEGVWDIAADNFRI 565
           +DEN       ++   D TI++WDV + KC++               + V  +A+   RI
Sbjct: 248 IDEN-----KFVTASADATIRVWDVNSSKCVQKWVVTSSSDDNVLRDQQVGVVASQEGRI 302

Query: 566 ISGSHDGSIKVWDLQSGKCMHTFNG 590
           +S S DG++ ++ L+    + +  G
Sbjct: 303 VSLSLDGTLNIFQLEQDNIITSIKG 327

>Scas_721.128
          Length = 851

 Score = 47.8 bits (112), Expect = 2e-05,   Method: Compositional matrix adjust.
 Identities = 28/87 (32%), Positives = 41/87 (47%), Gaps = 2/87 (2%)

Query: 375 ISTYRGHSDSVLSVD-SYQKVIVSGSADKTVKVWHVESRTCYTLRGHTEWVNCVKLHPKS 433
           +  Y+ HS  +L +D S    +++ S DK V +WH +  T      H ++V  V+ HPK 
Sbjct: 260 VRIYKEHSHDILDLDWSKNNFLLTASMDKLVSLWHPDRETSLKSFPHPDFVTSVRFHPKD 319

Query: 434 FSCF-SCSDDTTIRMWDIRTNSCLKVF 459
              F S   D   RMW I  N  +  F
Sbjct: 320 DRFFVSGCLDHKCRMWSILENKVVYEF 346

 Score = 34.3 bits (77), Expect = 0.35,   Method: Compositional matrix adjust.
 Identities = 45/205 (21%), Positives = 77/205 (37%), Gaps = 40/205 (19%)

Query: 295 IQEFKGHMDGVLTLQFNYR-LLFTGSYDSTIGIWDLFTGKLIRRLSGHSDGVKTLYF--- 350
           ++ +K H   +L L ++    L T S D  + +W       ++    H D V ++ F   
Sbjct: 260 VRIYKEHSHDILDLDWSKNNFLLTASMDKLVSLWHPDRETSLKSFP-HPDFVTSVRFHPK 318

Query: 351 DDRKLITGSLDKTIRVW--------------NYITGECISTYRGHSDSVLSVDSYQKVIV 396
           DDR  ++G LD   R+W              + IT   IS   G    + + + Y   I+
Sbjct: 319 DDRFFVSGCLDHKCRMWSILENKVVYEFDCQDLITAISISPGVGEFTIIGTFNGY-ITIL 377

Query: 397 SGSADKTVKVWHVESRTCYTLRG----------------HTEWVNCVKL----HPKSFSC 436
           S    K +  +HV  +      G                H   V  ++L           
Sbjct: 378 STFELKPLYTFHVLDKHMQGNSGNDSSFKNLLGQNLKNHHGPRVTGLQLFLEKETDDLKL 437

Query: 437 FSCSDDTTIRMWDIRTNSCLKVFRG 461
              S D+ IR++D+  N  ++VF+G
Sbjct: 438 LVSSTDSRIRIFDLEKNKLIEVFKG 462

 Score = 30.8 bits (68), Expect = 4.4,   Method: Compositional matrix adjust.
 Identities = 13/48 (27%), Positives = 25/48 (52%)

Query: 561 DNFRIISGSHDGSIKVWDLQSGKCMHTFNGRRLQRETQHTQTQSLGDK 608
           D+ +++  S D  I+++DL+  K +  F G R      + Q  + GD+
Sbjct: 433 DDLKLLVSSTDSRIRIFDLEKNKLIEVFKGFRSGLSQHNAQLSNWGDQ 480

>Kwal_14.1235
          Length = 607

 Score = 47.4 bits (111), Expect = 3e-05,   Method: Compositional matrix adjust.
 Identities = 49/208 (23%), Positives = 90/208 (43%), Gaps = 39/208 (18%)

Query: 409 VESRTCYTLRGHTEWVNCVKLHPKSFSCFSCSDDTTIRMWDIRTNSCLKVFRGHVGQVQK 468
           +E    +  + HT  VN +KL+       S S D  +  WD+ +  C+  F+G   Q+  
Sbjct: 306 MEGHIAHYFKKHTSTVNQLKLNNDESRFISGSWDKQVLEWDLNSGECINEFKGSSAQISS 365

Query: 469 II--PL-TIKDVENLATDNTSDGSSPQDDPTM------------------TDGADESDTP 507
           +   PL +  ++++ +T++  D     DD  +                     A+ES   
Sbjct: 366 LEFRPLFSSVEIQDTSTEDDDDVQMKADDDDLDSLFGDEEEEEKRKAQEENTTAEESTKK 425

Query: 508 SNEQE-------TVLDENIPYPTHLLSCGLDNTIKLWD--VKTGKCIRTQFGHVEGVWDI 558
           S E+E       TV DEN    T L SC  + +I++WD  + +   ++   G     W +
Sbjct: 426 SPEEEISRSTLRTVFDEN----TFLGSC-TNGSIQIWDRRIASRPAMKLMRGPQTPPWCM 480

Query: 559 AA----DNFRIISGSHDGSIKVWDLQSG 582
           +A    D  R+ +G  + +++ +DL+ G
Sbjct: 481 SACWSTDGDRVYAGRRNATVEEYDLKIG 508

 Score = 37.4 bits (85), Expect = 0.035,   Method: Compositional matrix adjust.
 Identities = 18/63 (28%), Positives = 32/63 (50%), Gaps = 2/63 (3%)

Query: 329 LFTGKLIRRLSGHSDGVKTLYF--DDRKLITGSLDKTIRVWNYITGECISTYRGHSDSVL 386
              G +      H+  V  L    D+ + I+GS DK +  W+  +GECI+ ++G S  + 
Sbjct: 305 FMEGHIAHYFKKHTSTVNQLKLNNDESRFISGSWDKQVLEWDLNSGECINEFKGSSAQIS 364

Query: 387 SVD 389
           S++
Sbjct: 365 SLE 367

 Score = 36.2 bits (82), Expect = 0.087,   Method: Compositional matrix adjust.
 Identities = 16/34 (47%), Positives = 20/34 (58%)

Query: 561 DNFRIISGSHDGSIKVWDLQSGKCMHTFNGRRLQ 594
           D  R ISGS D  +  WDL SG+C++ F G   Q
Sbjct: 329 DESRFISGSWDKQVLEWDLNSGECINEFKGSSAQ 362

 Score = 32.7 bits (73), Expect = 1.0,   Method: Compositional matrix adjust.
 Identities = 21/66 (31%), Positives = 29/66 (43%), Gaps = 8/66 (12%)

Query: 293 CRIQE------FKGHMDGVLTLQFN--YRLLFTGSYDSTIGIWDLFTGKLIRRLSGHSDG 344
           CR  E      FK H   V  L+ N       +GS+D  +  WDL +G+ I    G S  
Sbjct: 303 CRFMEGHIAHYFKKHTSTVNQLKLNNDESRFISGSWDKQVLEWDLNSGECINEFKGSSAQ 362

Query: 345 VKTLYF 350
           + +L F
Sbjct: 363 ISSLEF 368

>Kwal_27.11126
          Length = 996

 Score = 47.8 bits (112), Expect = 3e-05,   Method: Compositional matrix adjust.
 Identities = 21/55 (38%), Positives = 37/55 (67%), Gaps = 2/55 (3%)

Query: 527 SCGLDNTIKLWDVKTGKCIRTQFGHVEGVWDIAA--DNFRIISGSHDGSIKVWDL 579
           SC  D +IKLWD+K+G+ + T +GH   +W++    ++ ++IS S D + +VWD+
Sbjct: 198 SCSDDRSIKLWDLKSGQLLSTAWGHTARIWNLLFFDNDSKVISVSEDCTCRVWDI 252

 Score = 42.0 bits (97), Expect = 0.001,   Method: Compositional matrix adjust.
 Identities = 37/150 (24%), Positives = 71/150 (47%), Gaps = 5/150 (3%)

Query: 344 GVKTLYFDDRKLI-TGSLDKTIRVWNYITGECISTYRGHSDSVLSVDSYQ--KVIVSGSA 400
           G  T+Y  D+  I  G++   + VW+  + + +  +  H  ++  V + +  K   S S 
Sbjct: 142 GTITVYSQDKVHINAGTVMDGVIVWDLESEQNLHHFTDHEGAIFFVTASKNGKYAASCSD 201

Query: 401 DKTVKVWHVES-RTCYTLRGHTEWVNCVKLHPKSFSCFSCSDDTTIRMWDIRTNSCLKVF 459
           D+++K+W ++S +   T  GHT  +  +          S S+D T R+WDI  ++ L   
Sbjct: 202 DRSIKLWDLKSGQLLSTAWGHTARIWNLLFFDNDSKVISVSEDCTCRVWDISEDNTLSQA 261

Query: 460 RGHVGQVQKII-PLTIKDVENLATDNTSDG 488
             H G + K +  L + +   +A  + +DG
Sbjct: 262 SVHEGHLLKSVWGLDVDNERMIAATSGNDG 291

 Score = 40.0 bits (92), Expect = 0.005,   Method: Compositional matrix adjust.
 Identities = 52/216 (24%), Positives = 84/216 (38%), Gaps = 51/216 (23%)

Query: 370 ITGECISTYRGHSDSVLSVDSYQKV-IVSGSADKTVKVWHVES-RTCYTLRGHTEWVNCV 427
           + GE    Y G     ++V S  KV I +G+    V VW +ES +  +    H   +  V
Sbjct: 132 VFGERSILYSG----TITVYSQDKVHINAGTVMDGVIVWDLESEQNLHHFTDHEGAIFFV 187

Query: 428 KLHPKSFSCFSCSDDTTIRMWDIRTNSCLKVFRGHVGQVQKIIPLTIKDVENLATDNTSD 487
                     SCSDD +I++WD+++   L    GH  ++  +          L  DN S 
Sbjct: 188 TASKNGKYAASCSDDRSIKLWDLKSGQLLSTAWGHTARIWNL----------LFFDNDSK 237

Query: 488 GSSPQDDPTMTDGADESDTPSNEQETVLDENIPYPTHLLSCGLDNTIKLWDVKTGKCIRT 547
             S  +D T                            +     DNT+    V  G  +++
Sbjct: 238 VISVSEDCT--------------------------CRVWDISEDNTLSQASVHEGHLLKS 271

Query: 548 QFGHVEGVWDIAADNFRIISGS--HDGSIKVWDLQS 581
                  VW +  DN R+I+ +  +DG IK+ DL++
Sbjct: 272 -------VWGLDVDNERMIAATSGNDGRIKLTDLKA 300

 Score = 38.1 bits (87), Expect = 0.022,   Method: Compositional matrix adjust.
 Identities = 28/101 (27%), Positives = 52/101 (51%), Gaps = 8/101 (7%)

Query: 321 DSTIGIWDLFTGKLIRRLSGHSDGV-KTLYFD-DRKLITGSLDKTIRVWNYITGECISTY 378
           D +I +WDL +G+L+    GH+  +   L+FD D K+I+ S D T RVW+      +S  
Sbjct: 202 DRSIKLWDLKSGQLLSTAWGHTARIWNLLFFDNDSKVISVSEDCTCRVWDISEDNTLSQA 261

Query: 379 RGHSDSVLS------VDSYQKVIVSGSADKTVKVWHVESRT 413
             H   +L       VD+ + +  +   D  +K+  +++++
Sbjct: 262 SVHEGHLLKSVWGLDVDNERMIAATSGNDGRIKLTDLKAKS 302

>Sklu_2423.1 YLR409C, Contig c2423 869-3703
          Length = 944

 Score = 47.4 bits (111), Expect = 3e-05,   Method: Compositional matrix adjust.
 Identities = 26/61 (42%), Positives = 36/61 (59%), Gaps = 2/61 (3%)

Query: 321 DSTIGIWDLFTGKLIRRLSGHSDGVKTLYF--DDRKLITGSLDKTIRVWNYITGECISTY 378
           D +I + D  T K++R+L GHS+ V    F  D R +++ SLD TIR W+  TG CI   
Sbjct: 570 DLSIVVIDAVTQKVVRQLWGHSNRVTAFDFSPDGRWIVSASLDSTIRTWDLPTGGCIDGV 629

Query: 379 R 379
           R
Sbjct: 630 R 630

 Score = 46.2 bits (108), Expect = 8e-05,   Method: Compositional matrix adjust.
 Identities = 38/159 (23%), Positives = 64/159 (40%), Gaps = 24/159 (15%)

Query: 316 FTGSYDSTIGIWDLFTGKLIRRLSGHSDGVKTLYFD--DRKLITGSLDKTIRVWNYITGE 373
           F GS +  IG+++L +G   ++   H   V  +  D  +RK+++  LD  I  +++    
Sbjct: 482 FVGSSEGGIGVYNLQSGLQRKKYRLHKKAVTGVAIDGMNRKMVSCGLDGLIGFYDFTKSA 541

Query: 374 CIS-----------TYRGHSD-SVLSVDSYQKVIVSGSADKTVKVWHVESRTCYTLRGHT 421
            +             Y   SD   +++D    V++     K V+           L GH+
Sbjct: 542 FLGKLQLDAPVTSMVYHRSSDLFAVALDDLSIVVIDAVTQKVVR----------QLWGHS 591

Query: 422 EWVNCVKLHPKSFSCFSCSDDTTIRMWDIRTNSCLKVFR 460
             V      P      S S D+TIR WD+ T  C+   R
Sbjct: 592 NRVTAFDFSPDGRWIVSASLDSTIRTWDLPTGGCIDGVR 630

 Score = 42.0 bits (97), Expect = 0.001,   Method: Compositional matrix adjust.
 Identities = 29/89 (32%), Positives = 46/89 (51%), Gaps = 6/89 (6%)

Query: 525 LLSCGLDN-TIKLWDVKTGKCIRTQFGHVEGV--WDIAADNFRIISGSHDGSIKVWDLQS 581
           L +  LD+ +I + D  T K +R  +GH   V  +D + D   I+S S D +I+ WDL +
Sbjct: 563 LFAVALDDLSIVVIDAVTQKVVRQLWGHSNRVTAFDFSPDGRWIVSASLDSTIRTWDLPT 622

Query: 582 GKCMHTFNGRRLQRETQHTQTQSLGDKVA 610
           G C+   +G RL     + +    GD +A
Sbjct: 623 GGCI---DGVRLDSVATNLKFSPNGDLLA 648

>KLLA0B12804g 1117475..1120033 weakly similar to sp|Q03177
           Saccharomyces cerevisiae YMR102c, hypothetical start
          Length = 852

 Score = 47.4 bits (111), Expect = 3e-05,   Method: Compositional matrix adjust.
 Identities = 26/76 (34%), Positives = 40/76 (52%), Gaps = 2/76 (2%)

Query: 377 TYRGHSDSVLSVD-SYQKVIVSGSADKTVKVWHVESRTCYTLRGHTEWVNCVKLHPKSFS 435
           T+  H+D +L +D S    I++GS DK+ K+WH    T      H+++V  V+ HP+   
Sbjct: 258 TFHEHTDDILDIDWSKNSFILTGSMDKSCKLWHCARPTSLKTFVHSDFVTAVRFHPEDDR 317

Query: 436 CF-SCSDDTTIRMWDI 450
            F S   D   R+W I
Sbjct: 318 FFLSACLDQKCRLWSI 333

 Score = 34.7 bits (78), Expect = 0.26,   Method: Compositional matrix adjust.
 Identities = 23/85 (27%), Positives = 40/85 (47%), Gaps = 5/85 (5%)

Query: 298 FKGHMDGVLTLQFNYR-LLFTGSYDSTIGIWDLFTGKLIRRLSGHSDGVKTLYF---DDR 353
           F  H D +L + ++    + TGS D +  +W       ++    HSD V  + F   DDR
Sbjct: 259 FHEHTDDILDIDWSKNSFILTGSMDKSCKLWHCARPTSLKTFV-HSDFVTAVRFHPEDDR 317

Query: 354 KLITGSLDKTIRVWNYITGECISTY 378
             ++  LD+  R+W+ +  + I  Y
Sbjct: 318 FFLSACLDQKCRLWSILEKQVIFEY 342

>CAGL0K03377g complement(306529..309465) similar to sp|Q03177
           Saccharomyces cerevisiae YMR102c, hypothetical start
          Length = 978

 Score = 47.4 bits (111), Expect = 3e-05,   Method: Compositional matrix adjust.
 Identities = 28/78 (35%), Positives = 37/78 (47%), Gaps = 2/78 (2%)

Query: 375 ISTYRGHSDSVLSVD-SYQKVIVSGSADKTVKVWHVESRTCYTLRGHTEWVNCVKLHPKS 433
           + TY+ H   VL +D S    ++S S DKT K+WH           H ++V CVK HP  
Sbjct: 405 VRTYKEHLHDVLDMDWSKNNFLISASMDKTAKLWHPSKMRSLKSFQHPDFVTCVKFHPTD 464

Query: 434 FSCF-SCSDDTTIRMWDI 450
              F S   D   R+W I
Sbjct: 465 DRFFISGCLDQKCRLWSI 482

 Score = 37.4 bits (85), Expect = 0.036,   Method: Compositional matrix adjust.
 Identities = 38/148 (25%), Positives = 62/148 (41%), Gaps = 15/148 (10%)

Query: 241 WGLP-------LLHMKRARIQQNSTGSSSNADIQTQTTRPWKVIYRERFKVESNWRKGHC 293
           WGL        L   K  R+QQN  GSS    + +   R       +  +  SN      
Sbjct: 341 WGLDSSIDSAHLTSAKSLRLQQNQHGSSHGGPLGSPAMRRDTFDNIDAKENSSNLYAPVF 400

Query: 294 R---IQEFKGHMDGVLTLQFNYR-LLFTGSYDSTIGIWDLFTGKLIRRLSGHSDGVKTLY 349
           +   ++ +K H+  VL + ++    L + S D T  +W     + ++    H D V  + 
Sbjct: 401 QPTPVRTYKEHLHDVLDMDWSKNNFLISASMDKTAKLWHPSKMRSLKSFQ-HPDFVTCVK 459

Query: 350 F---DDRKLITGSLDKTIRVWNYITGEC 374
           F   DDR  I+G LD+  R+W+ +  E 
Sbjct: 460 FHPTDDRFFISGCLDQKCRLWSILDDEV 487

>Kwal_33.15475
          Length = 783

 Score = 47.4 bits (111), Expect = 3e-05,   Method: Compositional matrix adjust.
 Identities = 65/306 (21%), Positives = 121/306 (39%), Gaps = 42/306 (13%)

Query: 333 KLIRRLSGHSDGVKTLYFDDRK-----LITGSLDKTIRVWNYITGECISTYRGHSDSVLS 387
           +L   L GH D VK + F +       L TGS D+ IR+W   T E I     +SD    
Sbjct: 189 QLAAELEGHEDWVKAMDFYEESPGNMLLATGSQDRYIRLWRIRTNELID----NSDE--- 241

Query: 388 VDSYQKVIVSGSADKTVKVWHVESRTCY--TLRGHTEWVNCVKLHPKSFSCFSCSDDTTI 445
            D ++  ++     K      ++    +   + GH +W++C+K H +     + + DT +
Sbjct: 242 -DEFKLNLLGNKQSKFFITPDLKVAINFDALIVGHDDWISCLKWHKERPQLLASTADTAV 300

Query: 446 RMWDIRTNSCLKVFRGHVGQVQKIIP---------------LTIKDVENLATDNTSDGSS 490
            +W+   +S + +    +G++                     T K+ +++ T N   GS 
Sbjct: 301 MVWEPDADSGVWICASRLGELSSKGASTATGSSGGFWSCSWFTHKNRDHILT-NGKTGSW 359

Query: 491 PQDDPTMTDGADESDTPSNEQETVLDENI-PYPTHLLSCGLDNTIKL-----WDVKTGKC 544
                   +G  +    +   + V D    P   ++L+  LD T +L     +D   G  
Sbjct: 360 RMWVSDELEGWKQQLAITGPTKAVTDVAWSPNGLYMLATSLDQTTRLISRCNYDANAGSW 419

Query: 545 IRTQFGHVEGVWDIAAD---NFRIISGSHDGSIKVWDLQSG--KCMHTFNGRRLQRETQH 599
                  + G   I  +   N R ISG  +  ++ +D   G  + +  F G  ++ E + 
Sbjct: 420 FEFARPQIHGYDMICVEPLSNTRFISGGDEKIMRSFDEPKGVAQLLQKFAGIGIENELEM 479

Query: 600 TQTQSL 605
            ++ SL
Sbjct: 480 PESASL 485

 Score = 37.0 bits (84), Expect = 0.057,   Method: Compositional matrix adjust.
 Identities = 27/104 (25%), Positives = 46/104 (44%), Gaps = 14/104 (13%)

Query: 395 IVSGSADKTVKVWH----VESRTCYTLRGHTEWVNCVKLHPKSFSCFSCSDDTTIRMWDI 450
           I++ +  KT+ +W            TL+GH   V CVK  P +    S S+D+ +R+W  
Sbjct: 26  ILAFAGGKTIALWKPLDPAHHGVYRTLKGHNAEVTCVKFVPGTNLMVSSSEDSQVRLWAF 85

Query: 451 RTN-----SCLKVFRGHVGQVQKIIPLTIKDVENLATDNTSDGS 489
                    C++V   H      I  L++  + N+ +   +DGS
Sbjct: 86  EEKDQDALKCVQVIDHH---KHTITSLSV--ISNILSVGCADGS 124

 Score = 34.7 bits (78), Expect = 0.25,   Method: Compositional matrix adjust.
 Identities = 29/126 (23%), Positives = 49/126 (38%), Gaps = 12/126 (9%)

Query: 314 LLFTGSYDSTIGIW---DLFTGKLIRRLSGHSDGVKTLYF--DDRKLITGSLDKTIRVWN 368
           L F G    TI +W   D     + R L GH+  V  + F      +++ S D  +R+W 
Sbjct: 27  LAFAGG--KTIALWKPLDPAHHGVYRTLKGHNAEVTCVKFVPGTNLMVSSSEDSQVRLWA 84

Query: 369 YITGE-----CISTYRGHSDSVLSVDSYQKVIVSGSADKTVKVWHVESRTCYTLRGHTEW 423
           +   +     C+     H  ++ S+     ++  G AD +V +W  E+     L      
Sbjct: 85  FEEKDQDALKCVQVIDHHKHTITSLSVISNILSVGCADGSVSLWLTENNQAILLHSFNLQ 144

Query: 424 VNCVKL 429
            N   L
Sbjct: 145 TNVYPL 150

>AAL157C [30] [Homologous to ScYLL011W (SOF1) - SH] (70077..71516)
           [1440 bp, 479 aa]
          Length = 479

 Score = 47.0 bits (110), Expect = 4e-05,   Method: Compositional matrix adjust.
 Identities = 65/298 (21%), Positives = 117/298 (39%), Gaps = 36/298 (12%)

Query: 329 LFTGKLIRRLS-GHSDGVKTL---YFDDRKLITGSLDKTIRVWNYITGECISTYRGHSDS 384
           +F    + +L  GH DG   L   Y    KL +GS D  ++ WN  T E + ++R H   
Sbjct: 53  MFAKPFVGQLGYGHRDGCYVLAKNYNVLNKLASGSADGVVKYWNMATREELCSFRAHYGL 112

Query: 385 V---------LSVDSYQKVIVSGSADKTVKVWHVESRTCYTLRGHTEWVNCVKLHP--KS 433
           V         LS       ++S   DKT+K+W V S    +++  T+ V+        K+
Sbjct: 113 VTGLCVTPTHLSPTKKDSFMLSCGDDKTIKLWSVNSDDFNSIKDDTKIVSDTGDGALLKT 172

Query: 434 F---SCFSCSDD-----------TTIRMWDIRTNSCLKVFRGHVGQVQKIIPLTIKDVEN 479
           F     F   D              I++WD+     L      V  V  +     ++ E+
Sbjct: 173 FYGEHAFQSIDHHRRNPNFVTGGAQIQLWDVNRKKPLSNLSWGVDNVSFV--RFNQNEED 230

Query: 480 LATDNTSDGSSPQDDPTMTDGADESDTPSNEQETVLDENIPYPTHLLSCGLDNTIKLWDV 539
           +     SD S    D  +   +         +   L  N   P +      D+    +D+
Sbjct: 231 ILASTGSDNSIVLYD--LRTNSPTQKVVQRMRTNALCWNPMEPFNFAIANEDHNAYYYDM 288

Query: 540 KT-GKCIRTQFGHVEGVWDI--AADNFRIISGSHDGSIKVWDLQSGKCMHTFNGRRLQ 594
           +   + +     HV  V D+  +     I++GS+D +I++++L+ G     ++ +R+Q
Sbjct: 289 RNMSRALHVFKDHVSAVMDVDFSPTGEEIVTGSYDKTIRIFNLKHGHSREVYHTKRMQ 346

 Score = 44.7 bits (104), Expect = 2e-04,   Method: Compositional matrix adjust.
 Identities = 72/329 (21%), Positives = 133/329 (40%), Gaps = 52/329 (15%)

Query: 300 GHMDGVLTLQFNYRLL---FTGSYDSTIGIWDLFTGKLIRRLSGHSDGVKTLYF------ 350
           GH DG   L  NY +L    +GS D  +  W++ T + +     H   V  L        
Sbjct: 65  GHRDGCYVLAKNYNVLNKLASGSADGVVKYWNMATREELCSFRAHYGLVTGLCVTPTHLS 124

Query: 351 ---DDRKLITGSLDKTIRVWNYIT------------------GECISTYRGHSDSVLSVD 389
               D  +++   DKTI++W+  +                  G  + T+ G   +  S+D
Sbjct: 125 PTKKDSFMLSCGDDKTIKLWSVNSDDFNSIKDDTKIVSDTGDGALLKTFYGEH-AFQSID 183

Query: 390 SYQKV--IVSGSADKTVKVWHVESRTCYT-LRGHTEWVNCVKLHPKSFSCF-SCSDDTTI 445
            +++    V+G A   +++W V  +   + L    + V+ V+ +        S   D +I
Sbjct: 184 HHRRNPNFVTGGAQ--IQLWDVNRKKPLSNLSWGVDNVSFVRFNQNEEDILASTGSDNSI 241

Query: 446 RMWDIRTNSCLKVFRGHVGQVQKIIPLTIKDVE--NLATDNTSDGSSPQDDPTMTDGADE 503
            ++D+RTNS  +     V Q  +   L    +E  N A  N    +   D   M+     
Sbjct: 242 VLYDLRTNSPTQ----KVVQRMRTNALCWNPMEPFNFAIANEDHNAYYYDMRNMSRALH- 296

Query: 504 SDTPSNEQETVLDENI-PYPTHLLSCGLDNTIKLWDVKTGKCIRT----QFGHVEGVWDI 558
                +    V+D +  P    +++   D TI+++++K G         +  HV  V   
Sbjct: 297 --VFKDHVSAVMDVDFSPTGEEIVTGSYDKTIRIFNLKHGHSREVYHTKRMQHVFQV-KF 353

Query: 559 AADNFRIISGSHDGSIKVWDLQSGKCMHT 587
             D+  I+SGS DG++++W  ++ +  H 
Sbjct: 354 TMDSKYIVSGSDDGNVRLWRAKAWERSHV 382

 Score = 33.1 bits (74), Expect = 0.73,   Method: Compositional matrix adjust.
 Identities = 26/105 (24%), Positives = 46/105 (43%), Gaps = 11/105 (10%)

Query: 496 TMTDGADESDTPSNEQETVLDENIPYPTHLLSCGLDNTIKLWDVKTGKCIRTQF------ 549
           T++  ADE     + QE+ L  N+    H      + T  L   K  +     F      
Sbjct: 5   TISRNADEYVPVKSTQESQLPRNLDPALHPFERAREYTKALTATKLERMFAKPFVGQLGY 64

Query: 550 GHVEGVWDIAADNFRII----SGSHDGSIKVWDLQSGKCMHTFNG 590
           GH +G + + A N+ ++    SGS DG +K W++ + + + +F  
Sbjct: 65  GHRDGCY-VLAKNYNVLNKLASGSADGVVKYWNMATREELCSFRA 108

>YLL011W (SOF1) [3408] chr12 (127522..128991) Protein component of
           U3 snoRNP (also called small subunit processome), which
           is required for 18S rRNA biogenesis, contains seven WD
           (WD-40) repeats [1470 bp, 489 aa]
          Length = 489

 Score = 47.0 bits (110), Expect = 4e-05,   Method: Compositional matrix adjust.
 Identities = 71/320 (22%), Positives = 128/320 (40%), Gaps = 51/320 (15%)

Query: 300 GHMDGVLTLQFNY---RLLFTGSYDSTIGIWDLFTGKLIRRLSGHSDGVKTL-----YFD 351
           GH DGV  +  NY     L TGS D  I  W++ T +       H   V  L      F 
Sbjct: 65  GHRDGVYAIAKNYGSLNKLATGSADGVIKYWNMSTREEFVSFKAHYGLVTGLCVTQPRFH 124

Query: 352 DRK--------LITGSLDKTIRVW---------------NYITGE--CISTYRGHSDSVL 386
           D+K        +++ S DKT+++W               + +T E   I T+ G S +  
Sbjct: 125 DKKPDLKSQNFMLSCSDDKTVKLWSINVDDYSNKNSSDNDSVTNEEGLIRTFDGES-AFQ 183

Query: 387 SVDSYQKVIVSGSADKTVKVWHVES-RTCYTLRGHTEWVNCVKLHPKSFSCF-SCSDDTT 444
            +DS+++     +    + +W V   +    L    + +  +K +        S   D +
Sbjct: 184 GIDSHRENSTFATGGAKIHLWDVNRLKPVSDLSWGADNITSLKFNQNETDILASTGSDNS 243

Query: 445 IRMWDIRTNSCLKVFRGHVGQVQKIIPLTIKDVE--NLATDNTSDGSSPQDDPTMTDGAD 502
           I ++D+RTNS  +     + Q  +   +    +E  N  T N    +   D   M + + 
Sbjct: 244 IVLYDLRTNSPTQ----KIVQTMRTNAICWNPMEAFNFVTANEDHNAYYYD---MRNLSR 296

Query: 503 ESDTPSNEQETVLDENI-PYPTHLLSCGLDNTIKLWDVKTGKCIR----TQFGHVEGVWD 557
             +   +    V+D +  P    +++   D +I+++    G         +  HV  V  
Sbjct: 297 SLNVFKDHVSAVMDVDFSPTGDEIVTGSYDKSIRIYKTNHGHSREIYHTKRMQHVFQV-K 355

