Hit NameLength (aa)HSP LengthHSP ScoreHSP Significance
YIL045W (PIG2)53852924350.0
YER054C (GIP2)5481854532e-49
Scas_704.415821714436e-48
Scas_715.465701804357e-47
CAGL0J02904g5432054172e-44
Sklu_2260.63991793979e-43
CAGL0L00803g8272193685e-37
Kwal_23.57644621733482e-35
ADL083C3541473043e-30
KLLA0F27533g4981191862e-14
YOR178C (GAC1)7931451247e-07
YLR273C (PIG1)6481651183e-06
CAGL0H04037g91577890.010
Scas_526.4915103870.019
AGR275C67957860.021
Scas_521.157956780.20
Scas_659.2159456770.29
Kwal_56.2326242954740.55
CAGL0F04917g68254730.85
KLLA0D09240g74829649.0
BLASTP 2.2.26 [Sep-21-2011]

Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, 
Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), 
"Gapped BLAST and PSI-BLAST: a new generation of protein database search
programs",  Nucleic Acids Res. 25:3389-3402.

Reference for compositional score matrix adjustment: Altschul, Stephen F., 
John C. Wootton, E. Michael Gertz, Richa Agarwala, Aleksandr Morgulis,
Alejandro A. Schaffer, and Yi-Kuo Yu (2005) "Protein database searches
using compositionally adjusted substitution matrices", FEBS J. 272:5101-5109.

Query= YIL045W
         (529 letters)

Database: blastdb 
           34,618 sequences; 16,596,109 total letters

Searching..................................................done

                                                                 Score    E
Sequences producing significant alignments:                      (bits) Value

YIL045W (PIG2) [2622] chr9 (271160..272776) Protein that interac...   942   0.0  
YER054C (GIP2) [1483] chr5 complement(262051..263697) Glc7p-inte...   179   2e-49
Scas_704.41                                                           175   6e-48
Scas_715.46                                                           172   7e-47
CAGL0J02904g complement(279516..281147) similar to sp|P40036 Sac...   165   2e-44
Sklu_2260.6 YIL045W, Contig c2260 9086-10285 reverse complement       157   9e-43
CAGL0L00803g 98548..101031 some similarities with sp|P40036 Sacc...   146   5e-37
Kwal_23.5764                                                          138   2e-35
ADL083C [1658] [Homologous to ScYIL045W (PIG2) - SH; ScYER054C (...   121   3e-30
KLLA0F27533g 2549457..2550953 weakly similar to sp|P40036 Saccha...    76   2e-14
YOR178C (GAC1) [4975] chr15 complement(667860..670241) Regulator...    52   7e-07
YLR273C (PIG1) [3666] chr12 complement(689085..691031) Protein t...    50   3e-06
CAGL0H04037g complement(379169..381916) weakly similar to sp|P28...    39   0.010
Scas_526.4                                                             38   0.019
AGR275C [4586] [Homologous to ScYOR178C (GAC1) - SH; ScYLR273C (...    38   0.021
Scas_521.1                                                             35   0.20 
Scas_659.21                                                            34   0.29 
Kwal_56.23262                                                          33   0.55 
CAGL0F04917g complement(499132..501180) weakly similar to sp|P28...    33   0.85 
KLLA0D09240g complement(775848..778094) some similarities with s...    29   9.0  

>YIL045W (PIG2) [2622] chr9 (271160..272776) Protein that interacts
           with Gsy2p, possible regulatory subunit for the
           PP1-family protein phosphatase Glc7p [1617 bp, 538 aa]
          Length = 538

 Score =  942 bits (2435), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 466/529 (88%), Positives = 466/529 (88%)

Query: 1   MATTTQPQNILMDEXXXXXXXXXXXXXXXXXXXXIRTFAGMSMHMHPARLNSLEFLHKPR 60
           MATTTQPQNILMDE                    IRTFAGMSMHMHPARLNSLEFLHKPR
Sbjct: 1   MATTTQPQNILMDEPLNLPNNSAHNNNYGNINANIRTFAGMSMHMHPARLNSLEFLHKPR 60

Query: 61  RLSNVKLHRLPQDELQRNTDMNKGMYFNGKQVHAHHPFINSGANFNAHHQDVSKLGEEED 120
           RLSNVKLHRLPQDELQRNTDMNKGMYFNGKQVHAHHPFINSGANFNAHHQDVSKLGEEED
Sbjct: 61  RLSNVKLHRLPQDELQRNTDMNKGMYFNGKQVHAHHPFINSGANFNAHHQDVSKLGEEED 120

Query: 121 EISPLSHDNFQYESEENGNPSPPIYKKSGELVXXXXXXXXXXXPITPKSIFNKTGSKSKH 180
           EISPLSHDNFQYESEENGNPSPPIYKKSGELV           PITPKSIFNKTGSKSKH
Sbjct: 121 EISPLSHDNFQYESEENGNPSPPIYKKSGELVKSSLKRRSKSLPITPKSIFNKTGSKSKH 180

Query: 181 VNLDHVDTRLLQRSKSVHFDRVLPIKLFNENEKPIDVGKQMVQQDVLNFKHKPLTRLSAL 240
           VNLDHVDTRLLQRSKSVHFDRVLPIKLFNENEKPIDVGKQMVQQDVLNFKHKPLTRLSAL
Sbjct: 181 VNLDHVDTRLLQRSKSVHFDRVLPIKLFNENEKPIDVGKQMVQQDVLNFKHKPLTRLSAL 240