Query: 558 IAADNFRIISGSHDGSIKVW 577
            + D+  IISGS DG++++W
Sbjct: 356 YSMDSKYIISGSDDGNVRLW 375

>AGL301C [4011] [Homologous to ScYER107C (GLE2) - SH]
           (137221..138306) [1086 bp, 361 aa]
          Length = 361

 Score = 46.6 bits (109), Expect = 4e-05,   Method: Compositional matrix adjust.
 Identities = 28/96 (29%), Positives = 55/96 (57%), Gaps = 8/96 (8%)

Query: 317 TGSYDSTIGIWDLFTGKLIRRLSGHSDGVKTLYF------DDRKLITGSLDKTIRVWNYI 370
           +G  D+ + ++D+ +G+  +++  H   V+ L F      +   ++TGS DKTI+ W+  
Sbjct: 94  SGGCDNILKLYDVASGQA-QQIGSHDSAVRALRFVQCGPSNQECIVTGSWDKTIKYWDMR 152

Query: 371 TGECISTYRGHSDSVLSVDSYQKVIVSGSADKTVKV 406
             + IST     + V ++DS QK++V G+A++ + V
Sbjct: 153 QPQPISTV-AMPERVYALDSKQKLLVVGTAERHIVV 187

 Score = 38.9 bits (89), Expect = 0.011,   Method: Compositional matrix adjust.
 Identities = 30/104 (28%), Positives = 49/104 (47%), Gaps = 12/104 (11%)

Query: 314 LLFTGSYDSTIGIWDLFTGKLIRRLS-GHSDGVKTLYF--DDRKLITGSLDKTIRVWNYI 370
           L    ++D+T+ IWD+  G    R    H   V T  +  D  K+ +G  D  +++++  
Sbjct: 48  LFSVAAWDNTVRIWDVQNGMTQGRAQYEHQAPVLTTRWSSDGTKVASGGCDNILKLYDVA 107

Query: 371 TGECISTYRGHSDSVLSV-------DSYQKVIVSGSADKTVKVW 407
           +G+      G  DS +          S Q+ IV+GS DKT+K W
Sbjct: 108 SGQAQQI--GSHDSAVRALRFVQCGPSNQECIVTGSWDKTIKYW 149

 Score = 36.2 bits (82), Expect = 0.072,   Method: Compositional matrix adjust.
 Identities = 19/59 (32%), Positives = 33/59 (55%), Gaps = 3/59 (5%)

Query: 531 DNTIKLWDVKTGKCI-RTQFGHVEGVWDI--AADNFRIISGSHDGSIKVWDLQSGKCMH 586
           DNT+++WDV+ G    R Q+ H   V     ++D  ++ SG  D  +K++D+ SG+   
Sbjct: 55  DNTVRIWDVQNGMTQGRAQYEHQAPVLTTRWSSDGTKVASGGCDNILKLYDVASGQAQQ 113

 Score = 33.1 bits (74), Expect = 0.68,   Method: Compositional matrix adjust.
 Identities = 23/76 (30%), Positives = 36/76 (47%), Gaps = 17/76 (22%)

Query: 523 THLLSCGLDNTIKLWDVKTGKCIRTQFGHVEGVWDIAADNFR-----------IISGSHD 571
           T + S G DN +KL+DV +G+  +       G  D A    R           I++GS D
Sbjct: 90  TKVASGGCDNILKLYDVASGQAQQI------GSHDSAVRALRFVQCGPSNQECIVTGSWD 143

Query: 572 GSIKVWDLQSGKCMHT 587
            +IK WD++  + + T
Sbjct: 144 KTIKYWDMRQPQPIST 159

>CAGL0A00561g complement(63710..64948) similar to sp|P53196
           Saccharomyces cerevisiae YGL004c, hypothetical start
          Length = 412

 Score = 46.6 bits (109), Expect = 4e-05,   Method: Compositional matrix adjust.
 Identities = 26/72 (36%), Positives = 38/72 (52%), Gaps = 2/72 (2%)

Query: 519 IPYPTHLLSCGLDNTIKLWDVKTGKCIRTQFGHVEGVWD--IAADNFRIISGSHDGSIKV 576
            P    LLS   D  +K+W ++ G   RT  GH  G+ D  I      ++S S DGS+++
Sbjct: 150 FPSNAVLLSGSTDMQLKVWSLEDGSNPRTLKGHSAGITDTIIIERGRNVLSSSLDGSVRL 209

Query: 577 WDLQSGKCMHTF 588
           W+L SGK +  F
Sbjct: 210 WELGSGKTISKF 221

 Score = 43.5 bits (101), Expect = 4e-04,   Method: Compositional matrix adjust.
 Identities = 26/83 (31%), Positives = 46/83 (55%), Gaps = 4/83 (4%)

Query: 300 GHMDGVLTLQF--NYRLLFTGSYDSTIGIWDLFTGKLIRRLSGHSDGVK-TLYFD-DRKL 355
            H+  V T++   +  +L +GS D  + +W L  G   R L GHS G+  T+  +  R +
Sbjct: 139 AHVSDVTTVKIFPSNAVLLSGSTDMQLKVWSLEDGSNPRTLKGHSAGITDTIIIERGRNV 198

Query: 356 ITGSLDKTIRVWNYITGECISTY 378
           ++ SLD ++R+W   +G+ IS +
Sbjct: 199 LSSSLDGSVRLWELGSGKTISKF 221

 Score = 41.6 bits (96), Expect = 0.001,   Method: Compositional matrix adjust.
 Identities = 27/109 (24%), Positives = 52/109 (47%), Gaps = 3/109 (2%)

Query: 354 KLITGSLDKTIRVWNYITGECISTYRGHSDSVLSVDSY--QKVIVSGSADKTVKVWHVE- 410
           K++ G     I V+++     +S    H   V +V  +    V++SGS D  +KVW +E 
Sbjct: 113 KIVIGDSGGDINVYDHEWMSKLSLVGAHVSDVTTVKIFPSNAVLLSGSTDMQLKVWSLED 172

Query: 411 SRTCYTLRGHTEWVNCVKLHPKSFSCFSCSDDTTIRMWDIRTNSCLKVF 459
                TL+GH+  +    +  +  +  S S D ++R+W++ +   +  F
Sbjct: 173 GSNPRTLKGHSAGITDTIIIERGRNVLSSSLDGSVRLWELGSGKTISKF 221

 Score = 34.3 bits (77), Expect = 0.27,   Method: Compositional matrix adjust.
 Identities = 22/87 (25%), Positives = 39/87 (44%), Gaps = 1/87 (1%)

Query: 385 VLSVDSYQKVIVSGSADKTVKVWHVESRTCYTLRG-HTEWVNCVKLHPKSFSCFSCSDDT 443
           ++S D+    IV G +   + V+  E  +  +L G H   V  VK+ P +    S S D 
Sbjct: 104 LISCDASTDKIVIGDSGGDINVYDHEWMSKLSLVGAHVSDVTTVKIFPSNAVLLSGSTDM 163

Query: 444 TIRMWDIRTNSCLKVFRGHVGQVQKII 470
            +++W +   S  +  +GH   +   I
Sbjct: 164 QLKVWSLEDGSNPRTLKGHSAGITDTI 190

>CAGL0K12188g 1191188..1192795 similar to sp|P38262 Saccharomyces
           cerevisiae YBR103w SIF2 SIR4P interacting protein, start
           by similarity
          Length = 535

 Score = 46.6 bits (109), Expect = 4e-05,   Method: Compositional matrix adjust.
 Identities = 31/102 (30%), Positives = 49/102 (48%), Gaps = 11/102 (10%)

Query: 525 LLSCGLDNTIKLWDVKTGKCIRTQFGHVEGVWDIA-ADNFRIISGSHDGSIKVWDLQSGK 583
           L S   DNTI++W    G  I   +GH + +  +   +N  +IS S DGS+K+WD     
Sbjct: 374 LASAADDNTIRVWHGGNGNSIHCFYGHTQTIVSLKWVNNDMLISASMDGSVKLWD----- 428

Query: 584 CMHTFNGRRLQRETQHTQTQSLGDKVAPIACVCIGDSECFSG 625
           C     G++LQ  T +   +++ D V   A     D E ++ 
Sbjct: 429 C-----GKKLQEITGNLIAETIVDGVPIFAGAISDDRERYAA 465

 Score = 39.7 bits (91), Expect = 0.006,   Method: Compositional matrix adjust.
 Identities = 26/91 (28%), Positives = 48/91 (52%), Gaps = 9/91 (9%)

Query: 295 IQEFKGHMDGVLTLQFN--YRLLFTGSYDSTIGIWDLFTGKLIRRLSGHSDGVKTL-YFD 351
           I +  GH   +  L+FN   +LL + + D+TI +W    G  I    GH+  + +L + +
Sbjct: 352 IGKLVGHRGTISQLEFNSETKLLASAADDNTIRVWHGGNGNSIHCFYGHTQTIVSLKWVN 411

Query: 352 DRKLITGSLDKTIRVWN------YITGECIS 376
           +  LI+ S+D ++++W+       ITG  I+
Sbjct: 412 NDMLISASMDGSVKLWDCGKKLQEITGNLIA 442

 Score = 32.3 bits (72), Expect = 1.2,   Method: Compositional matrix adjust.
 Identities = 33/173 (19%), Positives = 70/173 (40%), Gaps = 21/173 (12%)

Query: 317 TGSYDSTIGIWDLFTGKLIRRLSGHSDGVKTLYFD--DRKLITGSLDKTIRVWNYITGEC 374
           TG  +  + +W+   GKL    + H   +  ++++  +   I+   D    +W+  +G  
Sbjct: 239 TGVENGELRLWNK-EGKLQNVFNFHKSPIIAIHWNSSNTHFISTDADNITILWDVNSGVV 297

Query: 375 ISTYRGHSDS-----------VLSVDSY----QKVIVSGSADKTVKVWHVESRTCYTLRG 419
           +  +   ++            +  VD+      K ++ G     +     +SR    L G
Sbjct: 298 LQHFESKANQINGNNNNNSNQMFGVDTVWVDTDKFVIPGPGGNLLVYTMSDSRPIGKLVG 357

Query: 420 HTEWVNCVKLHPKSFSCFSCSDDTTIRMWDIRTNSCLKVFRGHVGQVQKIIPL 472
           H   ++ ++ + ++    S +DD TIR+W     + +  F GH    Q I+ L
Sbjct: 358 HRGTISQLEFNSETKLLASAADDNTIRVWHGGNGNSIHCFYGH---TQTIVSL 407

>Scas_605.18
          Length = 424

 Score = 46.6 bits (109), Expect = 4e-05,   Method: Compositional matrix adjust.
 Identities = 55/259 (21%), Positives = 108/259 (41%), Gaps = 26/259 (10%)

Query: 334 LIRRLSGHSDGVKTLYF-DDRKLITGSLDKTIRVWNYITGECISTYRGHSDSVLSV---- 388
           ++    GH+  +  + F D+  +IT S D T  +W+    + +  Y  H   VL++    
Sbjct: 172 VVSIFKGHTCYISDIEFLDNSHIITSSGDMTCALWDIPKAKRVREYADHLGDVLALALPP 231

Query: 389 -----DSYQKVIVSGSADKTVKVWHVESRTCYTLR---GHTEWVNCVKLHPKSFSCFSCS 440
                ++   +  S  +D    +W  ++RT   ++        VN ++      S  +  
Sbjct: 232 PSADENTGANIFASCGSDGYTYIW--DTRTSAAVQKFFASDTDVNAIQFFKDGNSIVTGG 289

Query: 441 DDTTIRMWDIRTNSCLKVFRGHVGQVQKIIPLTIKDVENLATDNTSDGSSPQDDPTMTDG 500
           DD  I M+D+R++  +  +      +Q+ I   I+D   ++++      SPQ  P  T  
Sbjct: 290 DDGVINMFDLRSDCAIASY-----SLQQGIQKEIRDPTYMSSNMEYSRGSPQ-SPIST-- 341

Query: 501 ADESDTPSNEQETVLDENIPYPTHLLSCGLDNTIKLWDVKTGKCIRTQFGHVEGVWDI-- 558
           A  S    N+    LD +      + +C  D    +WDV   + +    GH   V  +  
Sbjct: 342 AISSSYLDNQGVVSLDFS-NSGRLMFACYTDLGCIIWDVLKAEIVGKLEGHSNRVSSVRT 400

Query: 559 AADNFRIISGSHDGSIKVW 577
           + D   + +GS D ++++W
Sbjct: 401 SPDGLGVCTGSWDSTMRIW 419

 Score = 43.5 bits (101), Expect = 4e-04,   Method: Compositional matrix adjust.
 Identities = 26/73 (35%), Positives = 42/73 (57%), Gaps = 6/73 (8%)

Query: 304 GVLTLQFNY--RLLFTGSYDSTIGIWDLFTGKLIRRLSGHSDGVKTLYF--DDRKLITGS 359
           GV++L F+   RL+F    D    IWD+   +++ +L GHS+ V ++    D   + TGS
Sbjct: 352 GVVSLDFSNSGRLMFACYTDLGCIIWDVLKAEIVGKLEGHSNRVSSVRTSPDGLGVCTGS 411

Query: 360 LDKTIRVW--NYI 370
            D T+R+W  NY+
Sbjct: 412 WDSTMRIWSPNYM 424

 Score = 40.4 bits (93), Expect = 0.004,   Method: Compositional matrix adjust.
 Identities = 58/272 (21%), Positives = 106/272 (38%), Gaps = 54/272 (19%)

Query: 338 LSGHSDGVKTLYF--DDRKLITGSLDKTIRVWNYITGECISTYRGHSDSVLSVDSYQKVI 395
           L GH++ +    +  D + +++ S D  + +W+  +G   +     S  VLS        
Sbjct: 87  LKGHNNKISDFRWSRDSKSILSASQDGFMLIWDTASGLKRNAIPLDSQWVLSCALSPSGN 146

Query: 396 VSGSAD--------KTVKVWHVESRTCYTLRGHTEWVNCVKLHPKSFSCFSCSDDTTIRM 447
           ++ SA         +  K   V+       +GHT +++ ++    S    + S D T  +
Sbjct: 147 LAASAGLNNNCTIYRVSKENRVQQNVVSIFKGHTCYISDIEFLDNSH-IITSSGDMTCAL 205

Query: 448 WDIRTNSCLKVFRGHVGQVQKIIPLTIKDVENLATDNTSDGSSPQDDPTMTDGADESDTP 507
           WDI     ++ +  H+G           DV  LA                         P
Sbjct: 206 WDIPKAKRVREYADHLG-----------DVLALALP----------------------PP 232

Query: 508 SNEQETVLDENIPYPTHLLSCGLDNTIKLWDVKTGKCIRTQFGHVEGVWDIA--ADNFRI 565
           S ++ T    NI       SCG D    +WD +T   ++  F     V  I    D   I
Sbjct: 233 SADENT--GANI-----FASCGSDGYTYIWDTRTSAAVQKFFASDTDVNAIQFFKDGNSI 285

Query: 566 ISGSHDGSIKVWDLQSGKCMHTFNGRR-LQRE 596
           ++G  DG I ++DL+S   + +++ ++ +Q+E
Sbjct: 286 VTGGDDGVINMFDLRSDCAIASYSLQQGIQKE 317

 Score = 31.2 bits (69), Expect = 2.4,   Method: Compositional matrix adjust.
 Identities = 47/200 (23%), Positives = 82/200 (41%), Gaps = 32/200 (16%)

Query: 409 VESRTCYTLRGHTEWVNCVKLHPKSFSCFSCSDDTTIRMWDIRTNSCLKVFRGHVGQVQK 468
           +  ++  TL+GH   ++  +    S S  S S D  + +WD  T S LK         + 
Sbjct: 79  INLQSTLTLKGHNNKISDFRWSRDSKSILSASQDGFMLIWD--TASGLK---------RN 127

Query: 469 IIPLTIKDVENLA---TDNTSDGSSPQDDPTMTDGADESDTPSN-----EQETVLDENIP 520
            IPL  + V + A   + N +  +   ++ T+   + E+    N     +  T    +I 
Sbjct: 128 AIPLDSQWVLSCALSPSGNLAASAGLNNNCTIYRVSKENRVQQNVVSIFKGHTCYISDIE 187

Query: 521 Y--PTHLLSCGLDNTIKLWDVKTGKCIRTQFGHVEGVWDIA-----AD-----NFRIISG 568
           +   +H+++   D T  LWD+   K +R    H+  V  +A     AD     N     G
Sbjct: 188 FLDNSHIITSSGDMTCALWDIPKAKRVREYADHLGDVLALALPPPSADENTGANIFASCG 247

Query: 569 SHDGSIKVWDLQSGKCMHTF 588
           S DG   +WD ++   +  F
Sbjct: 248 S-DGYTYIWDTRTSAAVQKF 266

>YMR102C (YMR102C) [4060] chr13 complement(469847..472351) Protein
           containing six WD domains (WD-40 repeat), which may
           mediate protein-protein interactions, has moderate
           similarity to S. cerevisiae Ykl121p, which binds
           phosphatidylinositol [2505 bp, 834 aa]
          Length = 834

 Score = 47.0 bits (110), Expect = 5e-05,   Method: Compositional matrix adjust.
 Identities = 27/75 (36%), Positives = 38/75 (50%), Gaps = 2/75 (2%)

Query: 378 YRGHSDSVLSVD-SYQKVIVSGSADKTVKVWHVESRTCYTLRGHTEWVNCVKLHPKSFSC 436
           Y+ H   VL ++ S    I+S S DKTVK+WH + +       H ++V CV+ HP     
Sbjct: 274 YKEHVQDVLDINWSKNNFILSASMDKTVKLWHPDRKNSLKTFIHPDFVTCVEFHPTDDRF 333

Query: 437 F-SCSDDTTIRMWDI 450
           F S   D   R+W I
Sbjct: 334 FISGCLDHKCRLWSI 348

 Score = 43.5 bits (101), Expect = 5e-04,   Method: Compositional matrix adjust.
 Identities = 49/212 (23%), Positives = 85/212 (40%), Gaps = 37/212 (17%)

Query: 298 FKGHMDGVLTLQFNYR-LLFTGSYDSTIGIWDLFTGKLIRRLSGHSDGVKTLYF---DDR 353
           +K H+  VL + ++    + + S D T+ +W       ++    H D V  + F   DDR
Sbjct: 274 YKEHVQDVLDINWSKNNFILSASMDKTVKLWHPDRKNSLKTFI-HPDFVTCVEFHPTDDR 332

Query: 354 KLITGSLDKTIRVW--------------NYITGECISTYRGHSDSVLSVDSYQKVIVSGS 399
             I+G LD   R+W              + IT   +S   G    + + + Y  ++++  
Sbjct: 333 FFISGCLDHKCRLWSILDDEVSFEYDCQDLITSVTLSPEEGKYTIIGTFNGYVHILMTRG 392

Query: 400 ADKTVKVWHVESRTCYTLRGH---TEWVNCVKLHPK-------------SFSCFSCSDDT 443
               V  +HV  R       H   TE  + ++  P+             SF     S+D+
Sbjct: 393 L-TPVSSFHVADRQTQEQNAHVMVTETDSKIRHGPRVTGLQAFRSQLDNSFRLVVTSNDS 451

Query: 444 TIRMWDIRTNSCLKVFRG-HVGQVQKIIPLTI 474
            IR++D+     L+V +G H G  Q    L+I
Sbjct: 452 RIRIFDLEQRKLLEVLKGFHSGSSQHKAQLSI 483

>CAGL0M09845g 975007..977817 highly similar to sp|Q06078
           Saccharomyces cerevisiae YLR409c, start by similarity
          Length = 936

 Score = 46.6 bits (109), Expect = 5e-05,   Method: Compositional matrix adjust.
 Identities = 38/155 (24%), Positives = 64/155 (41%), Gaps = 24/155 (15%)

Query: 316 FTGSYDSTIGIWDLFTGKLIRRLSGHSDGVKTLYFD--DRKLITGSLDKTIRVWNYITGE 373
           F GS +  IG++++ +G L ++   H   V  +  D  +RK+++  LD  I  +++   +
Sbjct: 474 FVGSSNGGIGVYNMQSGMLRKKYRLHKRAVTGVAVDGMNRKMVSCGLDGIIGFYDFNESK 533

Query: 374 CIS-----------TYRGHSD-SVLSVDSYQKVIVSGSADKTVKVWHVESRTCYTLRGHT 421
            +             Y   SD    ++D    V+V     K V+           L GH 
Sbjct: 534 YLGKLQMDAPITSMVYHRSSDLCAFALDDLSIVVVDTVTQKVVR----------QLWGHG 583

Query: 422 EWVNCVKLHPKSFSCFSCSDDTTIRMWDIRTNSCL 456
             +      P      S S D+TIR WD+ T SC+
Sbjct: 584 NRITAFDFSPDGRWLVSASLDSTIRTWDLPTGSCI 618

 Score = 37.7 bits (86), Expect = 0.028,   Method: Compositional matrix adjust.
 Identities = 24/90 (26%), Positives = 45/90 (50%), Gaps = 5/90 (5%)

Query: 531 DNTIKLWDVKTGKCIRTQFGHVEGV--WDIAADNFRIISGSHDGSIKVWDLQSGKCMHTF 588
           D +I + D  T K +R  +GH   +  +D + D   ++S S D +I+ WDL +G C+   
Sbjct: 562 DLSIVVVDTVTQKVVRQLWGHGNRITAFDFSPDGRWLVSASLDSTIRTWDLPTGSCI--- 618

Query: 589 NGRRLQRETQHTQTQSLGDKVAPIACVCIG 618
           +G +++    + +    GD +A    +  G
Sbjct: 619 DGVKIESVATNLKFSPNGDMLATTHVIGNG 648

 Score = 33.9 bits (76), Expect = 0.41,   Method: Compositional matrix adjust.
 Identities = 45/193 (23%), Positives = 69/193 (35%), Gaps = 51/193 (26%)

Query: 356 ITGSLDKTIRVWNYITGECISTYRGHSDSV--LSVDSYQKVIVSGSADKTVKVWHV-ESR 412
             GS +  I V+N  +G     YR H  +V  ++VD   + +VS   D  +  +   ES+
Sbjct: 474 FVGSSNGGIGVYNMQSGMLRKKYRLHKRAVTGVAVDGMNRKMVSCGLDGIIGFYDFNESK 533

Query: 413 TCYTLRGHTEWVNCVKLHPKSFSCFSCSDDTTIRMWDIRTNSCLKVFRGHVGQVQKIIPL 472
               L+      + V  H  S  C    DD +I + D  T   ++   GH  ++      
Sbjct: 534 YLGKLQMDAPITSMV-YHRSSDLCAFALDDLSIVVVDTVTQKVVRQLWGHGNRIT----- 587

Query: 473 TIKDVENLATDNTSDGSSPQDDPTMTDGADESDTPSNEQETVLDENIPYPTHLLSCGLDN 532
                   A D + DG                                    L+S  LD+
Sbjct: 588 --------AFDFSPDGR----------------------------------WLVSASLDS 605

Query: 533 TIKLWDVKTGKCI 545
           TI+ WD+ TG CI
Sbjct: 606 TIRTWDLPTGSCI 618

>CAGL0J10340g complement(1008637..1009653) highly similar to
           sp|P53011 Saccharomyces cerevisiae YGL100w SEH1 nuclear
           pore protein, start by similarity
          Length = 338

 Score = 45.8 bits (107), Expect = 5e-05,   Method: Compositional matrix adjust.
 Identities = 41/144 (28%), Positives = 66/144 (45%), Gaps = 24/144 (16%)

Query: 339 SGHSDGVKTLYFD--DRKLITGSLDKTIRVW----NYITGECISTYRGHSDSVLSVD--- 389
           +GH D V  + +D   R + T S D+ I+V+    +    E   ++R H  S++S+D   
Sbjct: 6   TGHEDIVHDVAYDFYGRTMATCSSDQHIKVFKLDKDATRWEVNDSWRAHDSSIVSLDWAS 65

Query: 390 -SYQKVIVSGSADKTVKVWHVE-----------SRTCYTLRGHTEWVNCVKLHPK--SFS 435
             Y ++I S S DKT+K+W  +           +R C TL      + CVK  P      
Sbjct: 66  PEYGRIIASASYDKTIKIWEEDPNQEECSGRRWTRLC-TLNDSKGSLYCVKFAPSHLGLR 124

Query: 436 CFSCSDDTTIRMWDIRTNSCLKVF 459
             S  +D  +RM+D    S L+ +
Sbjct: 125 IASIGNDGIMRMYDALDPSNLRSW 148

>CAGL0D05588g 533235..534668 highly similar to sp|P33750
           Saccharomyces cerevisiae YLL011w SOF1, start by
           similarity
          Length = 477

 Score = 46.2 bits (108), Expect = 6e-05,   Method: Compositional matrix adjust.
 Identities = 29/85 (34%), Positives = 46/85 (54%), Gaps = 15/85 (17%)

Query: 340 GHSDGVKTL---YFDDRKLITGSLDKTIRVWNYITGECISTYRGHSDSV--------LSV 388
           GH DGV  L   Y D  K+ +GS D  I+ W+  + E I++++ H  ++        +++
Sbjct: 65  GHQDGVYVLAKHYNDLNKIASGSGDGVIKYWDMSSREQIASFKAHYGTITGLCITPKVNI 124

Query: 389 DSY----QKVIVSGSADKTVKVWHV 409
           DS     Q  ++S S DKTVK+W V
Sbjct: 125 DSASSGNQNFVLSSSDDKTVKLWSV 149

 Score = 42.4 bits (98), Expect = 8e-04,   Method: Compositional matrix adjust.
 Identities = 64/319 (20%), Positives = 123/319 (38%), Gaps = 52/319 (16%)

Query: 300 GHMDGVLTLQFNYRLL---FTGSYDSTIGIWDLFTGKLIRRLSGHSDGVKTLYF------ 350
           GH DGV  L  +Y  L    +GS D  I  WD+ + + I     H   +  L        
Sbjct: 65  GHQDGVYVLAKHYNDLNKIASGSGDGVIKYWDMSSREQIASFKAHYGTITGLCITPKVNI 124

Query: 351 ------DDRKLITGSLDKTIRVW----------------NYITGECISTYRGHSDSVLSV 388
                 +   +++ S DKT+++W                N   G     Y  H+   L  
Sbjct: 125 DSASSGNQNFVLSSSDDKTVKLWSVNHEDFAHVDNDQVINTDNGLIKHYYGEHAFQGLDH 184

Query: 389 DSYQKVIVSGSADKTVKVWHV-ESRTCYTLRGHTEWVNCVKLHPKSFSCF-SCSDDTTIR 446
                  V+G     + +W +  S+    L    + +N VK +    +   S   D +I 
Sbjct: 185 SRMTSNFVTGGP--RINLWDINRSKPLSDLSWGADNINTVKFNQNDANVLGSAGSDNSIV 242

Query: 447 MWDIRTNSCLKVFRGHVGQVQKIIPLTIKDVE--NLATDNTSDGSSPQDDPTMTDGADES 504
           ++D+RTNS  +     + Q  ++  +    +E  N    +    +   D   M+   +  
Sbjct: 243 LYDLRTNSATQ----KIVQTMRVNSMCWNPMEAFNFVVASEDHNAYYYDMRNMSRALN-- 296

Query: 505 DTPSNEQETVLDENI-PYPTHLLSCGLDNTIKLWDVKTGKCIRTQFGHVEGVWDI----- 558
               +    V+D +I P    +++   D TI+++ +  G     +  H + +  +     
Sbjct: 297 -VFKDHVSAVMDVDISPTGEEVVTASYDKTIRIFPINKGHS--REIYHTKRMQHVFQAKF 353

Query: 559 AADNFRIISGSHDGSIKVW 577
           + D+  ++SGS DG++++W
Sbjct: 354 SMDSKYVMSGSDDGNVRLW 372

 Score = 37.0 bits (84), Expect = 0.042,   Method: Compositional matrix adjust.
 Identities = 30/104 (28%), Positives = 45/104 (43%), Gaps = 9/104 (8%)

Query: 496 TMTDGADESDTPSNEQETVLDENIPYPTHLLSCGLDNTIKLWDVKTGKCIRTQF------ 549
           T+   AD+     + QE+ L  N+    H      + T  L   K  +     F      
Sbjct: 5   TIKRSADDYVPVKSTQESQLPRNLNPELHPFERAREYTKALTATKLERMFAKPFVGQMGH 64

Query: 550 GHVEGVWDIAA---DNFRIISGSHDGSIKVWDLQSGKCMHTFNG 590
           GH +GV+ +A    D  +I SGS DG IK WD+ S + + +F  
Sbjct: 65  GHQDGVYVLAKHYNDLNKIASGSGDGVIKYWDMSSREQIASFKA 108

 Score = 30.4 bits (67), Expect = 5.4,   Method: Compositional matrix adjust.
 Identities = 19/63 (30%), Positives = 32/63 (50%), Gaps = 7/63 (11%)

Query: 354 KLITGSLDKTIRVWNYITGECISTYRGHS-----DSVLSVDSYQKVIVSGSADKTVKVWH 408
           +++T S DKTIR++    G     Y          +  S+DS  K ++SGS D  V++W 
Sbjct: 316 EVVTASYDKTIRIFPINKGHSREIYHTKRMQHVFQAKFSMDS--KYVMSGSDDGNVRLWR 373

Query: 409 VES 411
            ++
Sbjct: 374 AKA 376

>ADR264C [2005] [Homologous to ScYMR146C (TIF34) - SH]
           (1158218..1159258) [1041 bp, 346 aa]
          Length = 346

 Score = 45.8 bits (107), Expect = 6e-05,   Method: Compositional matrix adjust.
 Identities = 26/90 (28%), Positives = 44/90 (48%), Gaps = 5/90 (5%)

Query: 525 LLSCGLDNTIKLWDVKTGKCIRTQFGHVEGVWDIAADNF--RIISGSHDGSIKVWDLQSG 582
           + + G DN   +W    G+ + T  GH   +W I  D      ++GS D S+KVW ++ G
Sbjct: 25  IFTSGKDNVASVWYAMNGERLGTLEGHNGSIWSIDVDQHTEYAVTGSADFSVKVWRVRDG 84

Query: 583 KCMHTFNGRRLQRETQHTQTQSLGDKVAPI 612
              H+++ R   R  + + T   GD+V  +
Sbjct: 85  SIAHSWDTRTPVRRVEFSPT---GDRVLAV 111

 Score = 43.1 bits (100), Expect = 5e-04,   Method: Compositional matrix adjust.
 Identities = 23/57 (40%), Positives = 32/57 (56%), Gaps = 2/57 (3%)

Query: 355 LITGSLDKTIRVWNYITGECISTYRGHSDSVLS--VDSYQKVIVSGSADKTVKVWHV 409
           + T   D    VW  + GE + T  GH+ S+ S  VD + +  V+GSAD +VKVW V
Sbjct: 25  IFTSGKDNVASVWYAMNGERLGTLEGHNGSIWSIDVDQHTEYAVTGSADFSVKVWRV 81

 Score = 34.7 bits (78), Expect = 0.21,   Method: Compositional matrix adjust.
 Identities = 19/72 (26%), Positives = 36/72 (50%), Gaps = 4/72 (5%)

Query: 300 GHMDGVLTLQFNYR--LLFTGSYDSTIGIWDLFTGKLIRRLSGHSDGVKTLYFDDRK--L 355
           GH   +  +++N    L+FT   D+   +W    G+ +  L GH+  + ++  D      
Sbjct: 8   GHERSLTQVKYNREGDLIFTSGKDNVASVWYAMNGERLGTLEGHNGSIWSIDVDQHTEYA 67

Query: 356 ITGSLDKTIRVW 367
           +TGS D +++VW
Sbjct: 68  VTGSADFSVKVW 79

>Kwal_27.10785
          Length = 367

 Score = 45.8 bits (107), Expect = 7e-05,   Method: Compositional matrix adjust.
 Identities = 29/98 (29%), Positives = 57/98 (58%), Gaps = 8/98 (8%)

Query: 315 LFTGSYDSTIGIWDLFTGKLIRRLSGHSDGVKTLYF------DDRKLITGSLDKTIRVWN 368
           + +G  D+ + ++D+ +G+  +++  H   VK+L F      +   L+TGS DKTI+ W+
Sbjct: 94  IASGGCDNAVMVFDVSSGQS-QQVGAHDAAVKSLRFVQCGPSNTECLVTGSWDKTIKYWD 152

Query: 369 YITGECISTYRGHSDSVLSVDSYQKVIVSGSADKTVKV 406
               + +ST     + V ++DS QK++V G+A++ + V
Sbjct: 153 LRQPQPVSTL-AMPERVYTMDSKQKLLVVGTAERHIVV 189

 Score = 31.6 bits (70), Expect = 2.2,   Method: Compositional matrix adjust.
 Identities = 21/77 (27%), Positives = 36/77 (46%), Gaps = 17/77 (22%)

Query: 523 THLLSCGLDNTIKLWDVKTGKCIRTQFGHVEGVWDIAADNFR-----------IISGSHD 571
           T + S G DN + ++DV +G+  +       G  D A  + R           +++GS D
Sbjct: 92  TKIASGGCDNAVMVFDVSSGQSQQV------GAHDAAVKSLRFVQCGPSNTECLVTGSWD 145

Query: 572 GSIKVWDLQSGKCMHTF 588
            +IK WDL+  + + T 
Sbjct: 146 KTIKYWDLRQPQPVSTL 162

 Score = 31.6 bits (70), Expect = 2.2,   Method: Compositional matrix adjust.
 Identities = 23/77 (29%), Positives = 37/77 (48%), Gaps = 7/77 (9%)

Query: 296 QEFKGHMDGVLTLQF------NYRLLFTGSYDSTIGIWDLFTGKLIRRLSGHSDGVKTLY 349
           Q+   H   V +L+F      N   L TGS+D TI  WDL   + +  L+   + V T+ 
Sbjct: 114 QQVGAHDAAVKSLRFVQCGPSNTECLVTGSWDKTIKYWDLRQPQPVSTLA-MPERVYTMD 172

Query: 350 FDDRKLITGSLDKTIRV 366
              + L+ G+ ++ I V
Sbjct: 173 SKQKLLVVGTAERHIVV 189

 Score = 30.4 bits (67), Expect = 4.5,   Method: Compositional matrix adjust.
 Identities = 17/56 (30%), Positives = 30/56 (53%), Gaps = 3/56 (5%)

Query: 531 DNTIKLWDVKTGKC-IRTQFGHVEGVWDI--AADNFRIISGSHDGSIKVWDLQSGK 583
           D  +++WDV  G+   R ++ H   V     + D  +I SG  D ++ V+D+ SG+
Sbjct: 57  DKKVRVWDVNGGQAQCRAEYQHQAPVLATRWSTDGTKIASGGCDNAVMVFDVSSGQ 112

>KLLA0B14410g 1264616..1266736 similar to sp|P36037 Saccharomyces
           cerevisiae YKL213c DOA1 involved in ubiquitin-dependent
           proteolysis, start by similarity
          Length = 706

 Score = 46.2 bits (108), Expect = 8e-05,   Method: Compositional matrix adjust.
 Identities = 79/328 (24%), Positives = 139/328 (42%), Gaps = 53/328 (16%)

Query: 297 EFKGHMDGVLTL-QFNYRLLFTGSYDSTIGIWDL-FTGKLIRRLSGHSDG-VKTLYFDDR 353
           + +GH   V ++   +   + + S D T+ IW+L   G     ++  S+  V +L +D +
Sbjct: 7   QLRGHTQDVRSVVSLSTTQVASASRDGTVRIWNLDADGNWEGSIAFSSEKFVNSLTYDAK 66

Query: 354 K--LITGSLDKTIRVWNYITG---ECISTYRGHSDSVLSVDSYQKVIVSGSADKTVKVWH 408
           +  L  G  +K I   + +     E + T  GH  ++ S+    + +VS S DKT KVW 
Sbjct: 67  QCVLFCGGQEKIIYGVSPLLALGQEPVYTLVGHEGNICSLSGDFESLVSSSWDKTAKVW- 125

Query: 409 VESRTCYTLRGHTEWVNCVKLHPKSFSCFSCSDDTTIRMWDIRTNSCLKVF-RGHVGQVQ 467
                 + L+GH+  V   KL     S  + S DTT+++W  +  +  K F + H   V+
Sbjct: 126 TNGIVKWELKGHSASVWDAKLLNDG-SVLTASADTTVKLW--KNGTLAKTFDKLHSDVVR 182

Query: 468 KIIPLTIKDVENLATDNTSDGSSPQDDPTMTDGADESDTPSNEQETVLDENIPYPTH--- 524
            I  L          D+     S  +D T+          SN +  +L E I + +    
Sbjct: 183 NICIL----------DDGKHFVSCSNDGTL--------KLSNLEGGILHEFIGHESFVYA 224

Query: 525 --------LLSCGLDNTIKLWDVKTGKCIRTQFGHVEGVWDI-AADNFRIISGSHDGSIK 575
                   ++SCG D T+++W++  G   +        +W +    N  I+ GS D  I+
Sbjct: 225 VKQLPSGDIVSCGEDRTVRIWNMD-GTIKQVITLPAISIWTVDVLPNGDIVVGSSDKIIR 283

Query: 576 VWDLQSGKCMHTFNGRRLQRETQHTQTQ 603
           ++         T N +RL  + + T  Q
Sbjct: 284 IF---------TENEQRLASQEEITSLQ 302

>Sklu_2291.4 YPL183C, Contig c2291 6003-8996 reverse complement
          Length = 997

 Score = 46.2 bits (108), Expect = 8e-05,   Method: Compositional matrix adjust.
 Identities = 32/98 (32%), Positives = 53/98 (54%), Gaps = 6/98 (6%)

Query: 317 TGSYDSTIGIWDLFTGKLIRRLSGHSDGV--KTLYFDDRKLITGSLDKTIRVWNYITGEC 374
            G+    + IWDLF+   +  L GH   +   TL  +   +++ S D++I++WN  +GE 
Sbjct: 156 AGTVMGGVFIWDLFSETKVHNLLGHEGSIFYVTLSKNGEYVVSCSDDRSIKLWNLKSGEL 215

Query: 375 ISTYRGHSDSVLS---VDSYQKVIVSGSADKTVKVWHV 409
           +ST  GH+  +     +D+  KV VS S D T +VW +
Sbjct: 216 LSTGWGHTARIWQLKFIDNDTKV-VSVSEDCTCRVWDI 252

 Score = 45.8 bits (107), Expect = 1e-04,   Method: Compositional matrix adjust.
 Identities = 19/58 (32%), Positives = 39/58 (67%), Gaps = 2/58 (3%)

Query: 524 HLLSCGLDNTIKLWDVKTGKCIRTQFGHVEGVWDIAA--DNFRIISGSHDGSIKVWDL 579
           +++SC  D +IKLW++K+G+ + T +GH   +W +    ++ +++S S D + +VWD+
Sbjct: 195 YVVSCSDDRSIKLWNLKSGELLSTGWGHTARIWQLKFIDNDTKVVSVSEDCTCRVWDI 252

 Score = 40.4 bits (93), Expect = 0.004,   Method: Compositional matrix adjust.
 Identities = 31/108 (28%), Positives = 51/108 (47%), Gaps = 6/108 (5%)

Query: 364 IRVWNYITGECISTYRGHSDSVLSVDSYQKVIV-SGSADKTVKVWHVESRT-CYTLRGHT 421
           IR    + GE    Y G     +SV S  KV + +G+    V +W + S T  + L GH 
Sbjct: 126 IRWVKAVYGERSILYSGS----ISVFSDTKVYINAGTVMGGVFIWDLFSETKVHNLLGHE 181

Query: 422 EWVNCVKLHPKSFSCFSCSDDTTIRMWDIRTNSCLKVFRGHVGQVQKI 469
             +  V L        SCSDD +I++W++++   L    GH  ++ ++
Sbjct: 182 GSIFYVTLSKNGEYVVSCSDDRSIKLWNLKSGELLSTGWGHTARIWQL 229

 Score = 34.7 bits (78), Expect = 0.28,   Method: Compositional matrix adjust.
 Identities = 24/79 (30%), Positives = 43/79 (54%), Gaps = 4/79 (5%)

Query: 294 RIQEFKGHMDGV--LTLQFNYRLLFTGSYDSTIGIWDLFTGKLIRRLSGHSDGVKTLYF- 350
           ++    GH   +  +TL  N   + + S D +I +W+L +G+L+    GH+  +  L F 
Sbjct: 173 KVHNLLGHEGSIFYVTLSKNGEYVVSCSDDRSIKLWNLKSGELLSTGWGHTARIWQLKFI 232

Query: 351 -DDRKLITGSLDKTIRVWN 368
            +D K+++ S D T RVW+
Sbjct: 233 DNDTKVVSVSEDCTCRVWD 251

 Score = 30.8 bits (68), Expect = 3.8,   Method: Compositional matrix adjust.
 Identities = 15/56 (26%), Positives = 32/56 (57%), Gaps = 2/56 (3%)

Query: 534 IKLWDVKTGKCIRTQFGHVEGVW--DIAADNFRIISGSHDGSIKVWDLQSGKCMHT 587
           + +WD+ +   +    GH   ++   ++ +   ++S S D SIK+W+L+SG+ + T
Sbjct: 163 VFIWDLFSETKVHNLLGHEGSIFYVTLSKNGEYVVSCSDDRSIKLWNLKSGELLST 218

>CAGL0C01441g complement(156930..159947) similar to tr|Q08924
           Saccharomyces cerevisiae YPL183c, start by similarity
          Length = 1005

 Score = 45.8 bits (107), Expect = 9e-05,   Method: Compositional matrix adjust.
 Identities = 50/209 (23%), Positives = 98/209 (46%), Gaps = 22/209 (10%)

Query: 313 RLLFTGSYDSTIGIWDLFTGKLI--RRLSG-----HSDGVKTLYFDDRKLITGSLDKTIR 365
           +L    +Y+  + I DL TGK++  ++L G     +S  +K +   + ++  G++     
Sbjct: 105 KLYILTNYNKVL-ITDL-TGKVVEEKKLVGERSILYSGSIKVISESEVQINAGTVMGGAI 162

Query: 366 VWNYITGECISTYRGHSDSVLSVDS--YQKVIVSGSADKTVKVWHVESRTCYTLR-GHTE 422
           VW+    E I    GH  S+  + S  + K+I S S D+++++W  E+    ++   HT 
Sbjct: 163 VWDLYKEELIHNLTGHEGSIFYIQSSEHNKLIASCSDDRSIRLWDRETGKELSIGWSHTA 222

Query: 423 WVNCVKLHPKSFSCFSCSDDTTIRMWDIRTN-------SCLKVFRGHVGQVQKIIPLTIK 475
            +  +K      +  S S+D T R+W+I  N           +F GH+  ++ +  + + 
Sbjct: 223 RIWNLKFFNNDENLVSVSEDCTCRVWNIIPNDISGYELQISNIFEGHL--LKNVWGVDVN 280

Query: 476 DVENLATDNTSDGS-SPQDDPTMTDGADE 503
           D + +   + +DG  +  D  T T+  DE
Sbjct: 281 DEKRIIATSGNDGRINVIDLNTDTNSGDE 309

 Score = 37.0 bits (84), Expect = 0.055,   Method: Compositional matrix adjust.
 Identities = 18/57 (31%), Positives = 33/57 (57%), Gaps = 2/57 (3%)

Query: 525 LLSCGLDNTIKLWDVKTGKCIRTQFGHVEGVWDIAADNF--RIISGSHDGSIKVWDL 579
           + SC  D +I+LWD +TGK +   + H   +W++   N    ++S S D + +VW++
Sbjct: 194 IASCSDDRSIRLWDRETGKELSIGWSHTARIWNLKFFNNDENLVSVSEDCTCRVWNI 250

>CAGL0L02761g complement(320826..322085) similar to sp|P18851
           Saccharomyces cerevisiae YOR212w STE4, hypothetical
           start
          Length = 419

 Score = 45.4 bits (106), Expect = 1e-04,   Method: Compositional matrix adjust.
 Identities = 58/262 (22%), Positives = 109/262 (41%), Gaps = 37/262 (14%)

Query: 339 SGHSDGVKTLYFDDRKLITGSLDKTIRVWNYITGECISTYRGHSDSVLSVD------SYQ 392
           +G+  GV+  +  + +++T S D T  +W+    + +  Y  H   VL++       S  
Sbjct: 174 TGYISGVE--FVSESRVVTSSGDMTCALWDIPKAKRVREYSDHLGDVLAISIPVTNLSKN 231

Query: 393 KVIVSGSADKTVKVWHVESRTC---YTLRGHTEWVNCVKLHPKSFSCFSCSDDTTIRMWD 449
            +  S  +D    +W V S +    +++       NC+K  P   S    +DD TI ++D
Sbjct: 232 NMFASCGSDGYTFIWDVRSPSAVQQFSIGSCDS--NCLKFFPDGNSVAVGNDDGTISLFD 289

Query: 450 IRTNSCLKVF----RGHVGQVQKIIPLTIKDVENLATDNTSDGSSPQDDPTMTDGADESD 505
           +R +  + ++    RG         PL  ++V         + +  Q   +         
Sbjct: 290 LRADCTIALYSINDRGS--------PLQKENV-------FLNSNEYQSSSSSPKSPISLA 334

Query: 506 TPSNEQETVLDENIPYPTHLL-SCGLDNTIKLWDVKTGKCIRTQFGH---VEGVWDIAAD 561
           T   E   V+  +      L+ SC ++   ++WDV  G+ + +  GH   + GV   + D
Sbjct: 335 TNYFEDRGVISLDFSGSGRLMYSCYINLGCQVWDVLKGEVVYSLEGHGNRLAGV-KCSPD 393

Query: 562 NFRIISGSHDGSIKVWDLQSGK 583
              I +GS D ++K+W  Q  K
Sbjct: 394 GMAICTGSWDQTLKLWTPQYEK 415

 Score = 37.7 bits (86), Expect = 0.024,   Method: Compositional matrix adjust.
 Identities = 22/69 (31%), Positives = 40/69 (57%), Gaps = 6/69 (8%)

Query: 304 GVLTLQFNY--RLLFTGSYDSTIGIWDLFTGKLIRRLSGHSD---GVKTLYFDDRKLITG 358
           GV++L F+   RL+++   +    +WD+  G+++  L GH +   GVK    D   + TG
Sbjct: 342 GVISLDFSGSGRLMYSCYINLGCQVWDVLKGEVVYSLEGHGNRLAGVKC-SPDGMAICTG 400

Query: 359 SLDKTIRVW 367
           S D+T+++W
Sbjct: 401 SWDQTLKLW 409

>YOR212W (STE4) [5005] chr15 (742910..744181) Beta subunit of the
           trimeric G protein that mediates signal transduction by
           pheromones, member of the WD (WD-40) repeat family [1272
           bp, 423 aa]
          Length = 423

 Score = 45.4 bits (106), Expect = 1e-04,   Method: Compositional matrix adjust.
 Identities = 56/256 (21%), Positives = 104/256 (40%), Gaps = 30/256 (11%)

Query: 338 LSGHSDGVKTLYF-DDRKLITGSLDKTIRVWNYITGECISTYRGHSDSVLSV-------- 388
             GH+  +  + F D+  ++T S D T  +W+    + +  Y  H   VL++        
Sbjct: 177 FKGHTCYISDIEFTDNAHILTASGDMTCALWDIPKAKRVREYSDHLGDVLALAIPEEPNS 236

Query: 389 DSYQKVIVSGSADKTVKVWHVESRTCY-TLRGHTEWVNCVKLHPKSFSCFSCSDDTTIRM 447
           ++      S  +D    +W   S +   +   +   +N ++      S  + SD+  I M
Sbjct: 237 ENSSNTFASCGSDGYTYIWDSRSPSAVQSFYVNDSDINALRFFKDGMSIVAGSDNGAINM 296

Query: 448 WDIRTN---SCLKVFRGHVGQVQKIIPLTIKDVENLATDNTSDGSSPQDDPTMTDGADES 504
           +D+R++   +   +FRG+    ++  P       N+  +      SPQ     T  +  S
Sbjct: 297 YDLRSDCSIATFSLFRGY----EERTPTPTYMAANMEYNT---AQSPQ-----TLKSTSS 344

Query: 505 DTPSNEQETVLDENIPYPTHLLSCGLDNTIKLWDVKTGKCIRTQFGH---VEGVWDIAAD 561
               N+    LD +      + SC  D    +WDV  G+ +    GH   V GV   + D
Sbjct: 345 SYLDNQGVVSLDFSAS-GRLMYSCYTDIGCVVWDVLKGEIVGKLEGHGGRVTGVRS-SPD 402

Query: 562 NFRIISGSHDGSIKVW 577
              + +GS D ++K+W
Sbjct: 403 GLAVCTGSWDSTMKIW 418

 Score = 45.1 bits (105), Expect = 1e-04,   Method: Compositional matrix adjust.
 Identities = 57/280 (20%), Positives = 115/280 (41%), Gaps = 60/280 (21%)

Query: 338 LSGHSDGVKTLYF--DDRKLITGSLDKTIRVWNYITGECISTYRGHSDSVLS--VDSYQK 393
           L GH++ +    +  D +++++ S D  + +W+  +G   +     S  VLS  +     
Sbjct: 88  LKGHNNKISDFRWSRDSKRILSASQDGFMLIWDSASGLKQNAIPLDSQWVLSCAISPSST 147

Query: 394 VIVSGSADKTVKVWHV--ESRTCYTL----RGHTEWVNCVKLHPKSFSCFSCSDDTTIRM 447
           ++ S   +    ++ V  E+R    +    +GHT +++ ++    +    + S D T  +
Sbjct: 148 LVASAGLNNNCTIYRVSKENRVAQNVASIFKGHTCYISDIEFTDNAH-ILTASGDMTCAL 206

Query: 448 WDIRTNSCLKVFRGHVGQVQKIIPLTIKDVENLATDNTSDGSSPQDDPTMTDGADESDTP 507
           WDI     ++ +  H+G V   + L I +  N  ++N+S+                    
Sbjct: 207 WDIPKAKRVREYSDHLGDV---LALAIPEEPN--SENSSN-------------------- 241

Query: 508 SNEQETVLDENIPYPTHLLSCGLDNTIKLWDVKTGKCIRTQFGHVEGVWDIAA-----DN 562
                              SCG D    +WD ++   +++ + +     DI A     D 
Sbjct: 242 ----------------TFASCGSDGYTYIWDSRSPSAVQSFYVNDS---DINALRFFKDG 282

Query: 563 FRIISGSHDGSIKVWDLQSGKCMHTFNGRRLQRETQHTQT 602
             I++GS +G+I ++DL+S   + TF+  R   E   T T
Sbjct: 283 MSIVAGSDNGAINMYDLRSDCSIATFSLFRGYEERTPTPT 322

 Score = 39.7 bits (91), Expect = 0.006,   Method: Compositional matrix adjust.
 Identities = 21/68 (30%), Positives = 38/68 (55%), Gaps = 4/68 (5%)

Query: 304 GVLTLQFNY--RLLFTGSYDSTIGIWDLFTGKLIRRLSGHSDGVKTLYF--DDRKLITGS 359
           GV++L F+   RL+++   D    +WD+  G+++ +L GH   V  +    D   + TGS
Sbjct: 351 GVVSLDFSASGRLMYSCYTDIGCVVWDVLKGEIVGKLEGHGGRVTGVRSSPDGLAVCTGS 410

Query: 360 LDKTIRVW 367
            D T+++W
Sbjct: 411 WDSTMKIW 418

>ACR097W [1144] [Homologous to ScYOR212W (STE4) - SH]
           complement(529784..531187) [1404 bp, 467 aa]
          Length = 467

 Score = 45.4 bits (106), Expect = 1e-04,   Method: Compositional matrix adjust.
 Identities = 27/70 (38%), Positives = 41/70 (58%), Gaps = 6/70 (8%)

Query: 304 GVLTLQFNY--RLLFTGSYDSTIGIWDLFTGKLIRRLSGHSD---GVKTLYFDDRKLITG 358
           GV+++ F+   RLL+    +    +WDL  G++I +L GHSD   GV T   D   + TG
Sbjct: 395 GVISMDFSRSGRLLYVSYTEFGCAVWDLVKGEIIGKLDGHSDRISGVAT-SPDGLAICTG 453

Query: 359 SLDKTIRVWN 368
           S D T++VW+
Sbjct: 454 SWDMTMKVWS 463

 Score = 43.9 bits (102), Expect = 3e-04,   Method: Compositional matrix adjust.
 Identities = 39/168 (23%), Positives = 72/168 (42%), Gaps = 13/168 (7%)

Query: 333 KLIRRLSGHSDGVKTLYF--DDRKLITGSLDKTIRVWNYITGECISTYRGHSDSVLS--V 388
           K +  L GH++ V +  +  D R +++ S D  + +W+  TG   +    HS  VLS  +
Sbjct: 118 KPVTTLKGHNNKVSSFRWSSDSRTILSASQDGFMLLWDAATGLKSNAIPLHSQWVLSCAI 177

Query: 389 DSYQKVIVSGSADKTVKVWHV------ESRTCYTLRGHTEWVNCVKLHPKSFSCFSCSDD 442
                ++ S   D    ++ V      +       +GHT +++ ++    + S  + S D
Sbjct: 178 CPNGNLVASAGLDNNCTIYRVSRKDRIQQNIVSIFKGHTCYISEIEFLDDN-SILTASGD 236

Query: 443 TTIRMWDIRTNSCLKVFRGHVGQVQKI--IPLTIKDVENLATDNTSDG 488
            T  +WDI  +  +  F  H+G V  +   P   +   N+     SDG
Sbjct: 237 MTCALWDITKSKRINEFADHLGDVLSLSAAPTETEGNGNVFASGGSDG 284

 Score = 39.3 bits (90), Expect = 0.009,   Method: Compositional matrix adjust.
 Identities = 57/268 (21%), Positives = 104/268 (38%), Gaps = 25/268 (9%)

Query: 328 DLFTGKLIRRLSGHSDGVKTLYF-DDRKLITGSLDKTIRVWNYITGECISTYRGHSDSVL 386
           D     ++    GH+  +  + F DD  ++T S D T  +W+    + I+ +  H   VL
Sbjct: 202 DRIQQNIVSIFKGHTCYISEIEFLDDNSILTASGDMTCALWDITKSKRINEFADHLGDVL 261

Query: 387 SVDSYQ-------KVIVSGSADKTVKVWHVESRTCY-TLRGHTEWVNCVKLHPKSFSCFS 438
           S+ +          V  SG +D  + +W     T   +       V+ VK      +  +
Sbjct: 262 SLSAAPTETEGNGNVFASGGSDGYLYIWDKRVPTSVQSFFVSDSDVSKVKFFRNGNTIAT 321

Query: 439 CSDDTTIRMWDIRTN------SCLKVFRGHVGQVQKIIPLTIKDVENLATDNTSDGSSPQ 492
            SDD    ++D+R++      S  +   G     Q+     + +++  A   T   +SP 
Sbjct: 322 GSDDGCTNLYDLRSDCRIANYSLSRSIHGATPVQQQT--YIMSNMDYTAPSGTLARASPY 379

Query: 493 DDPTMTDGADESDTPSNEQETVLDENIPYPTHLLSCGL-DNTIKLWDVKTGKCIRTQFGH 551
                T  +   D      + V+  +      LL     +    +WD+  G+ I    GH
Sbjct: 380 SPAIGTVSSSFID-----NQGVISMDFSRSGRLLYVSYTEFGCAVWDLVKGEIIGKLDGH 434

Query: 552 VEGVWDIAA--DNFRIISGSHDGSIKVW 577
            + +  +A   D   I +GS D ++KVW
Sbjct: 435 SDRISGVATSPDGLAICTGSWDMTMKVW 462

>Scas_615.11
          Length = 349

 Score = 45.1 bits (105), Expect = 1e-04,   Method: Compositional matrix adjust.
 Identities = 47/170 (27%), Positives = 74/170 (43%), Gaps = 34/170 (20%)

Query: 313 RLLFTGSYDSTIGIW-------------------DLFTGKLIRRLSGHSDGVKTLYF--D 351
            LL  GS+DST+ IW                   +     L+  + GH + VK + +  D
Sbjct: 73  NLLAAGSFDSTVSIWTREDDLEEEEDDDEGEGTTNSLEMDLLAIIEGHENEVKGIAWSHD 132

Query: 352 DRKLITGSLDKTIRVWNYITG----ECISTYRGHSDSVLSVDSYQK--VIVSGSADKTVK 405
              L + S DK++ +W         ECIS  + HS  V  V  + +  ++ S S D T++
Sbjct: 133 GALLSSCSRDKSVWIWETDQDGEEYECISVLQEHSQDVKHVVWHPELPLLASSSYDDTIR 192

Query: 406 VW--HVESRTCYT-LRGHTEWVNCVKL----HPKSFSCFSCSDDTTIRMW 448
           +W  + +   C   L GH   V C       + +S    S SDD+T+R+W
Sbjct: 193 LWKDYDDDWECAAVLNGHEGTVWCSDFEKGKNGESIRLCSGSDDSTVRVW 242

 Score = 33.1 bits (74), Expect = 0.60,   Method: Compositional matrix adjust.
 Identities = 24/65 (36%), Positives = 32/65 (49%), Gaps = 8/65 (12%)

Query: 314 LLFTGSYDSTIGIWDLFTG--KLIRRLSGHSDGVKTLYFDDRK------LITGSLDKTIR 365
           LL + SYD TI +W  +    +    L+GH   V    F+  K      L +GS D T+R
Sbjct: 181 LLASSSYDDTIRLWKDYDDDWECAAVLNGHEGTVWCSDFEKGKNGESIRLCSGSDDSTVR 240

Query: 366 VWNYI 370
           VW YI
Sbjct: 241 VWRYI 245

 Score = 33.1 bits (74), Expect = 0.64,   Method: Compositional matrix adjust.
 Identities = 57/244 (23%), Positives = 94/244 (38%), Gaps = 60/244 (24%)

Query: 381 HSDSVLSVDSYQKVIVSGSADKTVKVWHVES--RTCYTLRG------HTEWVNCVKLHPK 432
            +D + S+D    ++ +GS D+ +K+ +V +  R   +L        H + + CV   P 
Sbjct: 12  QNDKLWSLDYSHGLLATGSTDRKIKIINVTNAPRGQVSLMDVLDDTVHKKAIRCVAWRPH 71

Query: 433 SFSCFSCSDDTTIRMW---------------DIRTNSC----LKVFRGHVGQVQKIIPLT 473
           S    + S D+T+ +W               +  TNS     L +  GH  +V+ I    
Sbjct: 72  SNLLAAGSFDSTVSIWTREDDLEEEEDDDEGEGTTNSLEMDLLAIIEGHENEVKGIAW-- 129

Query: 474 IKDVENLATDNTSDG---SSPQDDPTMTDGADESDTPSNEQETVLDENIPYPTH------ 524
                      + DG   SS   D ++     + D    E  +VL E+     H      
Sbjct: 130 -----------SHDGALLSSCSRDKSVWIWETDQDGEEYECISVLQEHSQDVKHVVWHPE 178

Query: 525 ---LLSCGLDNTIKLWDV--KTGKCIRTQFGHVEGVW------DIAADNFRIISGSHDGS 573
              L S   D+TI+LW       +C     GH   VW          ++ R+ SGS D +
Sbjct: 179 LPLLASSSYDDTIRLWKDYDDDWECAAVLNGHEGTVWCSDFEKGKNGESIRLCSGSDDST 238

Query: 574 IKVW 577
           ++VW
Sbjct: 239 VRVW 242

>Scas_680.11
          Length = 347

 Score = 45.1 bits (105), Expect = 1e-04,   Method: Compositional matrix adjust.
 Identities = 22/67 (32%), Positives = 38/67 (56%), Gaps = 2/67 (2%)

Query: 525 LLSCGLDNTIKLWDVKTGKCIRTQFGHVEGVWDIAADNF--RIISGSHDGSIKVWDLQSG 582
           L SC  DN   +W    G+ + T  GH   +W I  D F    ++GS D SIK+W +++G
Sbjct: 25  LFSCSKDNFASVWYSVNGERLGTLNGHAGTIWSIDVDKFTEYCVTGSADYSIKMWKVETG 84

Query: 583 KCMHTFN 589
           + +++++
Sbjct: 85  ENVYSWD 91

 Score = 43.1 bits (100), Expect = 5e-04,   Method: Compositional matrix adjust.
 Identities = 22/59 (37%), Positives = 35/59 (59%), Gaps = 2/59 (3%)

Query: 355 LITGSLDKTIRVWNYITGECISTYRGHSDSVLS--VDSYQKVIVSGSADKTVKVWHVES 411
           L + S D    VW  + GE + T  GH+ ++ S  VD + +  V+GSAD ++K+W VE+
Sbjct: 25  LFSCSKDNFASVWYSVNGERLGTLNGHAGTIWSIDVDKFTEYCVTGSADYSIKMWKVET 83

 Score = 38.1 bits (87), Expect = 0.019,   Method: Compositional matrix adjust.
 Identities = 23/83 (27%), Positives = 44/83 (53%), Gaps = 4/83 (4%)