Query: 241 NGGSDSVPIEDLLSENNQNEYGDTWLQNPKGVFLFGTXXXXXXXXXXXXXXXXXXXXXXX 300
           NGGSDSVPIEDLLSENNQNEYGDTWLQNPKGVFLFGT                       
Sbjct: 241 NGGSDSVPIEDLLSENNQNEYGDTWLQNPKGVFLFGTNSNNRRNKKKKFKLSDDDSDIEN 300

Query: 301 XXXXXXXXXRLVRQQDKDQAHLAHGLKNLLINDDDDYLETRTNSAKSGANLFIGNSKRIV 360
                    RLVRQQDKDQAHLAHGLKNLLINDDDDYLETRTNSAKSGANLFIGNSKRIV
Sbjct: 301 DNDSDDAINRLVRQQDKDQAHLAHGLKNLLINDDDDYLETRTNSAKSGANLFIGNSKRIV 360

Query: 361 GLYNKNFPILSDRNRKSLKLNIFLNLSRGRPVFLQEITLLTGFHNMVIIGKVFVKNIYFD 420
           GLYNKNFPILSDRNRKSLKLNIFLNLSRGRPVFLQEITLLTGFHNMVIIGKVFVKNIYFD
Sbjct: 361 GLYNKNFPILSDRNRKSLKLNIFLNLSRGRPVFLQEITLLTGFHNMVIIGKVFVKNIYFD 420

Query: 421 KKIIVRYTWDAWRTFHESECVYFSNANGILPGSNMDIFKFSIDDIHNPNDKDSNISQLEF 480
           KKIIVRYTWDAWRTFHESECVYFSNANGILPGSNMDIFKFSIDDIHNPNDKDSNISQLEF
Sbjct: 421 KKIIVRYTWDAWRTFHESECVYFSNANGILPGSNMDIFKFSIDDIHNPNDKDSNISQLEF 480

Query: 481 CIQYLTWGVDRSRKEYWDNNDSANYKIDVVTNETRTGPTTDVNDNYEMK 529
           CIQYLTWGVDRSRKEYWDNNDSANYKIDVVTNETRTGPTTDVNDNYEMK
Sbjct: 481 CIQYLTWGVDRSRKEYWDNNDSANYKIDVVTNETRTGPTTDVNDNYEMK 529

>YER054C (GIP2) [1483] chr5 complement(262051..263697)
           Glc7p-interacting protein, possible regulatory subunit
           for the PP1 family protein phosphatase Glc7p [1647 bp,
           548 aa]
          Length = 548

 Score =  179 bits (453), Expect = 2e-49,   Method: Compositional matrix adjust.
 Identities = 90/185 (48%), Positives = 121/185 (65%), Gaps = 38/185 (20%)

Query: 359 IVGLYNKNFPILSDRNRKSLKLNIFLNLSRGRPVFLQEITLL-----------TGFHNM- 406
           +VGLY+KNFPILS++N KSLKLNIF+NLS+ + VFLQE++L            + F+N+ 
Sbjct: 357 VVGLYSKNFPILSNKNPKSLKLNIFINLSQNKKVFLQELSLYIHRDNNYFSNSSSFYNIP 416

Query: 407 ---------------------VIIGKVFVKNIYFDKKIIVRYTWDAWRTFHESECVYFSN 445
                                +I G++ VKNI++DK+++VRYTWD+WRT HE ECVY S+
Sbjct: 417 NSHNGNDCNGVAKGYNAGCTRLIAGRILVKNIFYDKRVVVRYTWDSWRTTHEVECVYISD 476

Query: 446 ANGILPGSNMDIFKFSIDDIHNPNDKDSNISQLEFCIQYLTWGVDRSRKEYWDNNDSANY 505
            +GILPG+NMDIF F IDD+   + +     +LEFCI Y T   D  R+EYWDNN+  NY
Sbjct: 477 GDGILPGTNMDIFHFIIDDVSKVDPR----GKLEFCIHYSTRN-DYEREEYWDNNNGNNY 531

Query: 506 KIDVV 510
           K+DVV
Sbjct: 532 KVDVV 536

 Score =  108 bits (269), Expect = 9e-25,   Method: Compositional matrix adjust.
 Identities = 77/238 (32%), Positives = 119/238 (50%), Gaps = 40/238 (16%)

Query: 50  LNSLEFLHKPRRLSNVKLHRLPQDELQRNTDMNKGMYFNGKQVHAHHPFINSGANFNAHH 109
           LNSL+FLHKP+R++ ++ +R P++E+QRNTD+NK ++  G   +  +    S      +H
Sbjct: 56  LNSLKFLHKPQRVTQMRANRFPEEEVQRNTDLNKRIFSAGNDENVDNESGWSKIAAAKNH 115

Query: 110 QDVSKLGEE-----EDEISPLS-----HDNFQYESEENGNP----------------SPP 143
             V  L        + E+ PLS       +FQ E  E  +P                +PP
Sbjct: 116 TSVESLNGSTRPPFKIELPPLSPKSTVPKSFQAEYPEAKSPGNDMNFEYDEEILIPFAPP 175

Query: 144 IYKKSGELVXXXXXXXXXXXPITPKSIFNKTGSKSKHVNLDHVDTRLLQRSKSVHFDRVL 203
           +YKKSGEL+           P TP  I +  G +++        + +L RSKSVHFD+  
Sbjct: 176 VYKKSGELLKSSLKRRSKSLPTTP-GIRSGNGVQARD------GSPMLIRSKSVHFDQAA 228

Query: 204 PIKLFNENEKPIDVGKQMVQQDVLNFKHKPLTRL-------SALNGGSDSVPIEDLLS 254
           P+K F E+E PI+V K     + L+FKHKP+  +         L+ G ++  I+D L+
Sbjct: 229 PVKYFAEDESPINVNKTEQHDNCLSFKHKPVNLMVDPEEETKMLSSGLETTSIDDDLT 286

>Scas_704.41
          Length = 582

 Score =  175 bits (443), Expect = 6e-48,   Method: Compositional matrix adjust.
 Identities = 84/171 (49%), Positives = 118/171 (69%), Gaps = 17/171 (9%)

Query: 353 IGNSKRIVGLYNKNFPILSDRNRKSLKLNIFLNLSRGRPVFLQEITLLT----------- 401
           + + K ++GLY+KNFP L+++N +SLKLNIF+N S+G+ VFLQ++ L             
Sbjct: 405 LTSEKSVIGLYSKNFPTLNNKNPRSLKLNIFVNYSKGKKVFLQDLNLHIQNDYINNHVGN 464

Query: 402 -GFHNMVIIGKVFVKNIYFDKKIIVRYTWDAWRTFHESECVYFSNANGILPGSNMDIFKF 460
               N  IIG+  V+NIYFDKK++++YTWD WR++ + E +Y S+A  I+PGSNMD+FKF
Sbjct: 465 NNKQNKYIIGRALVENIYFDKKVVLKYTWDNWRSYRDIEAIYVSDAKQIIPGSNMDVFKF 524

Query: 461 SIDDIHNPNDKDSNISQLEFCIQYLTWGVDRSRKEYWDNNDSANYKIDVVT 511
            IDD+    +K  +   LEFCIQY T   ++ RKE+WDNND  NYK+DVVT
Sbjct: 525 LIDDV----NKSVSKCHLEFCIQYQTRN-EKERKEFWDNNDDKNYKVDVVT 570

 Score = 92.8 bits (229), Expect = 1e-19,   Method: Compositional matrix adjust.
 Identities = 70/200 (35%), Positives = 100/200 (50%), Gaps = 20/200 (10%)

Query: 50  LNSLEFLHKPRRLSNVKLHRLPQDELQRNTDMNKGMYFNGKQVHAHHPFINSGANFNAHH 109
            +SL FL +PR+L  +KL+ LPQ+EL+RNT++NK +  N            +    N + 
Sbjct: 97  FSSLNFLQEPRKLDQLKLNALPQEELRRNTNLNKNI--NPIPTPIKPTIYKNSYYLNDND 154

Query: 110 QDVSKLGEE-EDEISPLSH----DNFQYESEENG----NPSPPIYKKSGELVXXXXXXXX 160
            D  K  +E EDEISP++         +    N     N   P+YKKSGEL+        
Sbjct: 155 TDAFKEEQENEDEISPITQVPANAKIPFPVPNNAYMEVNRIKPVYKKSGELLKPSLKRRS 214

Query: 161 XXXPITPKSIFNKTGSKSKHVNLDHVD----TRLLQRSKSVHFDRVLPIKLFNENEKPID 216
              P+TP    N +    + +N  H +       L RSKSVHF   LP++ F+++E PI 
Sbjct: 215 QSLPVTP----NISNLNLRRIN-GHANGNDRAHHLARSKSVHFANTLPVRFFSKDESPII 269

Query: 217 VGKQMVQQDVLNFKHKPLTR 236
           V +     + LNFKHKPL R
Sbjct: 270 VAESHEITNELNFKHKPLQR 289

>Scas_715.46
          Length = 570

 Score =  172 bits (435), Expect = 7e-47,   Method: Compositional matrix adjust.
 Identities = 85/180 (47%), Positives = 115/180 (63%), Gaps = 30/180 (16%)

Query: 358 RIVGLYNKNFPILSDRNRKSLKLNIFLNLSRGRPVFLQEITLLTGFHN------------ 405
           ++VGLYN NFPILS++N KSLKLNIF+ LS+ +  FLQE+TL     N            
Sbjct: 387 KVVGLYNINFPILSNKNPKSLKLNIFIKLSKDKKCFLQEVTLHIEKENPLKRLLPANGSN 446

Query: 406 -------------MVIIGKVFVKNIYFDKKIIVRYTWDAWRTFHESECVYFSNANGILPG 452
                         +I GK+ VKNI++DK++IVRYTW+ WRT H+ EC++ S+ +GI+PG
Sbjct: 447 SEFGQGSIIQRSTRLITGKILVKNIFYDKRVIVRYTWNDWRTVHDVECIWVSDGDGIVPG 506

Query: 453 SNMDIFKFSIDDIHNPNDKDSNISQLEFCIQYLTWGVDRSRKEYWDNNDSANYKIDVVTN 512
           +NMD+F+F IDD +    +    ++LEFCIQY T   D  R EYWDNND  NYK+ V+ N
Sbjct: 507 TNMDVFRFLIDDANKLEAR----AKLEFCIQY-TARNDTERLEYWDNNDGKNYKVGVIMN 561

 Score = 81.3 bits (199), Expect = 4e-16,   Method: Compositional matrix adjust.
 Identities = 63/206 (30%), Positives = 98/206 (47%), Gaps = 41/206 (19%)

Query: 50  LNSLEFLHKPRRLSNVKLHRLPQDELQRNTDMNKGMYFNGKQVHAHHPFINSGANFNAHH 109
           LNS++FL+KP+R++ + + + P++E++RNTD+NK +             + SG+      
Sbjct: 87  LNSMDFLYKPQRVTQMNVDKFPEEEVKRNTDLNKNIRL-----------VTSGS----VA 131