Query: 300 GHMDGVLTLQFNYR--LLFTGSYDSTIGIWDLFTGKLIRRLSGHSDGVKTLYFDD--RKL 355
           GH   +  +++N    LLF+ S D+   +W    G+ +  L+GH+  + ++  D      
Sbjct: 8   GHERPLTQVKYNREGDLLFSCSKDNFASVWYSVNGERLGTLNGHAGTIWSIDVDKFTEYC 67

Query: 356 ITGSLDKTIRVWNYITGECISTY 378
           +TGS D +I++W   TGE + ++
Sbjct: 68  VTGSADYSIKMWKVETGENVYSW 90

 Score = 30.0 bits (66), Expect = 6.1,   Method: Compositional matrix adjust.
 Identities = 17/60 (28%), Positives = 28/60 (46%), Gaps = 1/60 (1%)

Query: 394 VIVSGSADKTVKVWH-VESRTCYTLRGHTEWVNCVKLHPKSFSCFSCSDDTTIRMWDIRT 452
           ++ S S D    VW+ V      TL GH   +  + +   +  C + S D +I+MW + T
Sbjct: 24  LLFSCSKDNFASVWYSVNGERLGTLNGHAGTIWSIDVDKFTEYCVTGSADYSIKMWKVET 83

>YLR409C (UTP21) [3786] chr12 complement(934411..937230) Member of
           the Utp21-specific WD40 associated domain containing
           family, contains seven WD domains (WD-40 repeat), which
           may mediate protein-protein interactions, has high
           similarity to uncharacterized C. albicans Orf6.6423p
           [2820 bp, 939 aa]
          Length = 939

 Score = 45.4 bits (106), Expect = 1e-04,   Method: Compositional matrix adjust.
 Identities = 37/155 (23%), Positives = 67/155 (43%), Gaps = 24/155 (15%)

Query: 316 FTGSYDSTIGIWDLFTGKLIRRLSGHSDGVKTLYFD--DRKLITGSLDKTIRVWNY---- 369
           F GS + +I I+++ +G L ++   H   V  +  D  +RK+++  LD  +  +++    
Sbjct: 476 FIGSSNGSITIYNMQSGILRKKYKLHKRAVTGISLDGMNRKMVSCGLDGIVGFYDFNKST 535

Query: 370 ITGEC-----ISTYRGHSDS---VLSVDSYQKVIVSGSADKTVKVWHVESRTCYTLRGHT 421
           + G+      I+    H  S    L++D    V++            V  R    L GH+
Sbjct: 536 LLGKLKLDAPITAMVYHRSSDLFALALDDLSIVVIDA----------VTQRVVRQLWGHS 585

Query: 422 EWVNCVKLHPKSFSCFSCSDDTTIRMWDIRTNSCL 456
             +      P+     S S D+TIR WD+ T  C+
Sbjct: 586 NRITAFDFSPEGRWIVSASLDSTIRTWDLPTGGCI 620

 Score = 37.4 bits (85), Expect = 0.045,   Method: Compositional matrix adjust.
 Identities = 20/64 (31%), Positives = 36/64 (56%), Gaps = 3/64 (4%)

Query: 525 LLSCGLDN-TIKLWDVKTGKCIRTQFGHVEGV--WDIAADNFRIISGSHDGSIKVWDLQS 581
           L +  LD+ +I + D  T + +R  +GH   +  +D + +   I+S S D +I+ WDL +
Sbjct: 557 LFALALDDLSIVVIDAVTQRVVRQLWGHSNRITAFDFSPEGRWIVSASLDSTIRTWDLPT 616

Query: 582 GKCM 585
           G C+
Sbjct: 617 GGCI 620

 Score = 31.2 bits (69), Expect = 3.1,   Method: Compositional matrix adjust.
 Identities = 37/161 (22%), Positives = 68/161 (42%), Gaps = 31/161 (19%)

Query: 398 GSADKTVKVWHVES---RTCYTLRGHTEWVNCVKLHPKSFSCFSCSDDTTIRMWDIRTNS 454
           GS++ ++ +++++S   R  Y L  H   V  + L   +    SC  D  +  +D   ++
Sbjct: 478 GSSNGSITIYNMQSGILRKKYKL--HKRAVTGISLDGMNRKMVSCGLDGIVGFYDFNKST 535

Query: 455 CLKVFRGHVGQVQKIIPLTI------KDVENLATDNTSDGSSPQDDPTMTDGADESDTPS 508
            L       G+++   P+T        D+  LA D+ S          + D   +     
Sbjct: 536 LL-------GKLKLDAPITAMVYHRSSDLFALALDDLS--------IVVIDAVTQRVVRQ 580

Query: 509 ----NEQETVLDENIPYPTHLLSCGLDNTIKLWDVKTGKCI 545
               + + T  D + P    ++S  LD+TI+ WD+ TG CI
Sbjct: 581 LWGHSNRITAFDFS-PEGRWIVSASLDSTIRTWDLPTGGCI 620

>YER066W (YER066W) [1497] chr5 (290240..290797) Protein containing
           three WD domains (WD-40 repeat), which may mediate
           protein-protein interactions, has high similarity to a
           region of S. cerevisiae Cdc4p, which is a component of
           the SCF-Cdc4p complex involved in ubiquitin-dependent
           degradation [558 bp, 185 aa]
          Length = 185

 Score = 43.5 bits (101), Expect = 1e-04,   Method: Composition-based stats.
 Identities = 35/120 (29%), Positives = 52/120 (43%), Gaps = 22/120 (18%)

Query: 333 KLIRRLSGHSDGV-KTLYFDDRK-LITGSLDKTIRVWNYIT----GEC------------ 374
           K +  LSGH+D +  T+Y  +RK  I+ S+D TIR+W+       GEC            
Sbjct: 2   KCLYILSGHTDRIYSTIYDHERKRCISASMDTTIRIWDLENIRNNGECSYATNSASPCAK 61

Query: 375 ----ISTYRGHSDSVLSVDSYQKVIVSGSADKTVKVWHVESRTCYTLRGHTEWVNCVKLH 430
               + T RGH   V  +    K +VS S D +++ W   +        HT+      LH
Sbjct: 62  ILGAMYTLRGHRALVGLLGLSDKFLVSASVDGSIRCWDANTYFLKHFFDHTQLNTITALH 121

 Score = 33.1 bits (74), Expect = 0.35,   Method: Composition-based stats.
 Identities = 18/42 (42%), Positives = 22/42 (52%), Gaps = 3/42 (7%)

Query: 415 YTLRGHTEWVNCVKLHPKSFSCFSCSDDTTIRMWD---IRTN 453
           Y L GHT+ +       +   C S S DTTIR+WD   IR N
Sbjct: 5   YILSGHTDRIYSTIYDHERKRCISASMDTTIRIWDLENIRNN 46

 Score = 33.1 bits (74), Expect = 0.36,   Method: Composition-based stats.
 Identities = 30/126 (23%), Positives = 56/126 (44%), Gaps = 25/126 (19%)

Query: 298 FKGHMDGVLTLQFNY--RLLFTGSYDSTIGIWDLFTGK--------------------LI 335
             GH D + +  +++  +   + S D+TI IWDL   +                     +
Sbjct: 7   LSGHTDRIYSTIYDHERKRCISASMDTTIRIWDLENIRNNGECSYATNSASPCAKILGAM 66

Query: 336 RRLSGHSDGVKTLYFDDRKLITGSLDKTIRVWNYITGECISTYRGHS--DSVLSVDSYQK 393
             L GH   V  L   D+ L++ S+D +IR W+  T   +  +  H+  +++ ++    +
Sbjct: 67  YTLRGHRALVGLLGLSDKFLVSASVDGSIRCWDANT-YFLKHFFDHTQLNTITALHVSDE 125

Query: 394 VIVSGS 399
           V+VSGS
Sbjct: 126 VLVSGS 131

 Score = 32.0 bits (71), Expect = 0.88,   Method: Composition-based stats.
 Identities = 17/53 (32%), Positives = 29/53 (54%), Gaps = 6/53 (11%)

Query: 543 KCIRTQFGHVEGVWDIAADN--FRIISGSHDGSIKVWDLQ----SGKCMHTFN 589
           KC+    GH + ++    D+   R IS S D +I++WDL+    +G+C +  N
Sbjct: 2   KCLYILSGHTDRIYSTIYDHERKRCISASMDTTIRIWDLENIRNNGECSYATN 54

 Score = 32.0 bits (71), Expect = 0.97,   Method: Composition-based stats.
 Identities = 24/92 (26%), Positives = 40/92 (43%), Gaps = 20/92 (21%)

Query: 526 LSCGLDNTIKLWDVKT----GKC----------------IRTQFGHVEGVWDIAADNFRI 565
           +S  +D TI++WD++     G+C                + T  GH   V  +   +  +
Sbjct: 27  ISASMDTTIRIWDLENIRNNGECSYATNSASPCAKILGAMYTLRGHRALVGLLGLSDKFL 86

Query: 566 ISGSHDGSIKVWDLQSGKCMHTFNGRRLQRET 597
           +S S DGSI+ WD  +    H F+  +L   T
Sbjct: 87  VSASVDGSIRCWDANTYFLKHFFDHTQLNTIT 118

>Kwal_26.7736
          Length = 507

 Score = 45.1 bits (105), Expect = 1e-04,   Method: Compositional matrix adjust.
 Identities = 56/241 (23%), Positives = 98/241 (40%), Gaps = 37/241 (15%)

Query: 364 IRVWNYITGECISTYRGHSDSVLSVDSYQ--KVIVSGSADKTVKVW--HVESRTCYTLRG 419
           +++++  T + I T+    D V S    Q  K++  G A   V V+  +       ++  
Sbjct: 63  VQLFSSRTRQVIKTFSRFKDVVYSASFRQDGKLLAMGDATGRVSVYDSYNPRAQLVSIAA 122

Query: 420 HTEWVNCVKLHPK-SFSCFSCSDDTTIRMWDIRTNSCLKV-FRGHVGQVQKIIPLTIKDV 477
            +   +  K HP  S +  + SDD  +R+WDI      +V   G    V+ +    +   
Sbjct: 123 SSHPTHVAKFHPADSRTLVTASDDRVVRVWDITQAQEPQVELTGASDYVRSVC--MVPQA 180

Query: 478 ENLATDNTSDGSSPQDDPTMTDGADESDTPSNEQETVLDENIPY-------PTHLLSCGL 530
            +L    + DG                DT +NE+ T L + +P         T L+SCG 
Sbjct: 181 PHLVVTGSYDGQ-----------VRLFDTRTNERATTLAQGMPVEDVIAVSATQLVSCG- 228

Query: 531 DNTIKLWDVKTGKCI--RTQFG-------HVEGVWDIAADNFRIISGSHDGSIKVWDLQS 581
               K+WD+   + +  R  F        HV+ V D    +  +++ S DG +K++D   
Sbjct: 229 GPKFKVWDLTAQRPLLERANFAKTVTCLNHVDLVEDSPMSS-TLVASSLDGHVKIFDPLD 287

Query: 582 G 582
           G
Sbjct: 288 G 288

 Score = 34.3 bits (77), Expect = 0.34,   Method: Compositional matrix adjust.
 Identities = 34/123 (27%), Positives = 54/123 (43%), Gaps = 10/123 (8%)

Query: 295 IQEFKGHMDGVLTLQFNY--RLLFTGSYDSTIGIWDLFT--GKLIR-RLSGHSDGVKTLY 349
           I+ F    D V +  F    +LL  G     + ++D +    +L+    S H   V   +
Sbjct: 74  IKTFSRFKDVVYSASFRQDGKLLAMGDATGRVSVYDSYNPRAQLVSIAASSHPTHVAKFH 133

Query: 350 -FDDRKLITGSLDKTIRVWNYITG-ECISTYRGHSD---SVLSVDSYQKVIVSGSADKTV 404
             D R L+T S D+ +RVW+     E      G SD   SV  V     ++V+GS D  V
Sbjct: 134 PADSRTLVTASDDRVVRVWDITQAQEPQVELTGASDYVRSVCMVPQAPHLVVTGSYDGQV 193

Query: 405 KVW 407
           +++
Sbjct: 194 RLF 196

 Score = 31.2 bits (69), Expect = 3.3,   Method: Compositional matrix adjust.
 Identities = 31/180 (17%), Positives = 70/180 (38%), Gaps = 29/180 (16%)

Query: 424 VNCVKLHPKSFSCFSCSDDTTIRMWDIRTNSCLKVFRGHVGQVQKIIPLTIKDVENLATD 483
           V  +  +P   + F+ +  T ++++  RT   +K F               KDV   A+ 
Sbjct: 42  VTSIAFNPNHPNDFAITSSTRVQLFSSRTRQVIKTFS------------RFKDVVYSASF 89

Query: 484 NTSDGSSPQDDPTMTDGADESDTPSNEQETVLDENIPYPTH-----------LLSCGLDN 532
                     D T      +S  P  +  ++   +  +PTH           L++   D 
Sbjct: 90  RQDGKLLAMGDATGRVSVYDSYNPRAQLVSIAASS--HPTHVAKFHPADSRTLVTASDDR 147

Query: 533 TIKLWDVKTGKCIRTQF----GHVEGVWDIAADNFRIISGSHDGSIKVWDLQSGKCMHTF 588
            +++WD+   +  + +      +V  V  +      +++GS+DG ++++D ++ +   T 
Sbjct: 148 VVRVWDITQAQEPQVELTGASDYVRSVCMVPQAPHLVVTGSYDGQVRLFDTRTNERATTL 207

>Scas_512.3
          Length = 534

 Score = 45.1 bits (105), Expect = 1e-04,   Method: Compositional matrix adjust.
 Identities = 21/60 (35%), Positives = 39/60 (65%), Gaps = 2/60 (3%)

Query: 352 DRKLITGSLDKTIRVWNYITGECISTYRGHSDSVLSV--DSYQKVIVSGSADKTVKVWHV 409
           DR +++GS+D +IRV++  +G+ + TY  H+  V  V  D   + I+S SAD++V ++ +
Sbjct: 158 DRYVVSGSMDNSIRVFDIESGKLLGTYADHNHYVQGVTWDPLNEFILSQSADRSVNIYQI 217

 Score = 34.7 bits (78), Expect = 0.25,   Method: Compositional matrix adjust.
 Identities = 20/60 (33%), Positives = 38/60 (63%), Gaps = 6/60 (10%)

Query: 524 HLLSCGLDNTIKLWDVKTGKCIRTQFGH---VEGV-WDIAADNFRIISGSHDGSIKVWDL 579
           +++S  +DN+I+++D+++GK + T   H   V+GV WD    N  I+S S D S+ ++ +
Sbjct: 160 YVVSGSMDNSIRVFDIESGKLLGTYADHNHYVQGVTWDPL--NEFILSQSADRSVNIYQI 217

 Score = 32.7 bits (73), Expect = 0.87,   Method: Compositional matrix adjust.
 Identities = 12/24 (50%), Positives = 20/24 (83%)

Query: 565 IISGSHDGSIKVWDLQSGKCMHTF 588
           ++SGS D SI+V+D++SGK + T+
Sbjct: 161 VVSGSMDNSIRVFDIESGKLLGTY 184

 Score = 32.3 bits (72), Expect = 1.2,   Method: Compositional matrix adjust.
 Identities = 15/60 (25%), Positives = 38/60 (63%), Gaps = 2/60 (3%)

Query: 313 RLLFTGSYDSTIGIWDLFTGKLIRRLSGHSDGVKTLYFD--DRKLITGSLDKTIRVWNYI 370
           R + +GS D++I ++D+ +GKL+   + H+  V+ + +D  +  +++ S D+++ ++  I
Sbjct: 159 RYVVSGSMDNSIRVFDIESGKLLGTYADHNHYVQGVTWDPLNEFILSQSADRSVNIYQII 218

 Score = 31.6 bits (70), Expect = 2.4,   Method: Compositional matrix adjust.
 Identities = 27/101 (26%), Positives = 46/101 (45%), Gaps = 11/101 (10%)

Query: 393 KVIVSGSADKTVKVWHVES-RTCYTLRGHTEWVNCVKLHPKSFSCFSCSDDTTIR----M 447
           + +VSGS D +++V+ +ES +   T   H  +V  V   P +    S S D ++     +
Sbjct: 159 RYVVSGSMDNSIRVFDIESGKLLGTYADHNHYVQGVTWDPLNEFILSQSADRSVNIYQII 218

Query: 448 WDIRTNSCLK------VFRGHVGQVQKIIPLTIKDVENLAT 482
           WD  +N+  K      + +G + Q       T  D +NL T
Sbjct: 219 WDSDSNTIDKLKLKNRIMKGELPQRDDENDKTKLDYKNLKT 259

>Scas_571.4
          Length = 601

 Score = 45.1 bits (105), Expect = 1e-04,   Method: Compositional matrix adjust.
 Identities = 31/134 (23%), Positives = 54/134 (40%), Gaps = 19/134 (14%)

Query: 350 FDDRKLITGSLDKTIRVWNYITGECISTYR----------------GHSDSVLSV---DS 390
           F+D K+ + S D  I +WN      + TYR                GH+  V  V     
Sbjct: 100 FNDFKIASASDDGKIGIWNIPMNYSMRTYRDSENKPMDIRPSKILSGHTRKVGHVLFHPR 159

Query: 391 YQKVIVSGSADKTVKVWHVESRTCYTLRGHTEWVNCVKLHPKSFSCFSCSDDTTIRMWDI 450
            + V+ S S D TVK+W+++         H++ V  +   P      + + +  + +WDI
Sbjct: 160 IRNVLASSSLDFTVKIWNIKKGKVIGTLQHSDMVTAMAFDPDGAYLATITRNKKLTIWDI 219

Query: 451 RTNSCLKVFRGHVG 464
            +   +   + H G
Sbjct: 220 ASKQIVSQTKSHQG 233

 Score = 40.8 bits (94), Expect = 0.003,   Method: Compositional matrix adjust.
 Identities = 33/122 (27%), Positives = 60/122 (49%), Gaps = 13/122 (10%)

Query: 298 FKGHMDGVLTLQFNYRL---LFTGSYDSTIGIWDLFTGKLIRRLSGHSDGVKTLYF--DD 352
             GH   V  + F+ R+   L + S D T+ IW++  GK+I  L  HSD V  + F  D 
Sbjct: 144 LSGHTRKVGHVLFHPRIRNVLASSSLDFTVKIWNIKKGKVIGTLQ-HSDMVTAMAFDPDG 202

Query: 353 RKLITGSLDKTIRVWNYITGECIS---TYRGHSDSVLSVDSYQKVIV----SGSADKTVK 405
             L T + +K + +W+  + + +S   +++G  +  +    Y ++I     S S D+ + 
Sbjct: 203 AYLATITRNKKLTIWDIASKQIVSQTKSHQGPKNQRVVWLGYSRIIATTGFSKSMDREIG 262

Query: 406 VW 407
           +W
Sbjct: 263 IW 264

 Score = 34.7 bits (78), Expect = 0.23,   Method: Compositional matrix adjust.
 Identities = 40/172 (23%), Positives = 65/172 (37%), Gaps = 34/172 (19%)

Query: 417 LRGHTEWVNCVKLHP-KSFSCFSCSDDTTIRMWDIRTNSCLKVFRGHVGQVQKIIPLTIK 475
            RGH   V      P   F   S SDD  I +W+I  N  ++ +R    +   I P  I 
Sbjct: 85  FRGHKGQVLDTDFDPFNDFKIASASDDGKIGIWNIPMNYSMRTYRDSENKPMDIRPSKI- 143

Query: 476 DVENLATDNTSDGSSPQDDPTMTDGADESDTPSNEQETVLDENIPYPTHLLSCGLDNTIK 535
                 + +T         P +                    N+     L S  LD T+K
Sbjct: 144 -----LSGHTRKVGHVLFHPRI-------------------RNV-----LASSSLDFTVK 174

Query: 536 LWDVKTGKCIRTQFGHVEGVWDIA--ADNFRIISGSHDGSIKVWDLQSGKCM 585
           +W++K GK I T   H + V  +A   D   + + + +  + +WD+ S + +
Sbjct: 175 IWNIKKGKVIGT-LQHSDMVTAMAFDPDGAYLATITRNKKLTIWDIASKQIV 225

>KLLA0B02827g 254447..257275 similar to sp|Q06078 Saccharomyces
           cerevisiae YLR409c singleton, start by similarity
          Length = 942

 Score = 45.1 bits (105), Expect = 2e-04,   Method: Compositional matrix adjust.
 Identities = 24/57 (42%), Positives = 36/57 (63%), Gaps = 2/57 (3%)

Query: 321 DSTIGIWDLFTGKLIRRLSGHSDGVKTLYF--DDRKLITGSLDKTIRVWNYITGECI 375
           D +I + D  T K++R+L GHS+ + +  F  D R +++ SLD TIR W+  TG CI
Sbjct: 566 DLSIVVVDSVTQKVVRQLWGHSNRISSFDFSPDGRWIVSSSLDSTIRTWDLPTGGCI 622

 Score = 38.9 bits (89), Expect = 0.014,   Method: Compositional matrix adjust.
 Identities = 26/89 (29%), Positives = 47/89 (52%), Gaps = 6/89 (6%)

Query: 525 LLSCGLDN-TIKLWDVKTGKCIRTQFGHVEGV--WDIAADNFRIISGSHDGSIKVWDLQS 581
           L +  LD+ +I + D  T K +R  +GH   +  +D + D   I+S S D +I+ WDL +
Sbjct: 559 LFALALDDLSIVVVDSVTQKVVRQLWGHSNRISSFDFSPDGRWIVSSSLDSTIRTWDLPT 618

Query: 582 GKCMHTFNGRRLQRETQHTQTQSLGDKVA 610
           G C+   +G +++    + +    GD +A
Sbjct: 619 GGCI---DGMKVENVITNIKFSPNGDLLA 644

 Score = 37.4 bits (85), Expect = 0.045,   Method: Compositional matrix adjust.
 Identities = 35/155 (22%), Positives = 61/155 (39%), Gaps = 24/155 (15%)

Query: 316 FTGSYDSTIGIWDLFTGKLIRRLSGHSDGVKTLYFD--DRKLITGSLDKTIRVWNYITGE 373
             GS +  I + +L +G+  +    H   V  +  D  +RK+++  LD  +  +++    
Sbjct: 478 LVGSSNGGISVHNLQSGQKRKVYRLHKKAVTGIAMDGMNRKMVSCGLDGIVGFYDFSKST 537

Query: 374 CIS-----------TYRGHSD-SVLSVDSYQKVIVSGSADKTVKVWHVESRTCYTLRGHT 421
            +             Y   SD   L++D    V+V     K V+           L GH+
Sbjct: 538 FLGKLKLDSPITSMVYHRSSDLFALALDDLSIVVVDSVTQKVVR----------QLWGHS 587

Query: 422 EWVNCVKLHPKSFSCFSCSDDTTIRMWDIRTNSCL 456
             ++     P      S S D+TIR WD+ T  C+
Sbjct: 588 NRISSFDFSPDGRWIVSSSLDSTIRTWDLPTGGCI 622

>AER081C [2586] [Homologous to ScYLR409C - SH] (785301..788372)
           [3072 bp, 1023 aa]
          Length = 1023

 Score = 45.1 bits (105), Expect = 2e-04,   Method: Compositional matrix adjust.
 Identities = 23/61 (37%), Positives = 36/61 (59%), Gaps = 2/61 (3%)

Query: 321 DSTIGIWDLFTGKLIRRLSGHSDGVKTLYF--DDRKLITGSLDKTIRVWNYITGECISTY 378
           D +I + D  T +++R+L GHS+ +    F  D R +++ SLD T+R W+  TG CI   
Sbjct: 652 DFSIQVIDSVTQRVVRQLWGHSNRITAFDFSPDGRWIVSASLDSTLRTWDLPTGTCIDGV 711

Query: 379 R 379
           R
Sbjct: 712 R 712

 Score = 44.3 bits (103), Expect = 3e-04,   Method: Compositional matrix adjust.
 Identities = 27/91 (29%), Positives = 50/91 (54%), Gaps = 6/91 (6%)

Query: 523 THLLSCGLDN-TIKLWDVKTGKCIRTQFGHVEGV--WDIAADNFRIISGSHDGSIKVWDL 579
           + L +  LD+ +I++ D  T + +R  +GH   +  +D + D   I+S S D +++ WDL
Sbjct: 643 SELFAVALDDFSIQVIDSVTQRVVRQLWGHSNRITAFDFSPDGRWIVSASLDSTLRTWDL 702

Query: 580 QSGKCMHTFNGRRLQRETQHTQTQSLGDKVA 610
            +G C+   +G RL+    + Q  + GD +A
Sbjct: 703 PTGTCI---DGVRLESVATNVQFSANGDILA 730

 Score = 43.1 bits (100), Expect = 6e-04,   Method: Compositional matrix adjust.
 Identities = 36/154 (23%), Positives = 67/154 (43%), Gaps = 6/154 (3%)

Query: 311 NYRLLFTGSYDSTIGIWDLFTGKLIRRLSGHSDGVKTLYFD--DRKLITGSLDKTIRVWN 368
           N+ L+  GS +  I +++L +G   +    H   V  L  D  +RK+++  LD  +  ++
Sbjct: 561 NFALI--GSSNGGISVYNLQSGIKRKVYKMHKGSVTGLAVDGMNRKMVSCGLDGLVGFYD 618

Query: 369 YITGECISTYR-GHSDSVLSVDSYQKVIVSGSADKTVKVW-HVESRTCYTLRGHTEWVNC 426
           + T   +   + G   + L      ++      D +++V   V  R    L GH+  +  
Sbjct: 619 FTTNSFLGKLQLGAPITQLVYHRASELFAVALDDFSIQVIDSVTQRVVRQLWGHSNRITA 678

Query: 427 VKLHPKSFSCFSCSDDTTIRMWDIRTNSCLKVFR 460
               P      S S D+T+R WD+ T +C+   R
Sbjct: 679 FDFSPDGRWIVSASLDSTLRTWDLPTGTCIDGVR 712

>YBR103W (SIF2) [292] chr2 (447666..449273) Protein involved in
           telomere silencing, interacts with Sir4p and targets
           Sir4p from telomeres to other sites, component of Set3p
           complex, has WD (WD-40) repeats [1608 bp, 535 aa]
          Length = 535

 Score = 44.7 bits (104), Expect = 2e-04,   Method: Compositional matrix adjust.
 Identities = 37/141 (26%), Positives = 60/141 (42%), Gaps = 28/141 (19%)

Query: 344 GVKTLYFDDRKLITGSLDKTIRVWNYITGECISTYRGHSD--SVLSVDSYQKVIVSGSAD 401
           GV   + DD K +       I V+            GH    SVL  +   K+++S S D
Sbjct: 321 GVDVEWVDDDKFVIPGPKGAIFVYQITEKTPTGKLIGHHGPISVLEFNDTNKLLLSASDD 380

Query: 402 KTVKVWHV---ESRTCYTLRGHTE------WVNCVKLHPKSFSCFSCSDDTTIRMWDIRT 452
            T+++WH     S+ C+   GH++      WV   K+        SCS D ++R+W ++ 
Sbjct: 381 GTLRIWHGGNGNSQNCF--YGHSQSIVSASWVGDDKV-------ISCSMDGSVRLWSLKQ 431

Query: 453 NSCLK--------VFRGHVGQ 465
           N+ L         +F G + Q
Sbjct: 432 NTLLALSIVDGVPIFAGRISQ 452

 Score = 44.3 bits (103), Expect = 2e-04,   Method: Compositional matrix adjust.
 Identities = 29/90 (32%), Positives = 48/90 (53%), Gaps = 7/90 (7%)

Query: 331 TGKLIRRLSGHSDGVKTLYFDD--RKLITGSLDKTIRVWNYITGECISTYRGHSDSVLSV 388
           TGKLI    GH   +  L F+D  + L++ S D T+R+W+   G   + + GHS S++S 
Sbjct: 352 TGKLI----GHHGPISVLEFNDTNKLLLSASDDGTLRIWHGGNGNSQNCFYGHSQSIVSA 407

Query: 389 D-SYQKVIVSGSADKTVKVWHVESRTCYTL 417
                  ++S S D +V++W ++  T   L
Sbjct: 408 SWVGDDKVISCSMDGSVRLWSLKQNTLLAL 437

 Score = 37.4 bits (85), Expect = 0.035,   Method: Compositional matrix adjust.
 Identities = 24/71 (33%), Positives = 36/71 (50%), Gaps = 3/71 (4%)

Query: 300 GHMDGVLTLQFN--YRLLFTGSYDSTIGIWDLFTGKLIRRLSGHSDG-VKTLYFDDRKLI 356
           GH   +  L+FN   +LL + S D T+ IW    G       GHS   V   +  D K+I
Sbjct: 357 GHHGPISVLEFNDTNKLLLSASDDGTLRIWHGGNGNSQNCFYGHSQSIVSASWVGDDKVI 416

Query: 357 TGSLDKTIRVW 367
           + S+D ++R+W
Sbjct: 417 SCSMDGSVRLW 427

 Score = 34.7 bits (78), Expect = 0.24,   Method: Compositional matrix adjust.
 Identities = 37/168 (22%), Positives = 71/168 (42%), Gaps = 22/168 (13%)

Query: 315 LFTGSYDSTIGIWDLFTGKLIRRLSGHSDGVKTLYF--DDRKLITGSLDKTIRVWNYITG 372
           + TG  +  + +W+  TG L+  L+ H   + ++ +  D   +I+  ++    +WN I+G
Sbjct: 235 IVTGVENGELRLWNK-TGALLNVLNFHRAPIVSVKWNKDGTHIISMDVENVTILWNVISG 293

Query: 373 ECISTYR------------GHS-DSVLSVDSY----QKVIVSGSADKTVKVWHVESRT-C 414
             +  +              HS D  L VD       K ++ G     + V+ +  +T  
Sbjct: 294 TVMQHFELKETGGSSINAENHSGDGSLGVDVEWVDDDKFVIPGPK-GAIFVYQITEKTPT 352

Query: 415 YTLRGHTEWVNCVKLHPKSFSCFSCSDDTTIRMWDIRTNSCLKVFRGH 462
             L GH   ++ ++ +  +    S SDD T+R+W     +    F GH
Sbjct: 353 GKLIGHHGPISVLEFNDTNKLLLSASDDGTLRIWHGGNGNSQNCFYGH 400

 Score = 32.3 bits (72), Expect = 1.1,   Method: Compositional matrix adjust.
 Identities = 17/62 (27%), Positives = 32/62 (51%), Gaps = 1/62 (1%)