Query: 110 QDVSKLGEEE------DEISPLS----HDNFQYESEENG--------NPSPPIYKKSGEL 151
           +D  + G E        EISP S     +  Q    + G         P  PIYKKSGEL
Sbjct: 132 KDEEETGREYMSPIDLPEISPRSTIQSSEFIQNNKTQEGVDERYDGITPLSPIYKKSGEL 191

Query: 152 VXXXXXXXXXXXPITPKSIFNKTGSKSKHVNLDHVDTRLLQRSKSVHFDRVLPIKLFNEN 211
           +           P T + +        K +  ++ D   + RSKSVHFD+  P+K F E+
Sbjct: 192 LKSSLKRRSKSLPSTSEIL-------QKSLRFEN-DAMEMVRSKSVHFDQKAPVKYFRED 243

Query: 212 EKPIDVGKQMVQQDVLNFKHKPLTRL 237
           E P  V       ++LN  HKP+ R+
Sbjct: 244 ESPSTVNMMAEFDNLLNLMHKPVNRV 269

>CAGL0J02904g complement(279516..281147) similar to sp|P40036
           Saccharomyces cerevisiae YER054c GIP2, hypothetical
           start
          Length = 543

 Score =  165 bits (417), Expect = 2e-44,   Method: Compositional matrix adjust.
 Identities = 92/205 (44%), Positives = 126/205 (61%), Gaps = 31/205 (15%)

Query: 337 YLETRTNSAKS---GANLFIGN-----SKRIVGLYNKNFPILSDRNRKSLKLNIFLNLSR 388
           Y   RT+S  S   G ++F G+      +R+VGLYN+NFPILS++N KSLKLNIF+NLS+
Sbjct: 336 YSNYRTDSGASVSNGGSMFNGSYSGKQQQRVVGLYNENFPILSNKNPKSLKLNIFINLSQ 395

Query: 389 GRPVFLQEITL-----------------LTGFHNMVIIGKVFVKNIYFDKKIIVRYTWDA 431
           G+ VFLQE++L                  T  +  ++ G+V VKNI+FDK++++RYTWD 
Sbjct: 396 GKEVFLQELSLHIHRERAFYSPGSGVDIGTPINTRLLSGRVLVKNIFFDKRVLIRYTWDR 455

Query: 432 WRTFHESECVYFSNANGILP-GSNMDIFKFSIDDIHNPNDKDSNISQLEFCIQYLTWGVD 490
           WR   + E V+ S+A G++P G+ MD+F F IDD      K S    LEFCIQY T   D
Sbjct: 456 WRNVQDVEGVWVSSAQGLVPGGAAMDVFHFVIDDATKWEGKAS----LEFCIQYTTRD-D 510

Query: 491 RSRKEYWDNNDSANYKIDVVTNETR 515
             R E+WDNN   NY +D+V +  R
Sbjct: 511 TQRLEFWDNNCGKNYCVDLVMDGFR 535

 Score = 87.8 bits (216), Expect = 3e-18,   Method: Compositional matrix adjust.
 Identities = 63/192 (32%), Positives = 92/192 (47%), Gaps = 32/192 (16%)

Query: 48  ARLNSLEFLHKPRRLSNVKLHRLPQDELQRNTDMNKGMYFNGKQVHAHHPFINSGANFNA 107
            +L SL+FLHKP+R+S +   R P++EL RNT +NK ++    QV +++   + G     
Sbjct: 38  GKLTSLQFLHKPQRVSQLNKDRFPEEELLRNTQLNKNLH----QVDSNYREYSQGPGDGG 93

Query: 108 HHQDVSKLGEEEDEISPLSHDNFQYESEEN---------------GNPSPPIYKKSGELV 152
                S+  +  D++ PLS  +   E + N                  SPP+YKKSGE V
Sbjct: 94  ----ASERQQARDDLIPLSPKSTLPELDTNMLDNTLDSDNSSNDLAPFSPPVYKKSGEPV 149

Query: 153 XXXXXXXXXXXPITPKSIFNKTGSKSKHVNLDHVDTRLLQRSKSVHFDRVLPIKLFNENE 212
                      P TP    +  G+   +          L RSKSVHFD+  P++ FNENE
Sbjct: 150 KSVLKRRSKSLPGTPGLNTSMHGASPPNK---------LMRSKSVHFDQTAPVRYFNENE 200

Query: 213 KPIDVGKQMVQQ 224
           +PIDV    + Q
Sbjct: 201 RPIDVSNADIYQ 212

>Sklu_2260.6 YIL045W, Contig c2260 9086-10285 reverse complement
          Length = 399

 Score =  157 bits (397), Expect = 9e-43,   Method: Compositional matrix adjust.
 Identities = 85/179 (47%), Positives = 118/179 (65%), Gaps = 12/179 (6%)

Query: 344 SAKSGANLFIGNSKRIV-GLYNKNFPILSDRNRKSLKLNIFLNLSRGRPVFLQEITLLTG 402
           S  S A    G+S   V GLYNKNFPILS++N  SLKLNIFLN++ G+ VFLQ+++LL G
Sbjct: 212 SGPSPATTASGSSMPPVPGLYNKNFPILSNKNPTSLKLNIFLNIAHGKQVFLQDLSLL-G 270

Query: 403 FHNMVIIGKVFVKNIYFDKKIIVRYTWDAWRTFHESECVYFSNANGILPGSNMDIFKFSI 462
             N V+ GKV VKNI +DK++IVRYTWD W T H+ +CV+FS+ + +LPG NMD+FKF +
Sbjct: 271 DGNYVV-GKVLVKNICYDKQVIVRYTWDQWNTTHDVQCVWFSSGDIVLPGMNMDMFKFVV 329