Query: 525 LLSCGLDNTIKLWDVKTGKCIRTQFGHVEGVWDIA-ADNFRIISGSHDGSIKVWDLQSGK 583
           LLS   D T+++W    G      +GH + +   +   + ++IS S DGS+++W L+   
Sbjct: 374 LLSASDDGTLRIWHGGNGNSQNCFYGHSQSIVSASWVGDDKVISCSMDGSVRLWSLKQNT 433

Query: 584 CM 585
            +
Sbjct: 434 LL 435

>YPR137W (RRP9) [5555] chr16 (802353..804074) Protein component of
           U3 snoRNP (also called small subunit processome) which
           is required for 18S rRNA biogenesis, required for
           pre-rRNA processing [1722 bp, 573 aa]
          Length = 573

 Score = 44.7 bits (104), Expect = 2e-04,   Method: Compositional matrix adjust.
 Identities = 60/227 (26%), Positives = 92/227 (40%), Gaps = 30/227 (13%)

Query: 373 ECISTYRGHSDSVLSVDSYQ--KVIVSGSADKTVKVWHVESRTCYTL------RGHTEWV 424
           E  +T  GH D +L+V +    K +V+G  D+ + VW  ES +   +      RG    V
Sbjct: 227 EYENTTEGHYDEILTVAASPDGKYVVTGGRDRKLIVWSTESLSPVKVIPTKDRRGE---V 283

Query: 425 NCVKLHPKSFSCFSCSDDTTIRMWDIRTNSCLKVFRGHVGQVQKIIPLTIKD-VENLATD 483
             +     S   ++   D  IR + I   S L++  GH   V+ I  L ++  V   A D
Sbjct: 284 LSLAFRKNSDQLYASCADFKIRTYSINQFSQLEILYGHHDIVEDISALAMERCVTVGARD 343

Query: 484 NTSDGSSPQDDPTMT-DGADESDTPSNEQETVLDENIPYPTHLLSCGLDNTIKLWDVKTG 542
            T+      D+  +T  G DE   P       + EN          G D  +K  D    
Sbjct: 344 RTAMLWKIPDETRLTFRGGDE---PQKLLRRWMKENA-------KEGEDGEVKYPDESEA 393

Query: 543 KCIRTQFGHVEGVWDIAA--DNFRIISGSHDGSIKVWDLQSGKCMHT 587
                     EG  D+ +  D+F  I+GS +G+I +W L   K + T
Sbjct: 394 PLF-----FCEGSIDVVSMVDDFHFITGSDNGNICLWSLAKKKPIFT 435

 Score = 34.7 bits (78), Expect = 0.24,   Method: Compositional matrix adjust.
 Identities = 30/132 (22%), Positives = 55/132 (41%), Gaps = 8/132 (6%)

Query: 299 KGHMDGVLTLQF--NYRLLFTGSYDSTIGIWDLFTGKLIRRLSGHSDGVKTLYFDDRK-- 354
           +GH D +LT+    + + + TG  D  + +W   +   ++ +       + L    RK  
Sbjct: 233 EGHYDEILTVAASPDGKYVVTGGRDRKLIVWSTESLSPVKVIPTKDRRGEVLSLAFRKNS 292

Query: 355 --LITGSLDKTIRVWNYITGECISTYRGHSDSV--LSVDSYQKVIVSGSADKTVKVWHVE 410
             L     D  IR ++      +    GH D V  +S  + ++ +  G+ D+T  +W + 
Sbjct: 293 DQLYASCADFKIRTYSINQFSQLEILYGHHDIVEDISALAMERCVTVGARDRTAMLWKIP 352

Query: 411 SRTCYTLRGHTE 422
             T  T RG  E
Sbjct: 353 DETRLTFRGGDE 364

>Kwal_23.4118
          Length = 939

 Score = 44.7 bits (104), Expect = 2e-04,   Method: Compositional matrix adjust.
 Identities = 37/159 (23%), Positives = 64/159 (40%), Gaps = 24/159 (15%)

Query: 316 FTGSYDSTIGIWDLFTGKLIRRLSGHSDGVKTLYFD--DRKLITGSLDKTIRVWNYITGE 373
           F GS +  IG+++L +G   ++   H   V  +  D  +RK+++  LD  +  +++    
Sbjct: 477 FVGSSNGGIGVYNLQSGLPRKKYRLHKKAVSGIAVDGMNRKMVSCGLDGIVGFYDFSKSS 536

Query: 374 CIS-----------TYRGHSD-SVLSVDSYQKVIVSGSADKTVKVWHVESRTCYTLRGHT 421
            +             Y   SD   L++D +  V+V     K V+           L GH+
Sbjct: 537 YLGKLQLDAPVTSMVYHRSSDLFALALDDFSIVVVDAVTQKVVR----------QLWGHS 586

Query: 422 EWVNCVKLHPKSFSCFSCSDDTTIRMWDIRTNSCLKVFR 460
             ++     P      S S D T R WD+ T  C+   R
Sbjct: 587 NRISSFDFSPDGRWIISTSLDGTARTWDLPTGCCIDGIR 625

 Score = 39.7 bits (91), Expect = 0.008,   Method: Compositional matrix adjust.
 Identities = 29/89 (32%), Positives = 45/89 (50%), Gaps = 6/89 (6%)

Query: 525 LLSCGLDN-TIKLWDVKTGKCIRTQFGHVEGV--WDIAADNFRIISGSHDGSIKVWDLQS 581
           L +  LD+ +I + D  T K +R  +GH   +  +D + D   IIS S DG+ + WDL +
Sbjct: 558 LFALALDDFSIVVVDAVTQKVVRQLWGHSNRISSFDFSPDGRWIISTSLDGTARTWDLPT 617

Query: 582 GKCMHTFNGRRLQRETQHTQTQSLGDKVA 610
           G C+   +G RL     + +     D VA
Sbjct: 618 GCCI---DGIRLDSVATNIRFSPNADFVA 643

>Sklu_675.1 YMR146C, Contig c675 761-1687
          Length = 308

 Score = 43.9 bits (102), Expect = 3e-04,   Method: Compositional matrix adjust.
 Identities = 25/96 (26%), Positives = 46/96 (47%), Gaps = 5/96 (5%)

Query: 525 LLSCGLDNTIKLWDVKTGKCIRTQFGHVEGVWDIAADNF--RIISGSHDGSIKVWDLQSG 582
           + SC  D+   +W    G+ + T  GH+  +W I  D F    ++GS D S+K+W +  G
Sbjct: 25  IFSCAKDSVASVWYAINGERLGTFEGHMGTIWSIDVDQFTEYAVTGSADFSVKLWKVCDG 84

Query: 583 KCMHTFNGRRLQRETQHTQTQSLGDKVAPIACVCIG 618
             ++T+  +   R  + +     GDK+  +    +G
Sbjct: 85  SNVYTWKTKTPVRRVEFSPA---GDKILAVLDGVMG 117

 Score = 43.1 bits (100), Expect = 4e-04,   Method: Compositional matrix adjust.
 Identities = 30/102 (29%), Positives = 49/102 (48%), Gaps = 9/102 (8%)

Query: 361 DKTIRVWNYITGECISTYRGHSDSVLS--VDSYQKVIVSGSADKTVKVWHV-ESRTCYTL 417
           D    VW  I GE + T+ GH  ++ S  VD + +  V+GSAD +VK+W V +    YT 
Sbjct: 31  DSVASVWYAINGERLGTFEGHMGTIWSIDVDQFTEYAVTGSADFSVKLWKVCDGSNVYTW 90

Query: 418 RGHTEWVNCVKLHPKSFSCFSCSDDT-----TIRMWDIRTNS 454
           +  T  V  V+  P      +  D       ++ ++D+  N+
Sbjct: 91  KTKTP-VRRVEFSPAGDKILAVLDGVMGYAGSVTVYDVVRNT 131

 Score = 35.0 bits (79), Expect = 0.17,   Method: Compositional matrix adjust.
 Identities = 20/86 (23%), Positives = 41/86 (47%), Gaps = 4/86 (4%)

Query: 298 FKGHMDGVLTLQFNYR--LLFTGSYDSTIGIWDLFTGKLIRRLSGHSDGVKTLYFDD--R 353
            KGH   +  +++N    L+F+ + DS   +W    G+ +    GH   + ++  D    
Sbjct: 6   LKGHERSLTQVKYNREGDLIFSCAKDSVASVWYAINGERLGTFEGHMGTIWSIDVDQFTE 65

Query: 354 KLITGSLDKTIRVWNYITGECISTYR 379
             +TGS D ++++W    G  + T++
Sbjct: 66  YAVTGSADFSVKLWKVCDGSNVYTWK 91

 Score = 33.5 bits (75), Expect = 0.42,   Method: Compositional matrix adjust.
 Identities = 16/53 (30%), Positives = 25/53 (47%)

Query: 417 LRGHTEWVNCVKLHPKSFSCFSCSDDTTIRMWDIRTNSCLKVFRGHVGQVQKI 469
           L+GH   +  VK + +    FSC+ D+   +W       L  F GH+G +  I
Sbjct: 6   LKGHERSLTQVKYNREGDLIFSCAKDSVASVWYAINGERLGTFEGHMGTIWSI 58

>Sklu_2364.4 YGL003C, Contig c2364 7265-8932 reverse complement
          Length = 555

 Score = 44.3 bits (103), Expect = 3e-04,   Method: Compositional matrix adjust.
 Identities = 39/150 (26%), Positives = 66/150 (44%), Gaps = 7/150 (4%)

Query: 315 LFTGSYDSTIGIWDLFTGKLIRRLSGHSDGVKTLYFDDRKLITGSLDKTIRVWNYITGE- 373
           L  G  +  + I+D+   K IR LSGH D V  L +++  L +GS D+ I   +    E 
Sbjct: 306 LAVGQGNGLVEIYDIVKRKCIRTLSGHMDRVACLSWNNHILTSGSRDRKILHRDVRMPEP 365

Query: 374 CISTYRGHSDSV--LSVDSYQKVIVSGSADKTVKVWHVESR-TCYTLRGHTEWVNCVKLH 430
                  H+  V  L  ++ +  + SG  D  V V+   SR     L  HT  V  +   
Sbjct: 366 YFEQVETHTQEVCGLKWNTDENRLASGGNDNVVYVYDGTSRKPTLKLAEHTAAVKAIAWS 425

Query: 431 PKSFSCFSC---SDDTTIRMWDIRTNSCLK 457
           P      +    + D  +++W++ T++ L+
Sbjct: 426 PHKRGILATGGGTADKKMKIWNVNTSTKLR 455

 Score = 41.2 bits (95), Expect = 0.002,   Method: Compositional matrix adjust.
 Identities = 33/127 (25%), Positives = 64/127 (50%), Gaps = 8/127 (6%)

Query: 295 IQEFKGHMDGVLTLQFNYRLLFTGSYDSTIGIWDL-FTGKLIRRLSGHSDGVKTLYF--D 351
           I+   GHMD V  L +N  +L +GS D  I   D+        ++  H+  V  L +  D
Sbjct: 326 IRTLSGHMDRVACLSWNNHILTSGSRDRKILHRDVRMPEPYFEQVETHTQEVCGLKWNTD 385

Query: 352 DRKLITGSLDKTIRVWNYITGECISTYRGHSDSVLSV--DSYQKVIVS---GSADKTVKV 406
           + +L +G  D  + V++  + +       H+ +V ++    +++ I++   G+ADK +K+
Sbjct: 386 ENRLASGGNDNVVYVYDGTSRKPTLKLAEHTAAVKAIAWSPHKRGILATGGGTADKKMKI 445

Query: 407 WHVESRT 413
           W+V + T
Sbjct: 446 WNVNTST 452

 Score = 38.1 bits (87), Expect = 0.020,   Method: Compositional matrix adjust.
 Identities = 25/100 (25%), Positives = 52/100 (52%), Gaps = 5/100 (5%)

Query: 318 GSYDSTIGIWDLFTGKLIRRLSGHSDGVKTLYFDD-RKLIT--GSLDKTIRVWNYITGEC 374
           G+ D  + IW++ T   +R +   S     ++  +  +L+T  G     + +W+Y + E 
Sbjct: 437 GTADKKMKIWNVNTSTKLRDIDTGSQVCNMIWSKNTNELVTSHGYSRYNLTLWDYPSMEP 496

Query: 375 ISTYRGHSDSVL--SVDSYQKVIVSGSADKTVKVWHVESR 412
           ++  +GHS  VL  ++ +    +VSG+ D+T++ W +  R
Sbjct: 497 VAILKGHSFRVLHLTLSADGTTVVSGAGDETLRYWKLFDR 536

 Score = 33.1 bits (74), Expect = 0.69,   Method: Compositional matrix adjust.
 Identities = 17/52 (32%), Positives = 30/52 (57%)

Query: 523 THLLSCGLDNTIKLWDVKTGKCIRTQFGHVEGVWDIAADNFRIISGSHDGSI 574
           +HL     +  ++++D+   KCIRT  GH++ V  ++ +N  + SGS D  I
Sbjct: 304 SHLAVGQGNGLVEIYDIVKRKCIRTLSGHMDRVACLSWNNHILTSGSRDRKI 355

 Score = 32.7 bits (73), Expect = 1.1,   Method: Compositional matrix adjust.
 Identities = 51/233 (21%), Positives = 93/233 (39%), Gaps = 13/233 (5%)

Query: 355 LITGSLDKTIRVWNYITGECISTYRGHSDSVLSVDSYQKVIVSGSADKTVKVWHVESRTC 414
           L  G  +  + +++ +  +CI T  GH D V  +     ++ SGS D+  K+ H + R  
Sbjct: 306 LAVGQGNGLVEIYDIVKRKCIRTLSGHMDRVACLSWNNHILTSGSRDR--KILHRDVRMP 363

Query: 415 YT----LRGHTEWVNCVKLHPKSFSCFSCSDDTTIRMWDIRTNSCLKVFRGHVGQVQKII 470
                 +  HT+ V  +K +       S  +D  + ++D  +         H   V K I
Sbjct: 364 EPYFEQVETHTQEVCGLKWNTDENRLASGGNDNVVYVYDGTSRKPTLKLAEHTAAV-KAI 422

Query: 471 PLTIKDVENLATDN-TSDGSSPQDDPTMTDGADESDTPSNEQETVLDENIPYPTHLLSCG 529
             +      LAT   T+D      +   +    + DT S     +  +N      + S G
Sbjct: 423 AWSPHKRGILATGGGTADKKMKIWNVNTSTKLRDIDTGSQVCNMIWSKNTN--ELVTSHG 480

Query: 530 LDN-TIKLWDVKTGKCIRTQFGHVEGVW--DIAADNFRIISGSHDGSIKVWDL 579
                + LWD  + + +    GH   V    ++AD   ++SG+ D +++ W L
Sbjct: 481 YSRYNLTLWDYPSMEPVAILKGHSFRVLHLTLSADGTTVVSGAGDETLRYWKL 533

>Kwal_27.10385
          Length = 536

 Score = 44.3 bits (103), Expect = 3e-04,   Method: Compositional matrix adjust.
 Identities = 22/71 (30%), Positives = 39/71 (54%), Gaps = 2/71 (2%)

Query: 351 DDRKLITGSLDKTIRVWNYITGECISTYRGHSDSVLSV--DSYQKVIVSGSADKTVKVWH 408
           DD  ++TGS+D ++R++    G C++    H+  V  V  D   + I S SAD++V V+ 
Sbjct: 147 DDNYIVTGSMDNSLRIFEVEEGTCVANAADHNHYVQGVVWDPQNEFIFSQSADRSVHVYR 206

Query: 409 VESRTCYTLRG 419
           +E     ++ G
Sbjct: 207 IEKTPSGSISG 217

 Score = 33.9 bits (76), Expect = 0.47,   Method: Compositional matrix adjust.
 Identities = 19/65 (29%), Positives = 37/65 (56%), Gaps = 6/65 (9%)

Query: 520 PYPTHLLSCGLDNTIKLWDVKTGKCIRTQFGH---VEG-VWDIAADNFRIISGSHDGSIK 575
           P   ++++  +DN++++++V+ G C+     H   V+G VWD    N  I S S D S+ 
Sbjct: 146 PDDNYIVTGSMDNSLRIFEVEEGTCVANAADHNHYVQGVVWD--PQNEFIFSQSADRSVH 203

Query: 576 VWDLQ 580
           V+ ++
Sbjct: 204 VYRIE 208

>Sklu_1659.2 YMR092C, Contig c1659 410-2251
          Length = 613

 Score = 44.3 bits (103), Expect = 3e-04,   Method: Compositional matrix adjust.
 Identities = 26/90 (28%), Positives = 49/90 (54%), Gaps = 4/90 (4%)

Query: 319 SYDSTIGIWDLFTGKLIRRLSGHSDGVKTLYFDDRKLITGSLDKTIRVWNYITGECISTY 378
           S D T+ I+ +    L+RR+ GH+ G+  L  +   L++GS D  +  W       +  Y
Sbjct: 315 SLDGTLNIFKIGEDSLVRRIEGHNKGITALVVN--PLVSGSYDGRVVQWINENEPHMENY 372

Query: 379 RGHSDSVLSVDSYQKVIVSGSADKTVKVWH 408
             H + ++S+D+  K++ + S D T+KV++
Sbjct: 373 --HGNMIVSIDNTDKIVSTVSWDDTLKVFN 400

 Score = 32.3 bits (72), Expect = 1.2,   Method: Compositional matrix adjust.
 Identities = 20/75 (26%), Positives = 40/75 (53%), Gaps = 9/75 (12%)

Query: 524 HLLSCGLDNTIKLWDVKTGKCIRTQFGHVEGV--------W-DIAADNFRIISGSHDGSI 574
           + +S G D  I  +D KTG+ I+      E +        W D   ++ + ++ S D ++
Sbjct: 217 YAISVGSDRKIVCYDGKTGEFIKYIEDTKENINGGLFAISWIDEGENSNKFVTSSADCTL 276

Query: 575 KVWDLQSGKCMHTFN 589
           K+WD++S KC+ +++
Sbjct: 277 KLWDVESSKCLQSWS 291

 Score = 32.0 bits (71), Expect = 1.8,   Method: Compositional matrix adjust.
 Identities = 20/89 (22%), Positives = 44/89 (49%), Gaps = 5/89 (5%)

Query: 505 DTPSNEQETVLDENIPYPTHLLSCGLDNTIKLWDVKTGKCIRTQFGHVEGVWDIAADNFR 564
           +T SN+Q  V    +     +++  LD T+ ++ +     +R   GH +G+  +  +   
Sbjct: 294 NTLSNQQVGVA---VTKDHEIVALSLDGTLNIFKIGEDSLVRRIEGHNKGITALVVN--P 348

Query: 565 IISGSHDGSIKVWDLQSGKCMHTFNGRRL 593
           ++SGS+DG +  W  ++   M  ++G  +
Sbjct: 349 LVSGSYDGRVVQWINENEPHMENYHGNMI 377

 Score = 30.8 bits (68), Expect = 3.9,   Method: Compositional matrix adjust.
 Identities = 16/56 (28%), Positives = 35/56 (62%), Gaps = 2/56 (3%)

Query: 314 LLFTGSYDSTIGIWDLFTG-KLIRRLSGHSDGVKTLYFDDRK-LITGSLDKTIRVW 367
           L+ TGS D+ + I+ +    K+I++L+ H DGV  + + +++ +++  +D  I+ W
Sbjct: 553 LVATGSLDTHMFIYSVKRPMKIIKKLNAHKDGVSVVKWKNKETIVSAGVDACIKEW 608

 Score = 30.0 bits (66), Expect = 6.5,   Method: Compositional matrix adjust.
 Identities = 23/75 (30%), Positives = 33/75 (44%), Gaps = 11/75 (14%)

Query: 395 IVSGSADKTVKVWHVESRTCY-------TLRGHTEWVNCVKLHPKSFSCFSCSDDTTIRM 447
            V+ SAD T+K+W VES  C        TL      V   K H       + S D T+ +
Sbjct: 267 FVTSSADCTLKLWDVESSKCLQSWSLENTLSNQQVGVAVTKDH----EIVALSLDGTLNI 322

Query: 448 WDIRTNSCLKVFRGH 462
           + I  +S ++   GH
Sbjct: 323 FKIGEDSLVRRIEGH 337

 Score = 29.6 bits (65), Expect = 9.3,   Method: Compositional matrix adjust.
 Identities = 34/172 (19%), Positives = 73/172 (42%), Gaps = 34/172 (19%)

Query: 317 TGSYDSTIG------IWDLFTGKLIRRLSGHSDGVKTLYF---------DDRKLITGSLD 361
           TG Y  ++G       +D  TG+ I+ +    + +    F         +  K +T S D
Sbjct: 214 TGKYAISVGSDRKIVCYDGKTGEFIKYIEDTKENINGGLFAISWIDEGENSNKFVTSSAD 273

Query: 362 KTIRVWNYITGECISTYRGHSDSVLSVDSYQKV---------IVSGSADKTVKVWHV-ES 411
            T+++W+  + +C+ ++     S+ +  S Q+V         IV+ S D T+ ++ + E 
Sbjct: 274 CTLKLWDVESSKCLQSW-----SLENTLSNQQVGVAVTKDHEIVALSLDGTLNIFKIGED 328

Query: 412 RTCYTLRGHTEWVNCVKLHPKSFSCFSCSDDTTIRMWDIRTNSCLKVFRGHV 463
                + GH + +  + ++P      S S D  +  W       ++ + G++
Sbjct: 329 SLVRRIEGHNKGITALVVNP----LVSGSYDGRVVQWINENEPHMENYHGNM 376

>Scas_465.4
          Length = 1002

 Score = 44.3 bits (103), Expect = 3e-04,   Method: Compositional matrix adjust.
 Identities = 28/96 (29%), Positives = 50/96 (52%), Gaps = 4/96 (4%)

Query: 318 GSYDSTIGIWDLFTGKLIRRLSGHSDGV--KTLYFDDRKLITGSLDKTIRVWNYITGECI 375
           G+    + IWDLF    +  L GH   +   T+  + R + + S D++I++WN  TGE +
Sbjct: 155 GTVMGGVLIWDLFLETKLYNLVGHEGSIFYATISDNGRYITSCSDDRSIKLWNLQTGEEL 214

Query: 376 STYRGHSDSVLSVDSYQK--VIVSGSADKTVKVWHV 409
            T  GH+  + ++  +     ++S S D T +VW +
Sbjct: 215 CTGWGHTARIWNLKFFNNDTQLISVSEDNTCRVWDI 250

 Score = 44.3 bits (103), Expect = 3e-04,   Method: Compositional matrix adjust.
 Identities = 21/58 (36%), Positives = 38/58 (65%), Gaps = 2/58 (3%)

Query: 524 HLLSCGLDNTIKLWDVKTGKCIRTQFGHVEGVWDIAADN--FRIISGSHDGSIKVWDL 579
           ++ SC  D +IKLW+++TG+ + T +GH   +W++   N   ++IS S D + +VWD+
Sbjct: 193 YITSCSDDRSIKLWNLQTGEELCTGWGHTARIWNLKFFNNDTQLISVSEDNTCRVWDI 250

 Score = 40.4 bits (93), Expect = 0.004,   Method: Compositional matrix adjust.
 Identities = 49/214 (22%), Positives = 101/214 (47%), Gaps = 29/214 (13%)

Query: 309 QFNYR--LLFTGSYDSTIGIWDLFTGKLIRR--LSG-----HSDGVKTLYFDDRKLITGS 359
           +FNYR   ++  +  + + + DL TG+++ R  L G     +S  +K    +   +  G+
Sbjct: 98  EFNYRGDQVYLLTCYNKVFVCDL-TGEILSRKTLQGERSILYSGSIKEFSPEKVYISAGT 156

Query: 360 LDKTIRVWNYITGECISTYRGHSDSVL--SVDSYQKVIVSGSADKTVKVWHVES--RTCY 415
           +   + +W+      +    GH  S+   ++    + I S S D+++K+W++++    C 
Sbjct: 157 VMGGVLIWDLFLETKLYNLVGHEGSIFYATISDNGRYITSCSDDRSIKLWNLQTGEELC- 215

Query: 416 TLRGHTEWVNCVKLHPKSFSCFSCSDDTTIRMWDI-----RTNSCL---KVFRGHVGQVQ 467
           T  GHT  +  +K         S S+D T R+WDI       N+ L   +++  H+  ++
Sbjct: 216 TGWGHTARIWNLKFFNNDTQLISVSEDNTCRVWDILQDEGNGNTSLTLSQIYEVHL--IK 273

Query: 468 KIIPLTIKDVENLATDNTSDG----SSPQDDPTM 497
            +  + I++ + +A  + +DG    +  QD  TM
Sbjct: 274 NVWGVDIQEKDMVAVTSGNDGRLKLTKIQDTKTM 307

 Score = 34.3 bits (77), Expect = 0.38,   Method: Compositional matrix adjust.
 Identities = 26/84 (30%), Positives = 44/84 (52%), Gaps = 4/84 (4%)

Query: 294 RIQEFKGHMDGVL--TLQFNYRLLFTGSYDSTIGIWDLFTGKLIRRLSGHSDGVKTLYF- 350
           ++    GH   +   T+  N R + + S D +I +W+L TG+ +    GH+  +  L F 
Sbjct: 171 KLYNLVGHEGSIFYATISDNGRYITSCSDDRSIKLWNLQTGEELCTGWGHTARIWNLKFF 230

Query: 351 -DDRKLITGSLDKTIRVWNYITGE 373
            +D +LI+ S D T RVW+ +  E
Sbjct: 231 NNDTQLISVSEDNTCRVWDILQDE 254

 Score = 33.9 bits (76), Expect = 0.46,   Method: Compositional matrix adjust.
 Identities = 51/236 (21%), Positives = 86/236 (36%), Gaps = 66/236 (27%)

Query: 370 ITGECIS--TYRG-----HSDSVLSVDSYQKVIVSGSADKTVKVWHVESRT-CYTLRGHT 421
           +TGE +S  T +G     +S S+      +  I +G+    V +W +   T  Y L GH 
Sbjct: 120 LTGEILSRKTLQGERSILYSGSIKEFSPEKVYISAGTVMGGVLIWDLFLETKLYNLVGHE 179

Query: 422 EWVNCVKLHPKSFSCFSCSDDTTIRMWDIRTNSCLKVFRGHVGQVQKIIPLTIKDVENLA 481
             +    +        SCSDD +I++W+++T   L    GH  ++            NL 
Sbjct: 180 GSIFYATISDNGRYITSCSDDRSIKLWNLQTGEELCTGWGHTARIW-----------NLK 228

Query: 482 TDNTSDGSSPQDDPTMTDGADESDTPSNEQETVLDENIPYPTHLLSCGLDNTIKLWDV-- 539
             N                                      T L+S   DNT ++WD+  
Sbjct: 229 FFNND------------------------------------TQLISVSEDNTCRVWDILQ 252

Query: 540 --KTGKCIRT-----QFGHVEGVW--DIAADNFRIISGSHDGSIKVWDLQSGKCMH 586
               G    T     +   ++ VW  DI   +   ++  +DG +K+  +Q  K M+
Sbjct: 253 DEGNGNTSLTLSQIYEVHLIKNVWGVDIQEKDMVAVTSGNDGRLKLTKIQDTKTMN 308

>Scas_719.30
          Length = 940

 Score = 44.3 bits (103), Expect = 3e-04,   Method: Compositional matrix adjust.
 Identities = 23/57 (40%), Positives = 35/57 (61%), Gaps = 2/57 (3%)

Query: 321 DSTIGIWDLFTGKLIRRLSGHSDGVKTLYF--DDRKLITGSLDKTIRVWNYITGECI 375
           D +I + D  T +++R+  GHS+ +  L F  D R +++ SLD TIR W+  TG CI
Sbjct: 565 DLSIVLIDAVTQRVVRQFWGHSNRITALDFSPDGRWIVSASLDSTIRTWDLPTGGCI 621

 Score = 43.5 bits (101), Expect = 6e-04,   Method: Compositional matrix adjust.
 Identities = 37/153 (24%), Positives = 67/153 (43%), Gaps = 20/153 (13%)

Query: 316 FTGSYDSTIGIWDLFTGKLIRRLSGHSDGVKTLYFD--DRKLITGSLDKTIRVWNYITGE 373
           F GS +  I ++++ +G L ++   H   V  +  D  +RK+++  LD  +  +++    
Sbjct: 477 FVGSSNGGISVFNMQSGILRKKYRLHKKTVTGIALDGMNRKMVSCGLDGIVGFYDF---- 532

Query: 374 CISTYRGHSDSVLSVDS-YQKVIVSGSAD---------KTVKVWHVESRTCYTLRGHTEW 423
             ST+ G     L +D+   K++   S+D           V +  V  R      GH+  
Sbjct: 533 NKSTFLGK----LQLDAPITKMVYHRSSDLFALILDDLSIVLIDAVTQRVVRQFWGHSNR 588

Query: 424 VNCVKLHPKSFSCFSCSDDTTIRMWDIRTNSCL 456
           +  +   P      S S D+TIR WD+ T  C+
Sbjct: 589 ITALDFSPDGRWIVSASLDSTIRTWDLPTGGCI 621

 Score = 38.9 bits (89), Expect = 0.014,   Method: Compositional matrix adjust.
 Identities = 28/97 (28%), Positives = 47/97 (48%), Gaps = 6/97 (6%)

Query: 525 LLSCGLDN-TIKLWDVKTGKCIRTQFGHVEGV--WDIAADNFRIISGSHDGSIKVWDLQS 581
           L +  LD+ +I L D  T + +R  +GH   +   D + D   I+S S D +I+ WDL +
Sbjct: 558 LFALILDDLSIVLIDAVTQRVVRQFWGHSNRITALDFSPDGRWIVSASLDSTIRTWDLPT 617

Query: 582 GKCMHTFNGRRLQRETQHTQTQSLGDKVAPIACVCIG 618
           G C+   +G +L+      +    GD +A    +  G
Sbjct: 618 GGCI---DGIKLESVATDVKFSPNGDMLATTHVIGNG 651

 Score = 31.6 bits (70), Expect = 2.7,   Method: Compositional matrix adjust.
 Identities = 41/192 (21%), Positives = 65/192 (33%), Gaps = 49/192 (25%)

Query: 356 ITGSLDKTIRVWNYITGECISTYRGHSDSV--LSVDSYQKVIVSGSADKTVKVWHVESRT 413
             GS +  I V+N  +G     YR H  +V  +++D   + +VS   D  V  +     T
Sbjct: 477 FVGSSNGGISVFNMQSGILRKKYRLHKKTVTGIALDGMNRKMVSCGLDGIVGFYDFNKST 536

Query: 414 CYTLRGHTEWVNCVKLHPKSFSCFSCSDDTTIRMWDIRTNSCLKVFRGHVGQVQKIIPLT 473
                     +  +  H  S       DD +I + D  T   ++ F GH  ++       
Sbjct: 537 FLGKLQLDAPITKMVYHRSSDLFALILDDLSIVLIDAVTQRVVRQFWGHSNRIT------ 590

Query: 474 IKDVENLATDNTSDGSSPQDDPTMTDGADESDTPSNEQETVLDENIPYPTHLLSCGLDNT 533
                  A D + DG                                    ++S  LD+T
Sbjct: 591 -------ALDFSPDGR----------------------------------WIVSASLDST 609

Query: 534 IKLWDVKTGKCI 545
           I+ WD+ TG CI
Sbjct: 610 IRTWDLPTGGCI 621

 Score = 31.2 bits (69), Expect = 3.3,   Method: Compositional matrix adjust.
 Identities = 25/78 (32%), Positives = 37/78 (47%), Gaps = 4/78 (5%)

Query: 295 IQEFKGHMDGVLTLQF--NYRLLFTGSYDSTIGIWDLFTGKLIR--RLSGHSDGVKTLYF 350
           +++F GH + +  L F  + R + + S DSTI  WDL TG  I   +L   +  VK    
Sbjct: 579 VRQFWGHSNRITALDFSPDGRWIVSASLDSTIRTWDLPTGGCIDGIKLESVATDVKFSPN 638

Query: 351 DDRKLITGSLDKTIRVWN 368
            D    T  +   I +WN
Sbjct: 639 GDMLATTHVIGNGIYIWN 656

>Kwal_47.17555
          Length = 417

 Score = 43.9 bits (102), Expect = 3e-04,   Method: Compositional matrix adjust.
 Identities = 46/189 (24%), Positives = 76/189 (40%), Gaps = 35/189 (18%)

Query: 298 FKGHMDGVLTLQF--NYRLLFTGSYDSTIGIWDLFTGKLIRRLSGHSDGVKTLYFDDR-- 353
            +GH   +  ++F  +  +L +GS D  + +W    G   R L GH+  V  L   DR  
Sbjct: 144 LEGHYAEITDVKFFPSGEVLLSGSADMQLKVWSTLDGSNPRTLKGHTSTVTALGIIDRGR 203

Query: 354 KLITGSLDKTIRVWNYITGECISTYRGHSD------------SVLSVDSYQKVIVSGSAD 401
            +++ S D ++++W   +GE I ++   +D            S  S +   + +  G+A 
Sbjct: 204 NVMSSSKDGSLKLWECGSGETIHSFARKTDQSDPVNDMLILCSPGSSEDGSRHLEFGTAG 263

Query: 402 KTVKVWHVESRTCY----------TLRGHTEWVNC------VKLHPKSFS---CFSCSDD 442
           KTV   H      Y           L    E   C       + HP S S    ++  D+
Sbjct: 264 KTVFAGHNSGFISYHDIRSKDLTFELPNQFESPCCSLASSTSQFHPASQSPVFLYAGYDN 323

Query: 443 TTIRMWDIR 451
            T+  WDIR
Sbjct: 324 GTVAQWDIR 332

 Score = 43.9 bits (102), Expect = 3e-04,   Method: Compositional matrix adjust.
 Identities = 29/111 (26%), Positives = 52/111 (46%), Gaps = 4/111 (3%)

Query: 352 DRKLITGSLDKTIRVWNYITGECISTYRGHSDSVLSVDSYQ--KVIVSGSADKTVKVWH- 408
           D    TG     I +++    E   T  GH   +  V  +   +V++SGSAD  +KVW  
Sbjct: 119 DYLYATGDQGGIISIYDS-QAEVTRTLEGHYAEITDVKFFPSGEVLLSGSADMQLKVWST 177

Query: 409 VESRTCYTLRGHTEWVNCVKLHPKSFSCFSCSDDTTIRMWDIRTNSCLKVF 459
           ++     TL+GHT  V  + +  +  +  S S D ++++W+  +   +  F
Sbjct: 178 LDGSNPRTLKGHTSTVTALGIIDRGRNVMSSSKDGSLKLWECGSGETIHSF 228

 Score = 42.0 bits (97), Expect = 0.001,   Method: Compositional matrix adjust.
 Identities = 26/72 (36%), Positives = 37/72 (51%), Gaps = 2/72 (2%)

Query: 519 IPYPTHLLSCGLDNTIKLWDVKTGKCIRTQFGHVEGVWDIAA-DNFR-IISGSHDGSIKV 576
            P    LLS   D  +K+W    G   RT  GH   V  +   D  R ++S S DGS+K+
Sbjct: 157 FPSGEVLLSGSADMQLKVWSTLDGSNPRTLKGHTSTVTALGIIDRGRNVMSSSKDGSLKL 216

Query: 577 WDLQSGKCMHTF 588
           W+  SG+ +H+F
Sbjct: 217 WECGSGETIHSF 228

 Score = 41.6 bits (96), Expect = 0.001,   Method: Compositional matrix adjust.
 Identities = 29/102 (28%), Positives = 50/102 (49%), Gaps = 5/102 (4%)

Query: 314 LLFTGSYDSTIGIWDLFTGKLIRRLSGHSDGVKTLYF--DDRKLITGSLDKTIRVWNYIT 371
           L  TG     I I+D    ++ R L GH   +  + F      L++GS D  ++VW+ + 
Sbjct: 121 LYATGDQGGIISIYDS-QAEVTRTLEGHYAEITDVKFFPSGEVLLSGSADMQLKVWSTLD 179

Query: 372 GECISTYRGHSDSV--LSVDSYQKVIVSGSADKTVKVWHVES 411
           G    T +GH+ +V  L +    + ++S S D ++K+W   S
Sbjct: 180 GSNPRTLKGHTSTVTALGIIDRGRNVMSSSKDGSLKLWECGS 221

 Score = 35.0 bits (79), Expect = 0.16,   Method: Compositional matrix adjust.
 Identities = 18/86 (20%), Positives = 34/86 (39%), Gaps = 4/86 (4%)

Query: 388 VDSYQK----VIVSGSADKTVKVWHVESRTCYTLRGHTEWVNCVKLHPKSFSCFSCSDDT 443
           +D Y+     +  +G     + ++  ++    TL GH   +  VK  P      S S D 
Sbjct: 111 IDQYESDGDYLYATGDQGGIISIYDSQAEVTRTLEGHYAEITDVKFFPSGEVLLSGSADM 170

Query: 444 TIRMWDIRTNSCLKVFRGHVGQVQKI 469
            +++W     S  +  +GH   V  +
Sbjct: 171 QLKVWSTLDGSNPRTLKGHTSTVTAL 196

>AFL009C [3184] [Homologous to ScYGL004C - SH] (420007..421248)
           [1242 bp, 413 aa]
          Length = 413

 Score = 43.5 bits (101), Expect = 4e-04,   Method: Compositional matrix adjust.
 Identities = 23/75 (30%), Positives = 36/75 (48%), Gaps = 2/75 (2%)

Query: 519 IPYPTHLLSCGLDNTIKLWDVKTGKCIRTQFGHVEGVWD--IAADNFRIISGSHDGSIKV 576
            P    LLS  +D  +K+W    G   RT FGH   +    +      ++S S DGS+++
Sbjct: 155 FPSGKVLLSASIDMQLKIWSAADGTNPRTLFGHTAPITGCGLIERGRNVLSSSKDGSVRL 214

Query: 577 WDLQSGKCMHTFNGR 591
           W+  SG  +  F+ R
Sbjct: 215 WECGSGSMLRAFHRR 229

 Score = 42.7 bits (99), Expect = 7e-04,   Method: Compositional matrix adjust.
 Identities = 26/83 (31%), Positives = 42/83 (50%), Gaps = 3/83 (3%)

Query: 380 GHSDSVLSVDSY--QKVIVSGSADKTVKVWHVESRTC-YTLRGHTEWVNCVKLHPKSFSC 436
           GHS  + S+  +   KV++S S D  +K+W     T   TL GHT  +    L  +  + 
Sbjct: 144 GHSGHITSLHYFPSGKVLLSASIDMQLKIWSAADGTNPRTLFGHTAPITGCGLIERGRNV 203

Query: 437 FSCSDDTTIRMWDIRTNSCLKVF 459
            S S D ++R+W+  + S L+ F
Sbjct: 204 LSSSKDGSVRLWECGSGSMLRAF 226

 Score = 32.3 bits (72), Expect = 1.1,   Method: Compositional matrix adjust.
 Identities = 26/100 (26%), Positives = 45/100 (45%), Gaps = 9/100 (9%)

Query: 293 CRIQEFKGHMDGVLTLQF--NYRLLFTGSYDSTIGIWDLFTGKLIRRLSGHSDGVK--TL 348
           CR     GH   + +L +  + ++L + S D  + IW    G   R L GH+  +    L
Sbjct: 139 CR--SLDGHSGHITSLHYFPSGKVLLSASIDMQLKIWSAADGTNPRTLFGHTAPITGCGL 196

Query: 349 YFDDRKLITGSLDKTIRVWNYITGECISTYR---GHSDSV 385
               R +++ S D ++R+W   +G  +  +     HSD V
Sbjct: 197 IERGRNVLSSSKDGSVRLWECGSGSMLRAFHRRDRHSDGV 236

>AGR168W [4479] [Homologous to ScYBL008W (HIR1) - SH]
           complement(1061522..1063999) [2478 bp, 825 aa]
          Length = 825

 Score = 43.5 bits (101), Expect = 5e-04,   Method: Compositional matrix adjust.
 Identities = 39/128 (30%), Positives = 57/128 (44%), Gaps = 21/128 (16%)

Query: 301 HMDGVLTLQF--NYRLLFTGSYDSTIGIW---------------DLFTGKLIRRLSGHSD 343
           H   V  L+F  + + L +GS D  + IW               DL    + RRL  H +
Sbjct: 76  HTGSVTALKFSPDNKYLASGSDDKILLIWEKEEGAVQPLFDMENDLEHWNVRRRLVAHDN 135

Query: 344 GVKTLYF--DDRKLITGSLDKTIRVWNYITGECISTYRGHSDSVLSV--DSYQKVIVSGS 399
            ++ + +  D   L+T  LD++I VWN  T E I  +  H   V  V  D   K   + S
Sbjct: 136 DIQDICWAPDSSILVTVGLDRSIIVWNGSTFEKIKRFDVHQSHVKGVVFDPANKYFATAS 195

Query: 400 ADKTVKVW 407
            D+TVKV+
Sbjct: 196 DDRTVKVF 203

>YMR092C (AIP1) [4050] chr13 complement(451631..453478) Actin
           interacting protein, contains eight WD (WD-40) repeats
           [1848 bp, 615 aa]
          Length = 615

 Score = 43.5 bits (101), Expect = 5e-04,   Method: Compositional matrix adjust.
 Identities = 25/72 (34%), Positives = 40/72 (55%), Gaps = 7/72 (9%)

Query: 525 LLSCGLDNTIKLWDVKTGKCI------RTQFGHVEGVWDIAADNFRIISGSHDGSIKVWD 578
             + G D TI++WDV T KC+      + Q G+ + V  +A  N RIIS S DG++  ++
Sbjct: 267 FATVGADATIRVWDVTTSKCVQKWTLDKQQLGN-QQVGVVATGNGRIISLSLDGTLNFYE 325

Query: 579 LQSGKCMHTFNG 590
           L   + + T +G
Sbjct: 326 LGHDEVLKTISG 337

 Score = 35.8 bits (81), Expect = 0.11,   Method: Compositional matrix adjust.
 Identities = 34/147 (23%), Positives = 61/147 (41%), Gaps = 15/147 (10%)

Query: 313 RLLFTGSYDSTIGIWDLFTGKLIRRLSGHSDGVKTLYF-----DDRKLITGSLDKTIRVW 367
             + T   D  I  +D  +G+ ++ +    + V+   F     D +K  T   D TIRVW
Sbjct: 220 EFVITVGSDRKISCFDGKSGEFLKYIEDDQEPVQGGIFALSWLDSQKFATVGADATIRVW 279

Query: 368 NYITGECISTY-----RGHSDSVLSVDSYQKVIVSGSADKTVKVWHV-ESRTCYTLRGHT 421
           +  T +C+  +     +  +  V  V +    I+S S D T+  + +       T+ GH 
Sbjct: 280 DVTTSKCVQKWTLDKQQLGNQQVGVVATGNGRIISLSLDGTLNFYELGHDEVLKTISGHN 339

Query: 422 EWVNCVKLHPKSFSCFSCSDDTTIRMW 448
           + +  + ++P      S S D  I  W
Sbjct: 340 KGITALTVNP----LISGSYDGRIMEW 362

 Score = 33.9 bits (76), Expect = 0.43,   Method: Compositional matrix adjust.
 Identities = 20/59 (33%), Positives = 33/59 (55%), Gaps = 2/59 (3%)

Query: 314 LLFTGSYDSTIGIWDL-FTGKLIRRLSGHSDGVKTLYFD-DRKLITGSLDKTIRVWNYI 370
           L+ TGS D+ I I+ +    K+I+ L+ H DGV  L ++    L++   D  I+ WN +
Sbjct: 555 LVATGSLDTNIFIYSVKRPMKIIKALNAHKDGVNNLLWETPSTLVSSGADACIKRWNVV 613

>Scas_718.6*
          Length = 546

 Score = 43.1 bits (100), Expect = 5e-04,   Method: Compositional matrix adjust.
 Identities = 28/99 (28%), Positives = 52/99 (52%), Gaps = 4/99 (4%)

Query: 315 LFTGSYDSTIGIWDLFTGKLIRRLSGHSDGVKTLYFD--DRKLITGS-LDKTIRVWNYIT 371
           L     + +I ++ +   K I +L GH   +  + F+   R L+T S  D +IR+W+   
Sbjct: 342 LVVPGVNGSILVYSIDDNKPIGKLLGHQGTISCIEFNVNSRLLLTSSDSDYSIRIWHGQK 401

Query: 372 GECISTYRGHSDSVLSVDSYQ-KVIVSGSADKTVKVWHV 409
             C + + GHS S++S+      +++S S D +V++W V
Sbjct: 402 ENCCNCFYGHSQSIISLSWINDDLVISASMDGSVRIWSV 440

 Score = 40.8 bits (94), Expect = 0.003,   Method: Compositional matrix adjust.
 Identities = 46/191 (24%), Positives = 87/191 (45%), Gaps = 21/191 (10%)

Query: 313 RLLFTGSYDSTIGIWDLFTGKLIRRLSGHSDGVKTLYF--DDRKLITGSLDKTIRVWNYI 370
            L+ T   +  + +W+   G+L    + H   + ++ +  D +  I+  LD    +WN I
Sbjct: 251 ELIITSVENGELRLWNK-DGRLQNVFNFHRSPIVSIKWNEDSKHFISLDLDNITILWNAI 309

Query: 371 TGECISTYR-----GHSDSVLSVD----SYQKVIVSGSADKTVKVWHVE-SRTCYTLRGH 420
            G  +  +       ++   L VD       K++V G  + ++ V+ ++ ++    L GH
Sbjct: 310 NGIILQHFEPEQKLENNTESLGVDIEWVDKDKLVVPG-VNGSILVYSIDDNKPIGKLLGH 368

Query: 421 TEWVNCVKLHPKSFSCFSCSD-DTTIRMWDIRTNSCLKVFRGHVGQVQKIIPLT-IKDVE 478
              ++C++ +  S    + SD D +IR+W  +  +C   F GH    Q II L+ I D  
Sbjct: 369 QGTISCIEFNVNSRLLLTSSDSDYSIRIWHGQKENCCNCFYGH---SQSIISLSWIND-- 423

Query: 479 NLATDNTSDGS 489
           +L    + DGS
Sbjct: 424 DLVISASMDGS 434

 Score = 35.0 bits (79), Expect = 0.19,   Method: Compositional matrix adjust.
 Identities = 24/80 (30%), Positives = 41/80 (51%), Gaps = 4/80 (5%)

Query: 295 IQEFKGHMDGVLTLQFNY--RLLFTGS-YDSTIGIWDLFTGKLIRRLSGHSDGVKTL-YF 350
           I +  GH   +  ++FN   RLL T S  D +I IW            GHS  + +L + 
Sbjct: 362 IGKLLGHQGTISCIEFNVNSRLLLTSSDSDYSIRIWHGQKENCCNCFYGHSQSIISLSWI 421

Query: 351 DDRKLITGSLDKTIRVWNYI 370
           +D  +I+ S+D ++R+W+ +
Sbjct: 422 NDDLVISASMDGSVRIWSVV 441

 Score = 30.8 bits (68), Expect = 3.4,   Method: Compositional matrix adjust.
 Identities = 15/56 (26%), Positives = 31/56 (55%), Gaps = 1/56 (1%)

Query: 525 LLSCGLDNTIKLWDVKTGKCIRTQFGHVEGVWDIA-ADNFRIISGSHDGSIKVWDL 579
           L S   D +I++W  +   C    +GH + +  ++  ++  +IS S DGS+++W +
Sbjct: 385 LTSSDSDYSIRIWHGQKENCCNCFYGHSQSIISLSWINDDLVISASMDGSVRIWSV 440

>Scas_642.1
          Length = 934

 Score = 43.1 bits (100), Expect = 6e-04,   Method: Compositional matrix adjust.
 Identities = 39/146 (26%), Positives = 64/146 (43%), Gaps = 22/146 (15%)

Query: 460 RGHVGQVQKIIP----LTIKDVENLATDNTSDGSSPQDDPTMTDGADESDTPSNEQ--ET 513
           RGHV   + I+P    LTI   +N+   +  D  + + D  M D  ++     +E+    
Sbjct: 116 RGHVLLDELILPKIQQLTIN--KNMTCISLPDIRNTRLDYDMDDEMNDDVAEGSEEGLAN 173

Query: 514 VLDENIPYPTHLLSCGLDNTIKLWDVKTGKCIRTQFGHVEGVWDIAA----DNFRIISGS 569
           +L  N+P+          N I+LWD K    I+   G  +  + I +    DN  + SGS
Sbjct: 174 LLIVNLPF----------NEIQLWDYKENLLIQKYMGQRQEQFIIRSCFGYDNKLVASGS 223

Query: 570 HDGSIKVWDLQSGKCMHTFNGRRLQR 595
            DG + +WD   G  +   +G   +R
Sbjct: 224 EDGKVYIWDRVKGNILGVLSGHNKER 249

 Score = 31.2 bits (69), Expect = 3.3,   Method: Compositional matrix adjust.
 Identities = 18/68 (26%), Positives = 33/68 (48%), Gaps = 4/68 (5%)

Query: 324 IGIWDLFTGKLIRRLSGHSDG---VKTLYFDDRKLI-TGSLDKTIRVWNYITGECISTYR 379
           I +WD     LI++  G       +++ +  D KL+ +GS D  + +W+ + G  +    
Sbjct: 184 IQLWDYKENLLIQKYMGQRQEQFIIRSCFGYDNKLVASGSEDGKVYIWDRVKGNILGVLS 243

Query: 380 GHSDSVLS 387
           GH+   LS
Sbjct: 244 GHNKERLS 251

 Score = 31.2 bits (69), Expect = 3.6,   Method: Compositional matrix adjust.
 Identities = 18/57 (31%), Positives = 30/57 (52%), Gaps = 4/57 (7%)

Query: 290 KGHCRIQEFKGHMDGVLTLQ--FNY--RLLFTGSYDSTIGIWDLFTGKLIRRLSGHS 342
           K +  IQ++ G       ++  F Y  +L+ +GS D  + IWD   G ++  LSGH+
Sbjct: 190 KENLLIQKYMGQRQEQFIIRSCFGYDNKLVASGSEDGKVYIWDRVKGNILGVLSGHN 246

>Sklu_2332.7 YER107C, Contig c2332 14211-15314 reverse complement
          Length = 367

 Score = 42.7 bits (99), Expect = 7e-04,   Method: Compositional matrix adjust.
 Identities = 26/96 (27%), Positives = 54/96 (56%), Gaps = 8/96 (8%)

Query: 317 TGSYDSTIGIWDLFTGKLIRRLSGHSDGVKTLYF------DDRKLITGSLDKTIRVWNYI 370
           +G  D+ + ++D+ +G+  +++  H   ++ L F      +   L+TGS DKTI+ W+  
Sbjct: 96  SGGCDNVVKLFDVQSGQA-QQVGAHDSAIRHLRFIQCGPTNTECLVTGSWDKTIKYWDMR 154

Query: 371 TGECISTYRGHSDSVLSVDSYQKVIVSGSADKTVKV 406
             + +ST     D V ++DS QK++V  +A++ + +
Sbjct: 155 QPQPVSTLM-MPDRVYAMDSKQKLLVVATAERHIAI 189

 Score = 34.7 bits (78), Expect = 0.20,   Method: Compositional matrix adjust.
 Identities = 19/57 (33%), Positives = 31/57 (54%), Gaps = 3/57 (5%)

Query: 531 DNTIKLWDVKTGKCI-RTQFGHVEGVWDI--AADNFRIISGSHDGSIKVWDLQSGKC 584
           DN +++WDV  G    R Q+ H   V     + D  ++ SG  D  +K++D+QSG+ 
Sbjct: 57  DNKVRIWDVNGGMAQGRAQYEHQAPVLTTRWSNDGTKVASGGCDNVVKLFDVQSGQA 113

 Score = 33.9 bits (76), Expect = 0.39,   Method: Compositional matrix adjust.
 Identities = 22/77 (28%), Positives = 38/77 (49%), Gaps = 17/77 (22%)

Query: 523 THLLSCGLDNTIKLWDVKTGKCIRTQFGHVEGVWDIAADNFR-----------IISGSHD 571
           T + S G DN +KL+DV++G+  +       G  D A  + R           +++GS D
Sbjct: 92  TKVASGGCDNVVKLFDVQSGQAQQV------GAHDSAIRHLRFIQCGPTNTECLVTGSWD 145

Query: 572 GSIKVWDLQSGKCMHTF 588
            +IK WD++  + + T 
Sbjct: 146 KTIKYWDMRQPQPVSTL 162

 Score = 30.8 bits (68), Expect = 3.4,   Method: Compositional matrix adjust.
 Identities = 26/103 (25%), Positives = 47/103 (45%), Gaps = 10/103 (9%)

Query: 314 LLFTGSYDSTIGIWDLFTGKLIRRLS-GHSDGVKTLYF--DDRKLITGSLDKTIRVWNYI 370
           L    S+D+ + IWD+  G    R    H   V T  +  D  K+ +G  D  +++++  
Sbjct: 50  LFSVSSWDNKVRIWDVNGGMAQGRAQYEHQAPVLTTRWSNDGTKVASGGCDNVVKLFDVQ 109

Query: 371 TGECISTYRGHSDSVLSVDSYQ------KVIVSGSADKTVKVW 407
           +G+       H  ++  +   Q      + +V+GS DKT+K W
Sbjct: 110 SGQA-QQVGAHDSAIRHLRFIQCGPTNTECLVTGSWDKTIKYW 151

>CAGL0A00605g complement(67281..69203) similar to sp|P53197
           Saccharomyces cerevisiae YGL003c CDH1 substrate-specific
           activator of APC-dependent proteolysis, hypothetical
           start
          Length = 640

 Score = 42.7 bits (99), Expect = 7e-04,   Method: Compositional matrix adjust.
 Identities = 39/149 (26%), Positives = 66/149 (44%), Gaps = 7/149 (4%)

Query: 315 LFTGSYDSTIGIWDLFTGKLIRRLSGHSDGVKTLYFDDRKLITGSLDKTIRVWNY-ITGE 373
           L  G  +  + I+D+   K IR LSGH D V  L +++  L +GS D+TI   +  +   
Sbjct: 391 LAIGQGNGIVEIYDVTKEKCIRTLSGHLDRVACLSWNNHILSSGSRDRTILHRDVRMADP 450

Query: 374 CISTYRGHSDSV--LSVDSYQKVIVSGSADKTVKVWHVESRTCY-TLRGHTEWVNCVKLH 430
                  H   +  L  ++    + SG  D  V V+   SRT + ++  H   V  +   
Sbjct: 451 FFEKIETHEQEICGLKWNTNDNKLASGGNDNMVFVYDGTSRTPFLSINEHKAAVKAMAWS 510

Query: 431 PKSFSCFSC---SDDTTIRMWDIRTNSCL 456
           P      +    + D T++MW++ T+  L
Sbjct: 511 PHKQGILATGGGTADRTLKMWNVNTSVKL 539

 Score = 40.4 bits (93), Expect = 0.004,   Method: Compositional matrix adjust.
 Identities = 32/125 (25%), Positives = 63/125 (50%), Gaps = 8/125 (6%)

Query: 295 IQEFKGHMDGVLTLQFNYRLLFTGSYDSTIGIWDL-FTGKLIRRLSGHSDGVKTLYF--D 351
           I+   GH+D V  L +N  +L +GS D TI   D+        ++  H   +  L +  +
Sbjct: 411 IRTLSGHLDRVACLSWNNHILSSGSRDRTILHRDVRMADPFFEKIETHEQEICGLKWNTN 470

Query: 352 DRKLITGSLDKTIRVWNYITGECISTYRGHSDSV--LSVDSYQKVIVS---GSADKTVKV 406
           D KL +G  D  + V++  +     +   H  +V  ++   +++ I++   G+AD+T+K+
Sbjct: 471 DNKLASGGNDNMVFVYDGTSRTPFLSINEHKAAVKAMAWSPHKQGILATGGGTADRTLKM 530

Query: 407 WHVES 411
           W+V +
Sbjct: 531 WNVNT 535

 Score = 34.3 bits (77), Expect = 0.37,   Method: Compositional matrix adjust.
 Identities = 18/52 (34%), Positives = 31/52 (59%)

Query: 523 THLLSCGLDNTIKLWDVKTGKCIRTQFGHVEGVWDIAADNFRIISGSHDGSI 574
           +HL     +  ++++DV   KCIRT  GH++ V  ++ +N  + SGS D +I
Sbjct: 389 SHLAIGQGNGIVEIYDVTKEKCIRTLSGHLDRVACLSWNNHILSSGSRDRTI 440

>Scas_660.8
          Length = 510

 Score = 42.4 bits (98), Expect = 9e-04,   Method: Compositional matrix adjust.
 Identities = 58/231 (25%), Positives = 102/231 (44%), Gaps = 23/231 (9%)

Query: 364 IRVWNYITGECISTYRGHSDSVLSVD--SYQKVIVSGSADKTVKVW-HVESRTCY-TLRG 419
           +++++  T + I T+    D V S    S  K++V+G A   V V+     RT   ++  
Sbjct: 63  VQIFSSRTRQVIKTFSRFKDVVYSASFRSDGKLLVAGDATGLVSVYDSYNPRTILLSINA 122

Query: 420 HTEWVNCVKLHPK-SFSCFSCSDDTTIRMWDIRTNSCLKV-FRGHVGQVQKIIPLTIKDV 477
            T   +  K HP+ + +  + SDD  IR+WDI      ++   G    V+ +    +   
Sbjct: 123 STHPTHVTKFHPQDNKTLITASDDRVIRLWDISNAYQPQLELTGSTDYVRSVT--CVPSA 180

Query: 478 ENLATDNTSDGSSPQDDPTMTDGADESDTPSNEQETVLDENIPY-PTHLLSCGLDNTIKL 536
            ++    + DG     D   T  +  S   S   +  +++ I    T ++SCG  N  K+
Sbjct: 181 PHMIVSGSYDGIIRLYD---TRASGSSPIYSLLHDQPIEDIISISATQIVSCGGSN-FKV 236

Query: 537 WDVKTGKCI--RTQFG-------HVEGVWDIAADNFRIISGSHDGSIKVWD 578
           WD+ + K +  R  F        HV  + D +  N  +I+ S DG +KV+D
Sbjct: 237 WDLTSNKKLYERGNFNKTVTCLDHVSSL-DDSPMNSALIASSLDGHVKVFD 286

 Score = 36.2 bits (82), Expect = 0.079,   Method: Compositional matrix adjust.
 Identities = 43/175 (24%), Positives = 74/175 (42%), Gaps = 16/175 (9%)

Query: 295 IQEFKGHMDGVLTLQF--NYRLLFTGSYDSTIGIWDLFTGKLIR---RLSGHSDGVKTLY 349
           I+ F    D V +  F  + +LL  G     + ++D +  + I      S H   V   +
Sbjct: 74  IKTFSRFKDVVYSASFRSDGKLLVAGDATGLVSVYDSYNPRTILLSINASTHPTHVTKFH 133

Query: 350 FDDRK-LITGSLDKTIRVWN----YITGECISTYRGHSDSVLSVDSYQKVIVSGSADKTV 404
             D K LIT S D+ IR+W+    Y     ++    +  SV  V S   +IVSGS D  +
Sbjct: 134 PQDNKTLITASDDRVIRLWDISNAYQPQLELTGSTDYVRSVTCVPSAPHMIVSGSYDGII 193

Query: 405 KVWHVE---SRTCYTLRGHTEWVNCVKLHPKSFSCFSCSDDTTIRMWDIRTNSCL 456
           +++      S   Y+L       + + +   +    SC   +  ++WD+ +N  L
Sbjct: 194 RLYDTRASGSSPIYSLLHDQPIEDIISI--SATQIVSCG-GSNFKVWDLTSNKKL 245

 Score = 31.2 bits (69), Expect = 2.5,   Method: Compositional matrix adjust.
 Identities = 37/174 (21%), Positives = 69/174 (39%), Gaps = 31/174 (17%)

Query: 424 VNCVKLHPKSFSCFSCSDDTTIRMWDIRTNSCLKVFRGHVGQVQKIIPLTIKDVENLATD 483
           V  +  +P+    F+ +  T ++++  RT   +K F               KDV   A+ 
Sbjct: 42  VTHIAFNPQHPHDFAVTSSTRVQIFSSRTRQVIKTFS------------RFKDVVYSASF 89

Query: 484 NTSDGSSPQDDPTMTDGADESDTPSNEQETVLDENIP-YPTH-----------LLSCGLD 531
            +        D T      +S  P   +  +L  N   +PTH           L++   D
Sbjct: 90  RSDGKLLVAGDATGLVSVYDSYNP---RTILLSINASTHPTHVTKFHPQDNKTLITASDD 146

Query: 532 NTIKLWDVKTGKCIRTQF----GHVEGVWDIAADNFRIISGSHDGSIKVWDLQS 581
             I+LWD+      + +      +V  V  + +    I+SGS+DG I+++D ++
Sbjct: 147 RVIRLWDISNAYQPQLELTGSTDYVRSVTCVPSAPHMIVSGSYDGIIRLYDTRA 200