Query: 463 D--------DIHNPNDKDSNISQLEFCIQYLTWGVDRSRKEYWDNNDSANYKIDVVTNE 513
           D         +   +       +++FCI+Y T   +  R+E+WDNN+  NY + VV  +
Sbjct: 330 DVPVDSAEATLATTDPDKEGGREVQFCIRYTTRDGNY-REEHWDNNNGKNYIVAVVIGD 387

 Score = 64.7 bits (156), Expect = 5e-11,   Method: Compositional matrix adjust.
 Identities = 63/207 (30%), Positives = 99/207 (47%), Gaps = 38/207 (18%)

Query: 52  SLEFLHKPRRLSNVKLHRLPQDELQRNTDMNKGM---YFNGKQVHAHHPFINSGANFNAH 108
           SL+FLHKP+R++ +K     +D LQRNT++N+G    Y N     +   +     +   H
Sbjct: 18  SLDFLHKPQRVTQLKT-LYAEDSLQRNTNLNRGPPPDYENVAPTDSREYY----GDGTLH 72

Query: 109 HQDVSKLGEEEDEISPLSHDNFQYESEENGNPSPPIYKKSGELVXXXXXX--XXXXXPIT 166
              +  L             N  +   +   P  PI KKSGELV             P T
Sbjct: 73  RGSIGSL-------------NSYFPDVDEYYPPKPIRKKSGELVKSSLKQHHRSKSLPAT 119

Query: 167 PKSIFNKTGSKSKHVNLDHVDTRLLQRSKSVHFDR--VLPIKLFNENEKPIDVGKQMVQQ 224
           P      TG + +    + +     +RSKSVHFD+  V+ +K F ++E+P++V ++ V++
Sbjct: 120 P------TGREPR---TEIIIMEPPKRSKSVHFDQRDVVSVKYFQKDERPVEVAQREVEE 170

Query: 225 DVLNFKHKPLTRLSALNGG-SDSVPIE 250
           D L+F  K   +LS +N   S+S P E
Sbjct: 171 DQLSFTPK---QLSFMNSWLSNSTPEE 194

>CAGL0L00803g 98548..101031 some similarities with sp|P40036
           Saccharomyces cerevisiae YER054c GIP2 or sp|P40187
           Saccharomyces cerevisiae YIL045w PIG2, hypothetical
           start
          Length = 827

 Score =  146 bits (368), Expect = 5e-37,   Method: Compositional matrix adjust.
 Identities = 82/219 (37%), Positives = 124/219 (56%), Gaps = 35/219 (15%)

Query: 322 LAHGLKNLLIND-----DDDYLETRTNSAKSGANLFIGNSKRIVGLYNKNFPILSDRNRK 376
            + GLK+L++ND      D++ +     ++S  +      +++  L +KNFP L  +  K
Sbjct: 612 FSRGLKSLMMNDRGSGLKDNFKDPTPPVSQSSTS---KKEEKMTTLVSKNFPTLGSKTSK 668

Query: 377 SLKLNIFLNLSRGRPVFLQEITL-----LTGFHN-------------------MVIIGKV 412
           SLKLNIFLN +  + V LQE++L      + ++N                   ++I G V
Sbjct: 669 SLKLNIFLNSTSDKKVLLQEVSLNVQKRKSNYYNSNFGGPGIGFSTGRDEDDKLIITGTV 728

Query: 413 FVKNIYFDKKIIVRYTWDAWRTFHESECVYFSNANGILPGSNMDIFKFSIDD--IHNPND 470
            VKNIYFDKK+ +RYTWD WR+ +E E +Y  + N  LPGS MDIF+F ID+  + N   
Sbjct: 729 LVKNIYFDKKVSIRYTWDHWRSCNEVESMYVGSGNNYLPGSQMDIFRFMIDNTVLSNGQY 788

Query: 471 KDSNISQLEFCIQYLTWGVDRSRKEYWDNNDSANYKIDV 509
             +   +LEFCIQY T   + +R+EYWDNN+  NY +++
Sbjct: 789 VSNRSRELEFCIQYTTRS-NTAREEYWDNNNGKNYIVEI 826

 Score = 97.4 bits (241), Expect = 5e-21,   Method: Compositional matrix adjust.
 Identities = 78/246 (31%), Positives = 118/246 (47%), Gaps = 54/246 (21%)

Query: 48  ARLNSLEFLHKPRRLSNVKLHR-LPQDELQRNTDMNK----------------------- 83
            R+NSL+FLHKP+R++ +K    +  +EL+RNTDMNK                       
Sbjct: 308 GRINSLDFLHKPQRVTQMKSEDFISPEELKRNTDMNKQILMAKILPDDRINDKIDDITTP 367

Query: 84  -----GMYFNGKQVHAHHPFINSGANFNAHHQDVSKLGEEEDEISPLSH----------- 127
                G+     ++   +   NS A  +   +++ +L ++E  ISP  H           
Sbjct: 368 EEEITGLKHELGKMSIGNGSANSPAINSIKAEEIIELAQDE-SISPTEHHYPILNRANQA 426

Query: 128 ---------DNF-QYESEENGNPSPPIYKKSGELVXXXXXXXXXXXPITPKSIFNKTGSK 177
                    D++ Q   E++  P PP+YKKSGELV           P+TP S  N+    
Sbjct: 427 QQDVCLPLHDSYDQSPVEDHMMPLPPVYKKSGELVKSSLKRRSKSLPVTPNS--NRRTQN 484