>Sklu_2406.11 YOR212W, Contig c2406 16632-17912 reverse complement
          Length = 426

 Score = 42.4 bits (98), Expect = 0.001,   Method: Compositional matrix adjust.
 Identities = 66/305 (21%), Positives = 114/305 (37%), Gaps = 49/305 (16%)

Query: 282 FKVESNWRKGHCRIQEFKGHMDGVLTLQF-NYRLLFTGSYDSTIGIWDLFTGKLIRRLSG 340
           +++    R     +  FKGH   V  L+F N   + T S D T  +WD+   K +   S 
Sbjct: 157 YRISQENRTQQKIVSIFKGHTCYVSDLEFINNESILTASGDMTCALWDIPKSKRVSEYSD 216

Query: 341 HSDGVKTLYFDDRKLITGSLDKTIRVWNYITGECISTYRGHSDSVLSVDSYQKVIVSGSA 400
           H   V TL                                 S       SY  +  SG +
Sbjct: 217 HLGDVLTL---------------------------------SVPPAGTTSYDSMFASGGS 243

Query: 401 DKTVKVWHVES-RTCYTLRGHTEWVNCVKLHPKSFSCFSCSDDTTIRMWDIRTNSCLKVF 459
           D  V +W   S  +          ++ V+      S  + SDD   R++D+R++  L  +
Sbjct: 244 DGYVYLWDTRSPSSVQNFFVSDSDISTVRFFSDGNSIITGSDDGIARLFDLRSDCELSSY 303

Query: 460 RGHVGQVQKIIPLTIKDVENLAT----DNTSDGSSPQDDPTMTDGADESDTPSNEQETVL 515
              + Q  +   + +K+   L++     N+S  ++P      T  +   D   N+    L
Sbjct: 304 --SLSQKVQQQQMKLKNRSYLSSTMEYSNSSAAATPYSPAAETIRSSYLD---NQGIVSL 358

Query: 516 DENIPYPTHLLSCGLDNTIKLWDVKTGKCIRTQFGH---VEGVWDIAADNFRIISGSHDG 572
           D +I     L +C  +    +WD   G+ +    GH   + GV   + D   + +GS D 
Sbjct: 359 DFSIS-GRLLYACYTEYGCIVWDTLRGEIVGRLEGHSSRISGV-RTSPDGMCVCTGSWDS 416

Query: 573 SIKVW 577
           ++K+W
Sbjct: 417 TMKLW 421

 Score = 39.3 bits (90), Expect = 0.009,   Method: Compositional matrix adjust.
 Identities = 56/278 (20%), Positives = 112/278 (40%), Gaps = 58/278 (20%)

Query: 338 LSGHSDGVKTLYF--DDRKLITGSLDKTIRVWNYITGECISTYRGHSDSVLS--VDSYQK 393
           L GH++ +    +  D + +++ S D  + +W+ ++G   +     S  VL+  +   + 
Sbjct: 84  LKGHNNKISDFRWSRDSKSILSASQDGFMLIWDPMSGLKKNAIPLDSQWVLACAISPSRN 143

Query: 394 VIVSGSADKTVKVWHV--ESRT----CYTLRGHTEWVNCVKLHPKSFSCFSCSDDTTIRM 447
           ++ SG       ++ +  E+RT        +GHT +V+ ++      S  + S D T  +
Sbjct: 144 LVASGGLSNNCTIYRISQENRTQQKIVSIFKGHTCYVSDLEFINNE-SILTASGDMTCAL 202

Query: 448 WDIRTNSCLKVFRGHVGQVQKIIPLTIKDVENLATDNTSDGSSPQDDPTMTDGADESDTP 507
           WDI  +  +  +  H+G V     LT+              S P    T           
Sbjct: 203 WDIPKSKRVSEYSDHLGDV-----LTL--------------SVPPAGTT----------- 232

Query: 508 SNEQETVLDENIPYPTHLLSCGLDNTIKLWDVKTGKCIRTQFGHVEGVWDIA--ADNFRI 565
                        Y +   S G D  + LWD ++   ++  F     +  +   +D   I
Sbjct: 233 ------------SYDSMFASGGSDGYVYLWDTRSPSSVQNFFVSDSDISTVRFFSDGNSI 280

Query: 566 ISGSHDGSIKVWDLQSGKCMHTFNGRRLQRETQHTQTQ 603
           I+GS DG  +++DL+S   + +++   L ++ Q  Q +
Sbjct: 281 ITGSDDGIARLFDLRSDCELSSYS---LSQKVQQQQMK 315

>CAGL0K00957g 94828..97209 similar to sp|P42935 Saccharomyces
           cerevisiae YGR200c subunit of elongating RNA polymerase
           II holoenzyme, start by similarity
          Length = 793

 Score = 42.0 bits (97), Expect = 0.001,   Method: Compositional matrix adjust.
 Identities = 43/170 (25%), Positives = 76/170 (44%), Gaps = 20/170 (11%)

Query: 311 NYRLLFTGSYDSTIGIWD--LFTGKLIR------RLSGHSDGVKTLYF------DDRKLI 356
           N  LL  G     I I+   L  GK+I        L GH D VK++ F       D  L 
Sbjct: 165 NKYLLAIGGTTVKIFIYSFVLSEGKVIENFNLAAELEGHEDWVKSIQFRHQETPGDYLLC 224

Query: 357 TGSLDKTIRVWNYITGECISTYRGHSDSVLSVDSYQKVIVSGSADKTVKVWHVESRTCYT 416
           +GS D+ IR+W   T + I       ++ L++ S ++     S D  + + + E+     
Sbjct: 225 SGSQDRYIRIWRIRTNDLIDDSE-DDETKLTLLSSKQHKFHISEDLRIGI-NFEA----L 278

Query: 417 LRGHTEWVNCVKLHPKSFSCFSCSDDTTIRMWDIRTNSCLKVFRGHVGQV 466
           + GH +WV+ ++ H       + + DT + +W+   +S + V    +G++
Sbjct: 279 IIGHDDWVSSLQWHESKLQLLASTADTAVMIWEPDESSGVWVCSSRLGEM 328

 Score = 37.7 bits (86), Expect = 0.032,   Method: Compositional matrix adjust.
 Identities = 31/111 (27%), Positives = 50/111 (45%), Gaps = 10/111 (9%)

Query: 338 LSGHSDGVKTLYF--DDRKLITGSLDKTIRVWNYITGE-----CISTYRGHSDSVLSVDS 390
           L GH   V  + F      L++ S D  +++W Y   E     CI T   +S +++S+++
Sbjct: 54  LKGHEAEVTCVKFMPGTDILVSASEDHHVKLWKYKAPESEELECIQTITHYSHTIVSIET 113

Query: 391 YQKVIVSGSADKTVKVWHVESRTCYTLRGHTEWVNCVKLHPKSFSCFSCSD 441
              +IV GSA   V +W  E+    T     E+     + P    CFS S+
Sbjct: 114 LAGLIVIGSAGGLVSIWVPETEGSDTYIISHEYSLPRNVFPL---CFSLSN 161

 Score = 35.8 bits (81), Expect = 0.12,   Method: Compositional matrix adjust.
 Identities = 21/69 (30%), Positives = 35/69 (50%), Gaps = 6/69 (8%)

Query: 390 SYQKV--IVSGSADKTVKVWH---VESRTCY-TLRGHTEWVNCVKLHPKSFSCFSCSDDT 443
           SY K   +++  A K + +W+    + R  Y TL+GH   V CVK  P +    S S+D 
Sbjct: 21  SYNKARNVLAFGAGKNIALWNPLDADCRGIYATLKGHEAEVTCVKFMPGTDILVSASEDH 80

Query: 444 TIRMWDIRT 452
            +++W  + 
Sbjct: 81  HVKLWKYKA 89

 Score = 30.0 bits (66), Expect = 6.4,   Method: Compositional matrix adjust.
 Identities = 19/64 (29%), Positives = 29/64 (45%), Gaps = 5/64 (7%)

Query: 349 YFDDRKLITGSLDKTIRVWNYITGEC---ISTYRGHSDSVLSVDSY--QKVIVSGSADKT 403
           Y   R ++     K I +WN +  +C    +T +GH   V  V       ++VS S D  
Sbjct: 22  YNKARNVLAFGAGKNIALWNPLDADCRGIYATLKGHEAEVTCVKFMPGTDILVSASEDHH 81

Query: 404 VKVW 407
           VK+W
Sbjct: 82  VKLW 85

 Score = 30.0 bits (66), Expect = 6.5,   Method: Compositional matrix adjust.
 Identities = 18/45 (40%), Positives = 25/45 (55%), Gaps = 6/45 (13%)

Query: 297 EFKGHMDGVLTLQFNYR------LLFTGSYDSTIGIWDLFTGKLI 335
           E +GH D V ++QF ++      LL +GS D  I IW + T  LI
Sbjct: 199 ELEGHEDWVKSIQFRHQETPGDYLLCSGSQDRYIRIWRIRTNDLI 243

>KLLA0E20779g complement(1841092..1842207) similar to sp|P40066
           Saccharomyces cerevisiae YER107c GLE2 required for
           nuclear pore complex structure and function, start by
           similarity
          Length = 371

 Score = 41.6 bits (96), Expect = 0.001,   Method: Compositional matrix adjust.
 Identities = 57/253 (22%), Positives = 97/253 (38%), Gaps = 31/253 (12%)

Query: 314 LLFTGSYDSTIGIWDLFTGKLIRRLS-GHSDGVKTLYF--DDRKLITGSLDKTIRVWNYI 370
           +    S+DS + IWD+ +G    R    H   V T  +  D  K+ +G  D  ++V++  
Sbjct: 50  MFSVSSWDSKVRIWDVQSGSPQGRAQYDHQAPVLTTRWSIDGTKVASGGCDNVLKVFDVT 109

Query: 371 TGECISTYRGHSDSVLSV------DSYQKVIVSGSADKTVKVWHVESRTCYTLRGHTEWV 424
           TG+     + H+ +V S+       + Q+ I +GS DKTVK W + S          E V
Sbjct: 110 TGQAQQIGQ-HNSAVQSLRFVSCGPTNQECIATGSWDKTVKYWDLRSPQPIMTLQMPERV 168

Query: 425 NC---------VKLHPKSFSCFSCSDDTTI-------RMWDIRTNSCLKVFRGH-VGQVQ 467
            C         V +  +  +    ++   I         W  R+ SC     G  +G ++
Sbjct: 169 YCMDASQKLMVVGMAERHIAVIDLNNPGQIFKTSLSPLKWQTRSISCYNEGNGFAIGSIE 228

Query: 468 KIIPLTIKDVENLATDNTSDGSSPQDDPTMTDGADESDTPSNEQETVLDENIPYPTH--L 525
               +   D +    D  S     Q      +GA    T +  Q   ++  + +P H   
Sbjct: 229 GRCAVQYIDEQEQRKDGFSFKCHRQQ--VQNNGAAGGRTSTEVQVYPVNSIVFHPIHGTF 286

Query: 526 LSCGLDNTIKLWD 538
            + G D +   WD
Sbjct: 287 ATAGGDGSFHFWD 299

 Score = 32.7 bits (73), Expect = 0.93,   Method: Compositional matrix adjust.
 Identities = 23/77 (29%), Positives = 37/77 (48%), Gaps = 17/77 (22%)

Query: 523 THLLSCGLDNTIKLWDVKTGKCIRTQFGHVEGVWDIAADNFRIIS-----------GSHD 571
           T + S G DN +K++DV TG+  +       G  + A  + R +S           GS D
Sbjct: 92  TKVASGGCDNVLKVFDVTTGQAQQI------GQHNSAVQSLRFVSCGPTNQECIATGSWD 145

Query: 572 GSIKVWDLQSGKCMHTF 588
            ++K WDL+S + + T 
Sbjct: 146 KTVKYWDLRSPQPIMTL 162

 Score = 32.3 bits (72), Expect = 1.2,   Method: Compositional matrix adjust.
 Identities = 19/59 (32%), Positives = 33/59 (55%), Gaps = 7/59 (11%)

Query: 531 DNTIKLWDVKTGKCI-RTQFGHVEGV----WDIAADNFRIISGSHDGSIKVWDLQSGKC 584
           D+ +++WDV++G    R Q+ H   V    W I  D  ++ SG  D  +KV+D+ +G+ 
Sbjct: 57  DSKVRIWDVQSGSPQGRAQYDHQAPVLTTRWSI--DGTKVASGGCDNVLKVFDVTTGQA 113

>Scas_510.5
          Length = 362

 Score = 41.6 bits (96), Expect = 0.002,   Method: Compositional matrix adjust.
 Identities = 27/96 (28%), Positives = 55/96 (57%), Gaps = 8/96 (8%)

Query: 317 TGSYDSTIGIWDLFTGKLIRRLSGHSDGVKTLYF------DDRKLITGSLDKTIRVWNYI 370
           +G  D+ + ++D+ +G+  +++  H   VK + F      +   L+TGS DK+I+ W+  
Sbjct: 95  SGGCDNIVKLFDVASGQS-QQIGMHDAPVKAVRFVNCGPSNTECLVTGSWDKSIKYWDMR 153

Query: 371 TGECISTYRGHSDSVLSVDSYQKVIVSGSADKTVKV 406
             + IST     D V ++DS Q+++V G+A++ + +
Sbjct: 154 QPQAISTVI-MPDRVYTMDSKQQLLVVGTAERHIAI 188

 Score = 31.2 bits (69), Expect = 2.5,   Method: Compositional matrix adjust.
 Identities = 21/76 (27%), Positives = 36/76 (47%), Gaps = 17/76 (22%)

Query: 523 THLLSCGLDNTIKLWDVKTGKCIRTQFGHVEGVWDIAADNFR-----------IISGSHD 571
           + + S G DN +KL+DV +G+  +       G+ D      R           +++GS D
Sbjct: 91  SKVASGGCDNIVKLFDVASGQSQQI------GMHDAPVKAVRFVNCGPSNTECLVTGSWD 144

Query: 572 GSIKVWDLQSGKCMHT 587
            SIK WD++  + + T
Sbjct: 145 KSIKYWDMRQPQAIST 160

>YER107C (GLE2) [1539] chr5 complement(373444..374541) Nuclear pore
           protein required for poly(A)+ RNA export, has WD (WD-40)
           repeats, functions in the nuclear export of the small
           ribosomal subunit [1098 bp, 365 aa]
          Length = 365

 Score = 41.2 bits (95), Expect = 0.002,   Method: Compositional matrix adjust.
 Identities = 26/103 (25%), Positives = 58/103 (56%), Gaps = 8/103 (7%)

Query: 317 TGSYDSTIGIWDLFTGKLIRRLSGHSDGVKTLYF------DDRKLITGSLDKTIRVWNYI 370
           +G  D+ + ++D+ +G+  +++  HS  +K L F      +   ++TGS DKTI+ W+  
Sbjct: 97  SGGCDNALKLYDIASGQ-TQQIGMHSAPIKVLRFVQCGPSNTECIVTGSWDKTIKYWDMR 155

Query: 371 TGECISTYRGHSDSVLSVDSYQKVIVSGSADKTVKVWHVESRT 413
             + +ST     + V S+D+ Q ++V  +A++ + + ++ + T
Sbjct: 156 QPQPVSTVM-MPERVYSMDNKQSLLVVATAERHIAIINLANPT 197

 Score = 30.4 bits (67), Expect = 5.1,   Method: Compositional matrix adjust.
 Identities = 20/72 (27%), Positives = 36/72 (50%), Gaps = 9/72 (12%)

Query: 523 THLLSCGLDNTIKLWDVKTGKCIRTQFGHVEGVWDI-------AADNFRIISGSHDGSIK 575
           T + S G DN +KL+D+ +G+    Q G       +        ++   I++GS D +IK
Sbjct: 93  TKVASGGCDNALKLYDIASGQT--QQIGMHSAPIKVLRFVQCGPSNTECIVTGSWDKTIK 150

Query: 576 VWDLQSGKCMHT 587
            WD++  + + T
Sbjct: 151 YWDMRQPQPVST 162

>Kwal_27.12586
          Length = 509

 Score = 41.6 bits (96), Expect = 0.002,   Method: Compositional matrix adjust.
 Identities = 33/126 (26%), Positives = 60/126 (47%), Gaps = 6/126 (4%)

Query: 291 GHCR-IQEFKGHMDGVLTLQFNYR--LLFTGSYDSTIGIWDLFTGKLIRRLSGHSDGVKT 347
           G  R + +  GH   +    FN    +L +GS D T+ +W   +        G++ G+ +
Sbjct: 323 GESRPLGKLNGHSATITAFDFNSENNMLLSGSDDKTLRVWRSGSLSSSNCFMGNTLGITS 382

Query: 348 LYF-DDRKLITGSLDKTIRVWNYITG--ECISTYRGHSDSVLSVDSYQKVIVSGSADKTV 404
            ++ DD K+I  SLD ++R+W+++T   + IS   G      S+   +     G  D  V
Sbjct: 383 AFWIDDDKVIATSLDGSVRLWSHLTNTLQAISMVDGVPIFCGSLSPDKLKFAIGKMDGEV 442

Query: 405 KVWHVE 410
            V+++E
Sbjct: 443 TVYNIE 448

 Score = 39.3 bits (90), Expect = 0.008,   Method: Compositional matrix adjust.
 Identities = 40/158 (25%), Positives = 60/158 (37%), Gaps = 12/158 (7%)

Query: 315 LFTGSYDSTIGIWDLFTGKLIRRLSGHSDGVKTLYF--DDRKLITGSLDKTIRVWNYITG 372
             TG     I +W     KL      H   + T+ +  D    +T  +D    VWN  TG
Sbjct: 221 FLTGVESGEIRLW-THDAKLQNAFDFHKSSIVTIKWNSDATHFLTYDVDNVAIVWNAQTG 279

Query: 373 ECISTY----RGHSDSVLSVDSY----QKVIVSGSADKTVKVWHVESRTCYTLRGHTEWV 424
             +  +     G  DS L VD+      K ++ G           ESR    L GH+  +
Sbjct: 280 TALQQFSFRENGTVDS-LGVDASWIGPDKFVIPGPQGSIYICGMGESRPLGKLNGHSATI 338

Query: 425 NCVKLHPKSFSCFSCSDDTTIRMWDIRTNSCLKVFRGH 462
                + ++    S SDD T+R+W   + S    F G+
Sbjct: 339 TAFDFNSENNMLLSGSDDKTLRVWRSGSLSSSNCFMGN 376

>YGL003C (CDH1) [1969] chr7 complement(492476..494176) Protein of
           the WD (WD-40) repeat family that binds to substrates
           (CLB2, CLB3, CDC5, HSL1) of the anaphase promoting
           complex (APC) and targets them for degradation [1701 bp,
           566 aa]
          Length = 566

 Score = 41.6 bits (96), Expect = 0.002,   Method: Compositional matrix adjust.
 Identities = 32/125 (25%), Positives = 62/125 (49%), Gaps = 8/125 (6%)

Query: 295 IQEFKGHMDGVLTLQFNYRLLFTGSYDSTIGIWDL-FTGKLIRRLSGHSDGVKTLYFD-- 351
           I+   GH+D V  L +N  +L +GS D  I   D+         +  H+  V  L ++  
Sbjct: 337 IRTLSGHIDRVACLSWNNHVLTSGSRDHRILHRDVRMPDPFFETIESHTQEVCGLKWNVA 396

Query: 352 DRKLITGSLDKTIRVWNYITGECISTYRGHSDSV--LSVDSYQKVIVS---GSADKTVKV 406
           D KL +G  D  + V+   +   I T+  H  +V  ++   +++ +++   G+AD+ +K+
Sbjct: 397 DNKLASGGNDNVVHVYEGTSKSPILTFDEHKAAVKAMAWSPHKRGVLATGGGTADRRLKI 456

Query: 407 WHVES 411
           W+V +
Sbjct: 457 WNVNT 461

 Score = 39.3 bits (90), Expect = 0.009,   Method: Compositional matrix adjust.
 Identities = 36/146 (24%), Positives = 61/146 (41%), Gaps = 7/146 (4%)

Query: 315 LFTGSYDSTIGIWDLFTGKLIRRLSGHSDGVKTLYFDDRKLITGSLDKTIRVWNY-ITGE 373
           L  G  +  + I+D+   K IR LSGH D V  L +++  L +GS D  I   +  +   
Sbjct: 317 LAVGQANGLVEIYDVMKRKCIRTLSGHIDRVACLSWNNHVLTSGSRDHRILHRDVRMPDP 376

Query: 374 CISTYRGHSDSV--LSVDSYQKVIVSGSADKTVKVWHVESRT-CYTLRGHTEWVNCVKLH 430
              T   H+  V  L  +     + SG  D  V V+   S++   T   H   V  +   
Sbjct: 377 FFETIESHTQEVCGLKWNVADNKLASGGNDNVVHVYEGTSKSPILTFDEHKAAVKAMAWS 436

Query: 431 PKSFSCFSC---SDDTTIRMWDIRTN 453
           P      +    + D  +++W++ T+
Sbjct: 437 PHKRGVLATGGGTADRRLKIWNVNTS 462

 Score = 35.4 bits (80), Expect = 0.13,   Method: Compositional matrix adjust.
 Identities = 18/52 (34%), Positives = 30/52 (57%)

Query: 523 THLLSCGLDNTIKLWDVKTGKCIRTQFGHVEGVWDIAADNFRIISGSHDGSI 574
           +HL     +  ++++DV   KCIRT  GH++ V  ++ +N  + SGS D  I
Sbjct: 315 SHLAVGQANGLVEIYDVMKRKCIRTLSGHIDRVACLSWNNHVLTSGSRDHRI 366

>Kwal_47.17567
          Length = 590

 Score = 41.6 bits (96), Expect = 0.002,   Method: Compositional matrix adjust.
 Identities = 37/145 (25%), Positives = 63/145 (43%), Gaps = 7/145 (4%)

Query: 315 LFTGSYDSTIGIWDLFTGKLIRRLSGHSDGVKTLYFDDRKLITGSLDKTIRVWNYITGE- 373
           L  G  +  + I+D+   K IR + GH D V  L +++  L +GS D+ I   +  T + 
Sbjct: 341 LAVGQTNGLVNIFDVEKKKCIRTIPGHIDRVACLSWNNHILTSGSRDRRILHRDVRTPQS 400

Query: 374 CISTYRGHSDSV--LSVDSYQKVIVSGSADKTVKVWHVESRTCY-TLRGHTEWVNCVKLH 430
                R H+  V  L  +     + SG  D  V V+   SR  +  L  HT  V  +   
Sbjct: 401 SFEEIRTHNQEVCGLKWNVEDNKLASGGNDNAVFVYDGTSRLPFLKLEEHTAAVKAMAWS 460

Query: 431 PKSFSCFSC---SDDTTIRMWDIRT 452
           P      +    + D  +++W+++T
Sbjct: 461 PHRRGILATGGGTADKRLKIWNVKT 485

 Score = 38.9 bits (89), Expect = 0.012,   Method: Compositional matrix adjust.
 Identities = 38/138 (27%), Positives = 69/138 (50%), Gaps = 13/138 (9%)

Query: 282 FKVESNWRKGHCRIQEFKGHMDGVLTLQFNYRLLFTGSYDSTIGIWDLFTGK-LIRRLSG 340
           F VE    K  C I+   GH+D V  L +N  +L +GS D  I   D+ T +     +  
Sbjct: 353 FDVE----KKKC-IRTIPGHIDRVACLSWNNHILTSGSRDRRILHRDVRTPQSSFEEIRT 407

Query: 341 HSDGVKTLYF--DDRKLITGSLDKTIRVWNYITGECISTYRGHSDSV--LSVDSYQKVIV 396
           H+  V  L +  +D KL +G  D  + V++  +         H+ +V  ++   +++ I+
Sbjct: 408 HNQEVCGLKWNVEDNKLASGGNDNAVFVYDGTSRLPFLKLEEHTAAVKAMAWSPHRRGIL 467

Query: 397 S---GSADKTVKVWHVES 411
           +   G+ADK +K+W+V++
Sbjct: 468 ATGGGTADKRLKIWNVKT 485

 Score = 35.4 bits (80), Expect = 0.13,   Method: Compositional matrix adjust.
 Identities = 19/59 (32%), Positives = 34/59 (57%)

Query: 523 THLLSCGLDNTIKLWDVKTGKCIRTQFGHVEGVWDIAADNFRIISGSHDGSIKVWDLQS 581
           +HL     +  + ++DV+  KCIRT  GH++ V  ++ +N  + SGS D  I   D+++
Sbjct: 339 SHLAVGQTNGLVNIFDVEKKKCIRTIPGHIDRVACLSWNNHILTSGSRDRRILHRDVRT 397

 Score = 32.0 bits (71), Expect = 2.0,   Method: Compositional matrix adjust.
 Identities = 39/199 (19%), Positives = 76/199 (38%), Gaps = 59/199 (29%)

Query: 263 NADIQTQTTRPWKVIYRERFKVESNWRKGHCRIQEFKGHMDGVLTLQFNYR--LLFTGSY 320
           N  I T  +R  ++++R+        R      +E + H   V  L++N     L +G  
Sbjct: 377 NNHILTSGSRDRRILHRD-------VRTPQSSFEEIRTHNQEVCGLKWNVEDNKLASGGN 429

Query: 321 DSTIGIWDLFTGKLIRRLSGHSDGVKTLYFDDRK---LITG--SLDKTIRVWNYITG--- 372
           D+ + ++D  +     +L  H+  VK + +   +   L TG  + DK +++WN  T    
Sbjct: 430 DNAVFVYDGTSRLPFLKLEEHTAAVKAMAWSPHRRGILATGGGTADKRLKIWNVKTSVKL 489

Query: 373 ----------------------------------------ECISTYRGHSDSVL--SVDS 390
                                                   E ++  +GHS  VL  ++ +
Sbjct: 490 HDVDTASQVCNMIWSKNTNEIITSHGYSKYNLTLWDGNTLEPMAILKGHSFRVLHMTLST 549

Query: 391 YQKVIVSGSADKTVKVWHV 409
               +VSG+ D+T++ W +
Sbjct: 550 DGTTVVSGAGDETLRYWKL 568

>YCL039W (GID7) [504] chr3 (52645..54882) Protein of unknown
           function, member of the WD (WD-40) repeat family [2238
           bp, 745 aa]
          Length = 745

 Score = 41.6 bits (96), Expect = 0.002,   Method: Compositional matrix adjust.
 Identities = 24/72 (33%), Positives = 36/72 (50%), Gaps = 5/72 (6%)

Query: 524 HLLSCGL-DNTIKLWDVKTGKCIRTQFGHVEGVWDI----AADNFRIISGSHDGSIKVWD 578
           HL+   L DN +++WD K    I+  FG  +  + I    A  N  ++SGS DG I +WD
Sbjct: 628 HLVLVSLQDNELQMWDYKENILIQKYFGQKQQHFIIRSCFAYGNKLVMSGSEDGKIYIWD 687

Query: 579 LQSGKCMHTFNG 590
              G  +   +G
Sbjct: 688 RIRGNLVSVLSG 699

 Score = 38.1 bits (87), Expect = 0.022,   Method: Compositional matrix adjust.
 Identities = 25/114 (21%), Positives = 52/114 (45%), Gaps = 18/114 (15%)

Query: 314 LLFTGSYDSTIGIWDLFTGKLIRRLSGHSDG---VKTLY-FDDRKLITGSLDKTIRVWNY 369
           L+     D+ + +WD     LI++  G       +++ + + ++ +++GS D  I +W+ 
Sbjct: 629 LVLVSLQDNELQMWDYKENILIQKYFGQKQQHFIIRSCFAYGNKLVMSGSEDGKIYIWDR 688

Query: 370 ITGECISTYRGHS--------------DSVLSVDSYQKVIVSGSADKTVKVWHV 409
           I G  +S   GHS              + V S  + +++  SG  D  +K+W +
Sbjct: 689 IRGNLVSVLSGHSTVMSNSTKPMGKNCNVVASNPADKEMFASGGDDGKIKIWKI 742

 Score = 34.7 bits (78), Expect = 0.29,   Method: Compositional matrix adjust.
 Identities = 21/57 (36%), Positives = 30/57 (52%), Gaps = 4/57 (7%)

Query: 290 KGHCRIQEFKGHMDGVLTLQ--FNY--RLLFTGSYDSTIGIWDLFTGKLIRRLSGHS 342
           K +  IQ++ G       ++  F Y  +L+ +GS D  I IWD   G L+  LSGHS
Sbjct: 645 KENILIQKYFGQKQQHFIIRSCFAYGNKLVMSGSEDGKIYIWDRIRGNLVSVLSGHS 701

>Scas_652.16
          Length = 345

 Score = 40.8 bits (94), Expect = 0.002,   Method: Compositional matrix adjust.
 Identities = 28/79 (35%), Positives = 43/79 (54%), Gaps = 10/79 (12%)

Query: 339 SGHSDGVKTLYFD--DRKLITGSLDKTIRVWNY----ITGECISTYRGHSDSVLSVD--- 389
           SGH D +  + +D   R + T S D+ I+V+         E   +++ H  S++SVD   
Sbjct: 9   SGHEDLIHDVVYDFYGRHVATCSSDQHIKVFKLDKETSEWELSDSWKAHDSSIVSVDWAS 68

Query: 390 -SYQKVIVSGSADKTVKVW 407
             Y ++IVS S DKTVK+W
Sbjct: 69  PEYGRIIVSASYDKTVKLW 87

>KLLA0D06787g 586289..587599 gi|4809177|gb|AAD30127.1|AF136180_1
           Kluyveromyces lactis heterotrimeric G protein beta
           subunit, start by similarity
          Length = 436

 Score = 41.2 bits (95), Expect = 0.002,   Method: Compositional matrix adjust.
 Identities = 60/270 (22%), Positives = 106/270 (39%), Gaps = 61/270 (22%)

Query: 335 IRRLSGHSDGVKTLYF--DDRKLITGSLDKTIRVWNYITGECISTYRGHSDSVLS--VDS 390
           +R L GH++ +  + +  D   +++ S D  I +W+  TG   S     S  VLS  +  
Sbjct: 79  VRTLKGHNNKISDVKWSQDSASVLSSSQDGFIIIWDPFTGLKKSAIPLLSQWVLSSAISP 138

Query: 391 YQKVIVSGSADKTVKVWHV------ESRTCYTLRGHTEWVNCVKLHPKSFSCFSCSDDTT 444
              ++ S   D    V+ V      +       +GHT +++  +   +  +  + S D T
Sbjct: 139 SGNLVASAGLDNHCSVYRVSRDNRIQQNVISIFKGHTCYISATEFLDER-TILTASGDMT 197