Query: 178 SKHVNLDHVDTRLLQRSKSVHFDRVLPIKLFNENEKPIDVGKQMVQQDVLNFKHKPLTRL 237
           S+ V +++   +L+ RSKSVHFD+ LP+K F + E P  V  +  + DVL+F+HKPL R 
Sbjct: 485 SRGVRMNNPRDQLI-RSKSVHFDQRLPVKYFFKEESPSVVSIRDEEDDVLSFQHKPLVRS 543

Query: 238 SALNGG 243
              N G
Sbjct: 544 IDRNNG 549

>Kwal_23.5764
          Length = 462

 Score =  138 bits (348), Expect = 2e-35,   Method: Compositional matrix adjust.
 Identities = 73/173 (42%), Positives = 105/173 (60%), Gaps = 19/173 (10%)

Query: 361 GLYNKNFPILSDRNRKSLKLNIFLNLSRGRPVFLQEITLLTGFHNMVIIGKVFVKNIYFD 420
           GLY+ NF  L+D ++ SLK NIFLN++     FLQE++L+   H   ++G V VKN+Y++
Sbjct: 284 GLYHANFATLADDDQCSLKSNIFLNIAHNSSCFLQELSLIGDQH--YLVGHVLVKNVYYE 341

Query: 421 KKIIVRYTWDAWRTFHESECVYFSNANGILPGSNMDIFKFSID-----------DIHNPN 469
           K ++VRYT D+WRT  + ECV+ S+ + +LPG +MD FK  ID           D    +
Sbjct: 342 KTVLVRYTRDSWRTSRDIECVWASSGDDVLPGMHMDRFKLVIDLAGLQEGDTSRDSTPSH 401

Query: 470 DKDSNISQ-----LEFCIQYLTWGVDRSRKEYWDNNDSANYKIDVVTNETRTG 517
           D   +  Q     L+FCIQY++   + SR EYWDNN   NY +DVV++  R G
Sbjct: 402 DSAGHACQLSTVRLQFCIQYVSRDAN-SRVEYWDNNAGRNYVVDVVSSAPRMG 453

 Score = 52.8 bits (125), Expect = 5e-07,   Method: Compositional matrix adjust.
 Identities = 58/196 (29%), Positives = 87/196 (44%), Gaps = 30/196 (15%)

Query: 52  SLEFLHKPRRLSNVKLHRLPQDE-LQRNTDMNKGM---------YFNGKQVHAHHPFINS 101
           SL FLHKP+R++  +   L  DE L+RNTDMN+G          YF+ +      P   +
Sbjct: 23  SLAFLHKPQRVTQPRA--LYADEWLRRNTDMNRGNVKVENCPEDYFS-QNFKGDGPTKQT 79

Query: 102 GANFNAHHQDVSKLGEEEDEISPLSHDNFQYESEENG----NPSPP-IYKKSGELVXXX- 155
            A+        +      D  SPL  + + + +EE+       +PP + KKSGE+V    
Sbjct: 80  AASEANGFDPSASNASAGDTASPLRVNPY-FPAEEDSVVADAAAPPLVRKKSGEVVRPSL 138

Query: 156 -XXXXXXXXPITPKSIFNKTGSKSKHVNLDHVDTRLLQRSKSVHFDR--VLPIKLFNENE 212
                    P TP         +     L        +RSKSVHFD+  V+  K F + +
Sbjct: 139 KMAQRSRSLPATPS-------DREPDKRLGGPPAAGPKRSKSVHFDQRDVVKFKYFWQED 191

Query: 213 KPIDVGKQMVQQDVLN 228
            P+DV +Q V +  L+
Sbjct: 192 SPLDVAEQDVLEGPLD 207

>ADL083C [1658] [Homologous to ScYIL045W (PIG2) - SH; ScYER054C
           (GIP2) - SH] (537421..538485) [1065 bp, 354 aa]
          Length = 354

 Score =  121 bits (304), Expect = 3e-30,   Method: Compositional matrix adjust.
 Identities = 63/147 (42%), Positives = 96/147 (65%), Gaps = 8/147 (5%)

Query: 362 LYNKNFPILSDRNRKSLKLNIFLNLSRGRPVFLQEITLLTGFHNMVIIGKVFVKNIYFDK 421
           L N NFPIL++++   L LNIFLN++  R VFLQ+++L +    +V+ G+V VKNI++DK
Sbjct: 214 LRNVNFPILANKDPAVLTLNIFLNIAYNRKVFLQDLSLDS---MLVMTGRVLVKNIHYDK 270

Query: 422 KIIVRYTWDAWRTFHESECVYFSNANGILPGSNMDIFKFSIDDIHNPNDKDSNISQLEFC 481
            +IVRYTWD W    ++  V+ S+ N +LPG +MD+F+F+I D+  P    S   +LEFC
Sbjct: 271 SVIVRYTWDNWAHTSDTASVWISSGNAVLPGKDMDLFEFAI-DVPAPV---SGTPRLEFC 326

Query: 482 IQYLTWGVDRSRKEYWDNNDSANYKID 508
           I+Y     +   + +WDNN   NY ++
Sbjct: 327 IRYQVRD-NSDFQTHWDNNHGNNYVVE 352

 Score = 34.7 bits (78), Expect = 0.15,   Method: Compositional matrix adjust.
 Identities = 45/190 (23%), Positives = 70/190 (36%), Gaps = 51/190 (26%)

Query: 48  ARLNSLEFLHKPRRLSNVKLHRLPQDELQRNTDMNKGMYFNGKQVHAHHPFINSGANFNA 107
            + +SL  L KP+R+S+       ++ L+RNTD N+                  G  + A
Sbjct: 22  GKYSSLALLRKPQRISSRTEREEQENILKRNTDYNRK---------------RGGGTWAA 66

Query: 108 HHQDVSKLGEEEDEISPLSHDNFQYESEENGNPSPPI----YKKSGELVXXXXXXXXXXX 163
                      ++ I PL  D    ES      SP +    + +S  +            
Sbjct: 67  -----------DENIDPLDGD----ESPRRAG-SPVVLTDYFSQSHAVYDNVGHQRSNSL 110

Query: 164 PITPKSIFNKTGSKSKHVNLDHVDTRLLQRSKSVHFDR--VLPIKLFNENEKPIDVGKQM 221
           P TP S   + G               ++RSKSVHFD   V+ +K FN +E  + V    
Sbjct: 111 PGTPTSALKRPGG--------------VRRSKSVHFDNRDVVSVKYFNSDESTLLVAHAQ 156

Query: 222 VQQDVLNFKH 231
             +D L  + 
Sbjct: 157 SFEDQLRLRQ 166

>KLLA0F27533g 2549457..2550953 weakly similar to sp|P40036
           Saccharomyces cerevisiae YER054c GIP2 GLC7P-interacting
           protein, hypothetical start
          Length = 498

 Score = 76.3 bits (186), Expect = 2e-14,   Method: Compositional matrix adjust.
 Identities = 44/119 (36%), Positives = 71/119 (59%), Gaps = 11/119 (9%)

Query: 394 LQEITLLTGFHNMVIIGKVFVKNIYFDKKIIVRYTWDAWRTFHESECVYFSNANGILPGS 453
           LQ++ L T  H  ++IG V V+NI ++K++IVRYT D+W++  + E V+ +N   +  G+
Sbjct: 385 LQDLRLDTQGH--MLIGNVIVRNISYEKRVIVRYTLDSWKSQQDVESVWITNHCNLKSGT 442

Query: 454 ---NMDIFKFSIDDIHNPNDKDSNISQLEFCIQYLTWGVDRSRKEYWDNNDSANYKIDV 509
              ++D+F+F+ID       K + I  +E CI Y T     S  ++WDNN   NYK+ V
Sbjct: 443 GAIDIDVFQFAID-----LGKINTIEHIEMCILYQT-REGSSWIDHWDNNSGQNYKVSV 495

 Score = 37.4 bits (85), Expect = 0.032,   Method: Compositional matrix adjust.
 Identities = 30/104 (28%), Positives = 47/104 (45%), Gaps = 13/104 (12%)

Query: 44  HMHPARLNSLEFLHKPRRLSNVKLHRLPQDELQRNTDMNKGMYFNGKQVH-----AHHPF 98
           ++   + +SL FL KP+R+S         D L+RNTD+NK      K +       H P 
Sbjct: 9   NLQSGKFSSLNFLRKPQRISCQVETTAMNDALKRNTDLNKSKIIVDKSLQDSQHDEHDPV 68

Query: 99  -------INSGANFNAHHQDVSKLGEEEDEISPLSHDNFQYESE 135
                  +N   NFN    D SK  + + E  PL  + ++ E++
Sbjct: 69  GNELAGRLNEKLNFNK-DADPSKKEDWDVETDPLKKEAWESETD 111

>YOR178C (GAC1) [4975] chr15 complement(667860..670241) Regulatory
           subunit for protein serine/threonine phosphatase Glc7p
           [2382 bp, 793 aa]
          Length = 793

 Score = 52.4 bits (124), Expect = 7e-07,   Method: Compositional matrix adjust.
 Identities = 44/145 (30%), Positives = 72/145 (49%), Gaps = 26/145 (17%)

Query: 379 KLNIFLNLSRGRPVFLQEITLLTGFHNMVIIGKVFVKNIYFDKKIIVRYTWDAWRTFHES 438
           +L  +LN   G+ V L  +T L G  +  I G V+VKN+ F+K + +++T+++WR  H  
Sbjct: 233 QLTKYLN---GQNVKLHSLTQL-GDDSSKITGLVYVKNLSFEKYLEIKFTFNSWRDIH-- 286

Query: 439 ECVYFSNANGILPGSNMDIFKFSID------------DIHNPNDKDSNISQLEFCIQYLT 486
                +N N  +  SN+D FKF+ID             I    +  S    +E C +Y  
Sbjct: 287 --YVTANFNRTI-NSNVDEFKFTIDLNSLKYILLIKRIITMEKNTSSCPLNIELCCRY-- 341

Query: 487 WGVDRSRKEYWDNNDSANYKIDVVT 511
              D + + Y+DNN+  NY + + T
Sbjct: 342 ---DVNNETYYDNNNGKNYHLFMTT 363

>YLR273C (PIG1) [3666] chr12 complement(689085..691031) Protein that
           interacts with Gsy2p, possible regulatory subunit for
           the PP1 family protein phosphatase Glc7p [1947 bp, 648
           aa]
          Length = 648

 Score = 50.1 bits (118), Expect = 3e-06,   Method: Compositional matrix adjust.
 Identities = 47/165 (28%), Positives = 77/165 (46%), Gaps = 28/165 (16%)