Query: 445 IRMWDIRTNSCLKVFRGHVGQVQKIIPLTIKDVENLATDNTSDGSSPQDDPTMTDGADES 504
             MWDI  +  +  F  H+G V     LT+                  D P         
Sbjct: 198 CAMWDIPKSKRVTEFIDHLGDV-----LTM------------------DLP--------- 225

Query: 505 DTPSNEQETVLDENIPYPTHLLSCGLDNTIKLWDVKTGKCIRTQFGHVEGVWDIAADNF- 563
             P+N           Y  + ++ G D    LWDV+     ++ F       D++A  F 
Sbjct: 226 --PANTGR--------YGHNFITGGSDGYAYLWDVRQPNSAQSFFISDS---DVSAIKFF 272

Query: 564 ----RIISGSHDGSIKVWDLQSGKCMHTFN 589
                 ++GS DGS +++DL+S   + T++
Sbjct: 273 NNGESFMAGSDDGSARLFDLRSDCQISTYS 302

 Score = 40.0 bits (92), Expect = 0.005,   Method: Compositional matrix adjust.
 Identities = 29/135 (21%), Positives = 62/135 (45%), Gaps = 9/135 (6%)

Query: 334 LIRRLSGHSDGV-KTLYFDDRKLITGSLDKTIRVWNYITGECISTYRGHSDSVLSVD--- 389
           +I    GH+  +  T + D+R ++T S D T  +W+    + ++ +  H   VL++D   
Sbjct: 167 VISIFKGHTCYISATEFLDERTILTASGDMTCAMWDIPKSKRVTEFIDHLGDVLTMDLPP 226

Query: 390 ----SYQKVIVSGSADKTVKVWHV-ESRTCYTLRGHTEWVNCVKLHPKSFSCFSCSDDTT 444
                Y    ++G +D    +W V +  +  +       V+ +K      S  + SDD +
Sbjct: 227 ANTGRYGHNFITGGSDGYAYLWDVRQPNSAQSFFISDSDVSAIKFFNNGESFMAGSDDGS 286

Query: 445 IRMWDIRTNSCLKVF 459
            R++D+R++  +  +
Sbjct: 287 ARLFDLRSDCQISTY 301

 Score = 38.5 bits (88), Expect = 0.014,   Method: Compositional matrix adjust.
 Identities = 18/68 (26%), Positives = 38/68 (55%), Gaps = 4/68 (5%)

Query: 304 GVLTLQFNY--RLLFTGSYDSTIGIWDLFTGKLIRRLSGHSDGVKTLYF--DDRKLITGS 359
           GV+++ F+   RL++    D    +WD+  G++I ++ GH + +  +    D   +++ S
Sbjct: 364 GVISIDFSSSGRLMYACYADYGCAVWDIIKGEMIGKVDGHRNRINAVKTSPDGMAVVSSS 423

Query: 360 LDKTIRVW 367
            D T++VW
Sbjct: 424 WDMTLKVW 431

 Score = 31.2 bits (69), Expect = 3.0,   Method: Compositional matrix adjust.
 Identities = 19/67 (28%), Positives = 33/67 (49%), Gaps = 3/67 (4%)

Query: 385 VLSVD--SYQKVIVSGSADKTVKVWHV-ESRTCYTLRGHTEWVNCVKLHPKSFSCFSCSD 441
           V+S+D  S  +++ +  AD    VW + +      + GH   +N VK  P   +  S S 
Sbjct: 365 VISIDFSSSGRLMYACYADYGCAVWDIIKGEMIGKVDGHRNRINAVKTSPDGMAVVSSSW 424

Query: 442 DTTIRMW 448
           D T+++W
Sbjct: 425 DMTLKVW 431

 Score = 31.2 bits (69), Expect = 3.1,   Method: Compositional matrix adjust.
 Identities = 17/44 (38%), Positives = 24/44 (54%), Gaps = 2/44 (4%)

Query: 366 VWNYITGECISTYRGHSDSVLSVDSYQK--VIVSGSADKTVKVW 407
           VW+ I GE I    GH + + +V +      +VS S D T+KVW
Sbjct: 388 VWDIIKGEMIGKVDGHRNRINAVKTSPDGMAVVSSSWDMTLKVW 431

>YGL100W (SEH1) [1883] chr7 (313235..314284) Protein found in
           complex with nuclear pore proteins, member of WD (WD-40)
           repeat family [1050 bp, 349 aa]
          Length = 349

 Score = 40.8 bits (94), Expect = 0.002,   Method: Compositional matrix adjust.
 Identities = 27/79 (34%), Positives = 43/79 (54%), Gaps = 10/79 (12%)

Query: 339 SGHSDGVKTLYFD--DRKLITGSLDKTIRVW----NYITGECISTYRGHSDSVLSVD--- 389
           SGH D V  + +D   R + T S D+ I+V+    +    E   ++R H  S++++D   
Sbjct: 6   SGHDDLVHDVVYDFYGRHVATCSSDQHIKVFKLDKDTSNWELSDSWRAHDSSIVAIDWAS 65

Query: 390 -SYQKVIVSGSADKTVKVW 407
             Y ++I S S DKTVK+W
Sbjct: 66  PEYGRIIASASYDKTVKLW 84

>Scas_397.2
          Length = 410

 Score = 40.8 bits (94), Expect = 0.003,   Method: Compositional matrix adjust.
 Identities = 27/90 (30%), Positives = 43/90 (47%), Gaps = 6/90 (6%)

Query: 519 IPYPTHLLSCGLDNTIKLWDVKTGKCIRTQFGHVEGVWD-IAADNFR-IISGSHDGSIKV 576
            P    +LS   D  +KLW +K   C R   GH   + D +  +  R  +S S DG++K+
Sbjct: 148 FPSGEVVLSGSSDMQLKLWSIKDASCPRIFRGHTSKITDSVLIERGRDFVSSSLDGTMKL 207

Query: 577 WDLQSGKCMHTFNGRRLQRETQHTQTQSLG 606
           W+  SG  + TF    ++RE  +    S+ 
Sbjct: 208 WECGSGSTVRTF----MRRENPNDGINSMA 233

 Score = 40.4 bits (93), Expect = 0.004,   Method: Compositional matrix adjust.
 Identities = 20/68 (29%), Positives = 38/68 (55%), Gaps = 1/68 (1%)

Query: 393 KVIVSGSADKTVKVWHVESRTC-YTLRGHTEWVNCVKLHPKSFSCFSCSDDTTIRMWDIR 451
           +V++SGS+D  +K+W ++  +C    RGHT  +    L  +     S S D T+++W+  
Sbjct: 152 EVVLSGSSDMQLKLWSIKDASCPRIFRGHTSKITDSVLIERGRDFVSSSLDGTMKLWECG 211

Query: 452 TNSCLKVF 459
           + S ++ F
Sbjct: 212 SGSTVRTF 219

 Score = 38.9 bits (89), Expect = 0.010,   Method: Compositional matrix adjust.
 Identities = 19/89 (21%), Positives = 43/89 (48%), Gaps = 6/89 (6%)

Query: 384 SVLSVDSYQKV-----IVSGSADKTVKVWHVESRTCYTLR-GHTEWVNCVKLHPKSFSCF 437
           +V S+D++ +       + G+ + ++ ++  +    +T    H   +  +K  P      
Sbjct: 96  NVTSIDAFARANDVASYIVGNEEGSISLYDSQFSHEWTQEDAHCSEITTLKFFPSGEVVL 155

Query: 438 SCSDDTTIRMWDIRTNSCLKVFRGHVGQV 466
           S S D  +++W I+  SC ++FRGH  ++
Sbjct: 156 SGSSDMQLKLWSIKDASCPRIFRGHTSKI 184

 Score = 33.1 bits (74), Expect = 0.62,   Method: Compositional matrix adjust.
 Identities = 26/96 (27%), Positives = 45/96 (46%), Gaps = 8/96 (8%)

Query: 318 GSYDSTIGIWDLFTGKLIRRLSGHSDGVKTLYF--DDRKLITGSLDKTIRVWNYITGECI 375
           G+ + +I ++D        +   H   + TL F      +++GS D  +++W+     C 
Sbjct: 115 GNEEGSISLYDSQFSHEWTQEDAHCSEITTLKFFPSGEVVLSGSSDMQLKLWSIKDASCP 174

Query: 376 STYRGH----SDSVLSVDSYQKVIVSGSADKTVKVW 407
             +RGH    +DSVL      +  VS S D T+K+W
Sbjct: 175 RIFRGHTSKITDSVLI--ERGRDFVSSSLDGTMKLW 208

>Sklu_1926.5 YBR103W, Contig c1926 4197-5726 reverse complement
          Length = 509

 Score = 40.8 bits (94), Expect = 0.003,   Method: Compositional matrix adjust.
 Identities = 27/98 (27%), Positives = 49/98 (50%), Gaps = 3/98 (3%)

Query: 323 TIGIWDLFTGKLIRRLSGHSDGVKTLYF--DDRKLITGSLDKTIRVWNYITGECISTYRG 380
           +I ++ +   K I +L GH+  +  L +  D++ L++ S DKT+R W        + + G
Sbjct: 317 SILVFSIGESKPIGKLVGHTKTLTVLCYNSDNKLLLSASDDKTLRTWRGGNANSSNCFYG 376

Query: 381 HSDSVLSVDSY-QKVIVSGSADKTVKVWHVESRTCYTL 417
           H+ S+   D      ++S S D +V+VW V+      L
Sbjct: 377 HTQSITYADWLDDDRLISTSMDGSVRVWSVKQNALVGL 414

 Score = 38.1 bits (87), Expect = 0.018,   Method: Compositional matrix adjust.
 Identities = 37/157 (23%), Positives = 65/157 (41%), Gaps = 10/157 (6%)

Query: 315 LFTGSYDSTIGIWDLFTGKLIRRLSGHSDGVKTLYF--DDRKLITGSLDKTIRVWNYITG 372
           L TG  +  + +W  F G L    + H   V ++ +  D   ++T  +D    VWN +TG
Sbjct: 222 LITGVENGELRMWS-FRGILQNVFNFHRSPVVSIEWNADSTHVLTSDVDNITIVWNALTG 280

Query: 373 ECISTY-----RGHSDSVLSVDSYQ--KVIVSGSADKTVKVWHVESRTCYTLRGHTEWVN 425
             +  +      G+    + V+  +  K ++ G     +     ES+    L GHT+ + 
Sbjct: 281 TALQHFDLKDTTGNESLGIDVEWIETDKFVIPGLQGSILVFSIGESKPIGKLVGHTKTLT 340

Query: 426 CVKLHPKSFSCFSCSDDTTIRMWDIRTNSCLKVFRGH 462
            +  +  +    S SDD T+R W     +    F GH
Sbjct: 341 VLCYNSDNKLLLSASDDKTLRTWRGGNANSSNCFYGH 377

 Score = 32.7 bits (73), Expect = 1.1,   Method: Compositional matrix adjust.
 Identities = 18/62 (29%), Positives = 31/62 (50%), Gaps = 1/62 (1%)

Query: 525 LLSCGLDNTIKLWDVKTGKCIRTQFGHVEGV-WDIAADNFRIISGSHDGSIKVWDLQSGK 583
           LLS   D T++ W           +GH + + +    D+ R+IS S DGS++VW ++   
Sbjct: 351 LLSASDDKTLRTWRGGNANSSNCFYGHTQSITYADWLDDDRLISTSMDGSVRVWSVKQNA 410

Query: 584 CM 585
            +
Sbjct: 411 LV 412

 Score = 31.2 bits (69), Expect = 2.8,   Method: Compositional matrix adjust.
 Identities = 45/193 (23%), Positives = 75/193 (38%), Gaps = 26/193 (13%)

Query: 424 VNCVKLHPKSFSCFSCSDDTTIRMWDIRTNSCLKVFRGHVGQVQKI------IPLTIKDV 477
           V C+   P   S  +  ++  +RMW  R      VF  H   V  I        +   DV
Sbjct: 210 VTCLSWSPSGESLITGVENGELRMWSFR-GILQNVFNFHRSPVVSIEWNADSTHVLTSDV 268

Query: 478 ENLATD-NTSDGSSPQDDPTMTDGADESDTPSNEQETVLDENIPYPTHLLSCGLDNTIKL 536
           +N+    N   G++ Q         D  DT  NE   +  E I     ++  GL  +I +
Sbjct: 269 DNITIVWNALTGTALQH-------FDLKDTTGNESLGIDVEWIETDKFVIP-GLQGSILV 320

Query: 537 WDVKTGKCIRTQFGHVEGVWDIA--ADNFRIISGSHDGSIKVWDLQSGKCMHTFNGRRLQ 594
           + +   K I    GH + +  +   +DN  ++S S D +++ W   +    + F G    
Sbjct: 321 FSIGESKPIGKLVGHTKTLTVLCYNSDNKLLLSASDDKTLRTWRGGNANSSNCFYG---- 376

Query: 595 RETQHTQTQSLGD 607
               HTQ+ +  D
Sbjct: 377 ----HTQSITYAD 385

>Kwal_56.24399
          Length = 369

 Score = 40.4 bits (93), Expect = 0.004,   Method: Compositional matrix adjust.
 Identities = 48/213 (22%), Positives = 84/213 (39%), Gaps = 35/213 (16%)

Query: 290 KGHCRIQEFKGHMDGVLTLQF--NYRLLFTGSYDSTIGIWDLFTGKLIRRLSGH----SD 343
           + H  ++   GH   VL  +F  +  L  +   D  + IWDL +G     + GH    S 
Sbjct: 64  QSHELLELAGGHTRPVLACKFVKSGTLALSAGLDPHLCIWDLKSGH--NHVLGHCHRRSA 121

Query: 344 GVKTL-YFDDRKLITGSLDKTIRVWNYITGECISTYRGHSDSV-----LSVDSYQKVIVS 397
            + T    DD + +TGS D  + + +  TG  +  + GH+  V     L+ D +  V   
Sbjct: 122 AITTFDTLDDTRAVTGSSDTRLALVDLHTGRKLRNFAGHTRVVNQVRALNTDRFASV--- 178

Query: 398 GSADKTVKVWHVESRT----------CYTLRGHTEWVNCVKLHPKSFSCFSCSDDTTIRM 447
            S D  +K+W   +++           +TL   +   +   L+           D  IR 
Sbjct: 179 -SDDGALKIWDAHTKSPVWQISSEFPLFTLTSSSSSSDDNILYTSGL-------DPVIRA 230

Query: 448 WDIRTNSCLKVFRGHVGQVQKIIPLTIKDVENL 480
           +D+R N+  ++F         +  + I    NL
Sbjct: 231 YDLRQNNGQELFNWSTPHTDSVTSIHINASRNL 263

 Score = 35.4 bits (80), Expect = 0.13,   Method: Compositional matrix adjust.
 Identities = 19/49 (38%), Positives = 27/49 (55%), Gaps = 1/49 (2%)

Query: 531 DNTIKLWDVKTGKCIRTQFGHVEGVWDIAADNF-RIISGSHDGSIKVWD 578
           D  + L D+ TG+ +R   GH   V  + A N  R  S S DG++K+WD
Sbjct: 140 DTRLALVDLHTGRKLRNFAGHTRVVNQVRALNTDRFASVSDDGALKIWD 188

 Score = 34.7 bits (78), Expect = 0.19,   Method: Compositional matrix adjust.
 Identities = 23/75 (30%), Positives = 36/75 (48%), Gaps = 17/75 (22%)

Query: 526 LSCGLDNTIKLWDVKTGKCIRTQFGHVEG----------VWDIAADNFRIISGSHDGSIK 575
           LS GLD  + +WD+K+G        HV G           +D   D+ R ++GS D  + 
Sbjct: 92  LSAGLDPHLCIWDLKSGH------NHVLGHCHRRSAAITTFD-TLDDTRAVTGSSDTRLA 144

Query: 576 VWDLQSGKCMHTFNG 590
           + DL +G+ +  F G
Sbjct: 145 LVDLHTGRKLRNFAG 159

>Scas_721.29
          Length = 414

 Score = 40.4 bits (93), Expect = 0.004,   Method: Compositional matrix adjust.
 Identities = 26/69 (37%), Positives = 40/69 (57%), Gaps = 4/69 (5%)

Query: 513 TVLDENIPYPTHLLSCGLDN-TIKLWDVKTGKCIRTQFGHVEGVWDIA---ADNFRIISG 568
           + L+ N    T + S G D+  +KLWDV T + + T  GH+ GV DI+    D + + S 
Sbjct: 336 STLEWNPNLETIVASAGQDDGLVKLWDVSTDELVFTHGGHMLGVNDISWNLHDTWLMCSV 395

Query: 569 SHDGSIKVW 577
           S+D S++VW
Sbjct: 396 SNDNSVQVW 404

 Score = 38.9 bits (89), Expect = 0.010,   Method: Compositional matrix adjust.
 Identities = 35/123 (28%), Positives = 61/123 (49%), Gaps = 17/123 (13%)

Query: 299 KGHMDGVLTLQFNYR---LLFTGSYDSTIGIWDL--FTGKLIRRLSGHSDGVKTLYFD-D 352
           K H  G+ + +FN     LL +G  +  I +WDL    G+ I+ L  H   + TL ++ +
Sbjct: 285 KMHNGGINSCKFNSHCDSLLISGDSEGRINLWDLRKLDGEPIKTLH-HGSSISTLEWNPN 343

Query: 353 RKLITGSL---DKTIRVWNYITGECISTYRGHSDSVLSV-----DSYQKVIVSGSADKTV 404
            + I  S    D  +++W+  T E + T+ GH   V  +     D++  ++ S S D +V
Sbjct: 344 LETIVASAGQDDGLVKLWDVSTDELVFTHGGHMLGVNDISWNLHDTW--LMCSVSNDNSV 401

Query: 405 KVW 407
           +VW
Sbjct: 402 QVW 404

 Score = 30.4 bits (67), Expect = 5.3,   Method: Compositional matrix adjust.
 Identities = 20/75 (26%), Positives = 36/75 (48%), Gaps = 7/75 (9%)

Query: 525 LLSCGLDNTIKLWDVKT--GKCIRTQFGHVEGV----WDIAADNFRIISGSHDGSIKVWD 578
           L+S   +  I LWD++   G+ I+T   H   +    W+   +     +G  DG +K+WD
Sbjct: 304 LISGDSEGRINLWDLRKLDGEPIKT-LHHGSSISTLEWNPNLETIVASAGQDDGLVKLWD 362

Query: 579 LQSGKCMHTFNGRRL 593
           + + + + T  G  L
Sbjct: 363 VSTDELVFTHGGHML 377

>YGR200C (ELP2) [2150] chr7 complement(899907..902273) 90 kDa
           subunit of elongator and elongating RNA polymerase II
           holoenzyme, has WD (WD-40) repeats [2367 bp, 788 aa]
          Length = 788

 Score = 40.8 bits (94), Expect = 0.004,   Method: Compositional matrix adjust.
 Identities = 35/143 (24%), Positives = 66/143 (46%), Gaps = 18/143 (12%)

Query: 333 KLIRRLSGHSDGVKTLYF------DDRKLITGSLDKTIRVWNYITGECISTYRGHSD--S 384
           +++  L GH D VK+L F       D  L +GS D+ IR+W     + I      S   +
Sbjct: 193 RVVAELEGHEDWVKSLAFRHQETPGDYLLCSGSQDRYIRLWRIRINDLIDDSEEDSKKLT 252

Query: 385 VLSVDSYQKVIVSGSADKTVKVW-HVESRTCYTLRGHTEWVNCVKLHPKSFSCFSCSDDT 443
           +LS   Y+  I     D  ++V  + E+     + GH +W++ ++ H       + + DT
Sbjct: 253 LLSNKQYKFQI-----DDELRVGINFEA----LIMGHDDWISSLQWHESRLQLLAATADT 303

Query: 444 TIRMWDIRTNSCLKVFRGHVGQV 466
           ++ +W+    S + V    +G++
Sbjct: 304 SLMVWEPDETSGIWVCSLRLGEM 326

 Score = 39.3 bits (90), Expect = 0.010,   Method: Compositional matrix adjust.
 Identities = 24/93 (25%), Positives = 46/93 (49%), Gaps = 8/93 (8%)

Query: 323 TIGIWDLFTGK---LIRRLSGHSDGVKTLYF--DDRKLITGSLDKTIRVW---NYITGEC 374
           TI +WD        +   L GH   V  + F  D   +++ S D  +++W   +Y   +C
Sbjct: 37  TIALWDPIEPNNKGVYATLKGHEAEVTCVRFVPDSDFMVSASEDHHVKIWKFTDYSHLQC 96

Query: 375 ISTYRGHSDSVLSVDSYQKVIVSGSADKTVKVW 407
           I T + +S +++++ +   +I  G AD T+ +W
Sbjct: 97  IQTIQHYSKTIVALSALPSLISVGCADGTISIW 129

 Score = 37.4 bits (85), Expect = 0.038,   Method: Compositional matrix adjust.
 Identities = 27/92 (29%), Positives = 42/92 (45%), Gaps = 5/92 (5%)

Query: 370 ITGECISTYRGHSDSVLSVDSYQKVIVSGSADKTVKVW---HVESRTCY-TLRGHTEWVN 425
           IT E I         V  +   +K++  G A KT+ +W      ++  Y TL+GH   V 
Sbjct: 5   ITPEAIFIGANKQTQVSDIHKVKKIVAFG-AGKTIALWDPIEPNNKGVYATLKGHEAEVT 63

Query: 426 CVKLHPKSFSCFSCSDDTTIRMWDIRTNSCLK 457
           CV+  P S    S S+D  +++W     S L+
Sbjct: 64  CVRFVPDSDFMVSASEDHHVKIWKFTDYSHLQ 95

>Sklu_1870.2 YLR055C, Contig c1870 1126-2835 reverse complement
          Length = 569

 Score = 40.4 bits (93), Expect = 0.004,   Method: Compositional matrix adjust.
 Identities = 47/211 (22%), Positives = 81/211 (38%), Gaps = 41/211 (19%)

Query: 408 HVESRTCYTLRGHTEWVNCVKLHPKSFSCFSCSDDTTIRMWDIRTNSCLKVFRGHVGQV- 466
           ++E    +    HT  VN ++L+ K     S   D  I  WD+ T  C+  F+G V Q+ 
Sbjct: 263 YMEGSISHYFSKHTSVVNQLRLNDKEDKFISGGWDKQILEWDLNTGDCVNEFKGSVAQLS 322

Query: 467 ------------------------QKIIPLTIKDVENLATDNTS-----DGSSPQDDPTM 497
                                   Q+ I     D+++L  D        D  +  DD   
Sbjct: 323 SLEFRPLFSTVDIDSLVEKEPFQKQEQIQQKDDDMDSLFGDEDEEEKRMDLDTQSDDRNR 382

Query: 498 TDGADESDTPSNEQETVLDENIPYPTHLLSCGLDNTIKLWDVKTGK--CIRTQFGHVEGV 555
            +     +   N  +T  DE+I      L+  ++ +I +WD +T     +  Q G     
Sbjct: 383 QEKQSMQEISKNTLKTSCDESI-----FLTSSINGSIHVWDRRTPAKPVVGLQRGPQVPP 437

Query: 556 WDIAA----DNFRIISGSHDGSIKVWDLQSG 582
           W ++A    D  RI +G  +  ++ +DL+ G
Sbjct: 438 WCMSACWSMDGDRIYAGRRNAVVEEFDLKMG 468

 Score = 35.8 bits (81), Expect = 0.10,   Method: Compositional matrix adjust.
 Identities = 17/51 (33%), Positives = 28/51 (54%), Gaps = 2/51 (3%)

Query: 332 GKLIRRLSGHSDGVKTLYFDDR--KLITGSLDKTIRVWNYITGECISTYRG 380
           G +    S H+  V  L  +D+  K I+G  DK I  W+  TG+C++ ++G
Sbjct: 266 GSISHYFSKHTSVVNQLRLNDKEDKFISGGWDKQILEWDLNTGDCVNEFKG 316

 Score = 30.4 bits (67), Expect = 5.1,   Method: Compositional matrix adjust.
 Identities = 13/31 (41%), Positives = 17/31 (54%)

Query: 564 RIISGSHDGSIKVWDLQSGKCMHTFNGRRLQ 594
           + ISG  D  I  WDL +G C++ F G   Q
Sbjct: 290 KFISGGWDKQILEWDLNTGDCVNEFKGSVAQ 320

>Kwal_14.906
          Length = 328

 Score = 40.0 bits (92), Expect = 0.004,   Method: Compositional matrix adjust.
 Identities = 35/137 (25%), Positives = 61/137 (44%), Gaps = 24/137 (17%)

Query: 345 VKTLYFDD--RKLITGSLDKTIRVWNYITGECIST-----YRGHSDSVLSVDSYQKVIVS 397
           V +L FDD  R L+T S +  + +++ +    ++T     Y  HS         Q   V 
Sbjct: 29  VTSLSFDDHGRYLLTASANDNMHLYDAMNCRFLNTVASKKYGCHSAKFTHA---QNECVY 85

Query: 398 GSADKTVKVWHVESRTCYTLR---GHTEWVNCVKLHPKSFSCFSCSDDTTIRMWDIRTNS 454
            S  K+  + H+   T   LR   GH   V+ +++ P + +  S S D ++R+WD+R + 
Sbjct: 86  SSTMKSFDIRHLNLETNQYLRYFTGHGALVSDIEMSPLNDTFLSASYDESVRLWDMRAS- 144

Query: 455 CLKVFRGHVGQVQKIIP 471
                     + Q I+P
Sbjct: 145 ----------KAQAIVP 151

 Score = 32.0 bits (71), Expect = 1.5,   Method: Compositional matrix adjust.
 Identities = 19/64 (29%), Positives = 34/64 (53%), Gaps = 7/64 (10%)

Query: 528 CGLDNTIKLWDVK-----TGKCIRTQFGHVEGVWDIAAD--NFRIISGSHDGSIKVWDLQ 580
           C   +T+K +D++     T + +R   GH   V DI     N   +S S+D S+++WD++
Sbjct: 83  CVYSSTMKSFDIRHLNLETNQYLRYFTGHGALVSDIEMSPLNDTFLSASYDESVRLWDMR 142

Query: 581 SGKC 584
           + K 
Sbjct: 143 ASKA 146

>ABL044C [548] [Homologous to ScYMR093W - SH] (312378..313934) [1557
           bp, 518 aa]
          Length = 518

 Score = 40.0 bits (92), Expect = 0.006,   Method: Compositional matrix adjust.
 Identities = 56/235 (23%), Positives = 100/235 (42%), Gaps = 23/235 (9%)

Query: 364 IRVWNYITGECISTYRGHSDSVLSVDSYQ---KVIVSGSADKTVKVW--HVESRTCYTLR 418
           +++++  T + I T+    D V S  S++   K++ +G A   V V+  +       +++
Sbjct: 63  VQLFSSRTRQVIKTFSRFKDVVYS-SSFRPDGKLLAAGDATGLVSVYDSYNPRNLLVSIK 121

Query: 419 GHTEWVNCVKLHP-KSFSCFSCSDDTTIRMWDIR--TNSCLKVFRGHVGQVQKIIPLTIK 475
             T   +  K HP    +  + +DD  +R+WDI       L++  G    V+ +    + 
Sbjct: 122 ASTHPAHVTKFHPLDKQTLVTATDDRVVRVWDISHAYEPTLELL-GASDYVRSVC--FVP 178

Query: 476 DVENLATDNTSDGSSPQDDPTMTDGADESDTPSNEQETVLDENIPYPTHLLSCGLDNTIK 535
              ++      DG     D T T  A +  T  N   +V D     PT L+SCG  +  K
Sbjct: 179 GAPHMVVSGCYDGVVRLHD-TRTRSA-QPVTQLNHGMSVEDIVAISPTQLVSCG-GSKFK 235

Query: 536 LWDVKTGKCIRTQFGHVEGVW--------DIAADNFRIISGSHDGSIKVWDLQSG 582
           +WD+   K +  +    + V         D  A N  +++ S DG +KV+D   G
Sbjct: 236 VWDLTGNKLLHERGNFAKTVTCLDYVNMPDGGAMNSCLLASSLDGHVKVFDPLDG 290

 Score = 33.9 bits (76), Expect = 0.41,   Method: Compositional matrix adjust.
 Identities = 43/175 (24%), Positives = 73/175 (41%), Gaps = 16/175 (9%)

Query: 295 IQEFKGHMDGVLTLQF--NYRLLFTGSYDSTIGIWDLFTGKLIR---RLSGHSDGVKTLY 349
           I+ F    D V +  F  + +LL  G     + ++D +  + +    + S H   V   +
Sbjct: 74  IKTFSRFKDVVYSSSFRPDGKLLAAGDATGLVSVYDSYNPRNLLVSIKASTHPAHVTKFH 133

Query: 350 -FDDRKLITGSLDKTIRVWNYITG-ECISTYRGHSDSVLS---VDSYQKVIVSGSADKTV 404
             D + L+T + D+ +RVW+     E      G SD V S   V     ++VSG  D  V
Sbjct: 134 PLDKQTLVTATDDRVVRVWDISHAYEPTLELLGASDYVRSVCFVPGAPHMVVSGCYDGVV 193

Query: 405 KVWHVESRTC--YTLRGHTEWV-NCVKLHPKSFSCFSCSDDTTIRMWDIRTNSCL 456
           ++    +R+    T   H   V + V + P      SC   +  ++WD+  N  L
Sbjct: 194 RLHDTRTRSAQPVTQLNHGMSVEDIVAISPTQL--VSCG-GSKFKVWDLTGNKLL 245

  Database: blastdb
    Posted date:  Apr 3, 2006  3:33 PM
  Number of letters in database: 16,596,109
  Number of sequences in database:  34,618
  
Lambda     K      H
   0.320    0.134    0.418 

Gapped
Lambda     K      H
   0.267   0.0410    0.140 

Matrix: BLOSUM62
Gap Penalties: Existence: 11, Extension: 1
Number of Sequences: 34618
Number of Hits to DB: 21,406,358
Number of extensions: 978700
Number of successful extensions: 8629
Number of sequences better than 10.0: 442
Number of HSP's gapped: 6049
Number of HSP's successfully gapped: 1611
Length of query: 629
Length of database: 16,596,109
Length adjustment: 108
Effective length of query: 521
Effective length of database: 12,857,365
Effective search space: 6698687165
Effective search space used: 6698687165
Neighboring words threshold: 11
Window for multiple hits: 40
X1: 16 ( 7.4 bits)
X2: 38 (14.6 bits)
X3: 64 (24.7 bits)
S1: 41 (21.8 bits)
S2: 65 (29.6 bits)