Query: 359 IVGLYNKNFPILSDRNRKSLKLNIFLNLSRGRPVFLQEITLLTGFHNMVIIGKVFVKNIY 418
           + GL +K F  L+ +N K   L +        PV  ++I     F N  I G +FV N+ 
Sbjct: 182 VTGLEDKIFKYLNGQNIKVHSLEL------SDPVSYEDI-CSNNFGNCQIWGLIFVNNLN 234

Query: 419 FDKKIIVRYTWDAWRTFHESECVYFSNANGILPGSNMDIFKFSID------DIHNPN--- 469
           F+KKI +++T + W   H     Y      + P  ++D FKF ID      ++ + N   
Sbjct: 235 FEKKIEIKFTLNNWADIHYINAHY---NKSVTP--HVDEFKFIIDISALKLNLISKNLIY 289

Query: 470 -----DKDSNISQLEFCIQYLTWGVDRSRKEYWDNNDSANYKIDV 509
                 K + +  L+FC +Y   G +   + ++DNND  NY+I +
Sbjct: 290 TNFFERKTTCLLNLQFCCRYDVNGFE--YRSFYDNNDYKNYEITI 332

>CAGL0H04037g complement(379169..381916) weakly similar to sp|P28006
           Saccharomyces cerevisiae YOR178c GAC1 ser/thr
           phosphoprotein phosphatase 1, hypothetical start
          Length = 915

 Score = 38.9 bits (89), Expect = 0.010,   Method: Compositional matrix adjust.
 Identities = 23/77 (29%), Positives = 41/77 (53%), Gaps = 16/77 (20%)

Query: 408 IIGKVFVKNIYFDKKIIVRYTWDAWRTFHESECVYFSNANGILPGSNMDIFKFSIDDIHN 467
           I+GK+ VKN+ ++K I V+YT++ W   H     YF+ +      + +D F+F I     
Sbjct: 298 IVGKILVKNLNYEKFIEVKYTFNNWNDIHYI-TAYFTKS----ISAEIDEFEFKI----- 347

Query: 468 PNDKDSNISQLEFCIQY 484
                 N+S L++ +Q+
Sbjct: 348 ------NLSSLKYILQF 358

>Scas_526.4
          Length = 915

 Score = 38.1 bits (87), Expect = 0.019,   Method: Compositional matrix adjust.
 Identities = 30/103 (29%), Positives = 57/103 (55%), Gaps = 8/103 (7%)

Query: 362 LYNKNFPILSDRNRK-SLKLNIFLNLSRGRPVFLQEITLLTGFHNMVIIGKVFVKNIYFD 420
           L + N     D N+K SL++++F N  +G+ + L  +   +  ++  +IG ++V N+ F+
Sbjct: 263 LKSSNISTFHDTNKKNSLEVSLF-NFLQGQNIRLHSLNQDSN-NSSKLIGLIYVNNLNFE 320

Query: 421 KKIIVRYTWDAWRTFHESECVYFSNANGILPGSNMDIFKFSID 463
           K I ++++++ W+  H      F N +     SN+D FKF ID
Sbjct: 321 KFIEIKFSFNHWKDIH--YVTAFLNKSVT---SNIDEFKFVID 358

>AGR275C [4586] [Homologous to ScYOR178C (GAC1) - SH; ScYLR273C
           (PIG1) - SH] (1254768..1256807) [2040 bp, 679 aa]
          Length = 679

 Score = 37.7 bits (86), Expect = 0.021,   Method: Compositional matrix adjust.
 Identities = 18/57 (31%), Positives = 30/57 (52%), Gaps = 5/57 (8%)

Query: 407 VIIGKVFVKNIYFDKKIIVRYTWDAWRTFHESECVYFSNANGILPGSNMDIFKFSID 463
            I G ++V N++F+K I V++++D W+  H     Y          S +D F+F ID
Sbjct: 285 TIKGSLYVTNLHFEKFIEVKFSFDEWKNIHYVTAQYLKTVT-----SKVDEFQFIID 336

>Scas_521.1
          Length = 579

 Score = 34.7 bits (78), Expect = 0.20,   Method: Compositional matrix adjust.
 Identities = 20/56 (35%), Positives = 32/56 (57%), Gaps = 5/56 (8%)

Query: 408 IIGKVFVKNIYFDKKIIVRYTWDAWRTFHESECVYFSNANGILPGSNMDIFKFSID 463
           ++G + V NI F+K I V++T++ W    E+ C   +  N  L  +  D FKF+ID
Sbjct: 205 LVGLILVNNIQFEKNIEVKFTFNNW----ENICYQVAYFNRSL-NAKFDEFKFTID 255

>Scas_659.21
          Length = 594

 Score = 34.3 bits (77), Expect = 0.29,   Method: Compositional matrix adjust.
 Identities = 18/56 (32%), Positives = 31/56 (55%), Gaps = 5/56 (8%)

Query: 408 IIGKVFVKNIYFDKKIIVRYTWDAWRTFHESECVYFSNANGILPGSNMDIFKFSID 463
           ++G + V NI F+K I V++T++ W      +  YF+ +  +      D FKF+ID
Sbjct: 223 LVGLILVNNIQFEKNIEVKFTFNNWENIC-YQVAYFNRSLNV----KFDEFKFTID 273

>Kwal_56.23262
          Length = 429

 Score = 33.1 bits (74), Expect = 0.55,   Method: Compositional matrix adjust.
 Identities = 16/54 (29%), Positives = 30/54 (55%), Gaps = 5/54 (9%)

Query: 410 GKVFVKNIYFDKKIIVRYTWDAWRTFHESECVYFSNANGILPGSNMDIFKFSID 463
           G ++V N+ F+K + +++T++ WR  H     Y +  +       +D FKF+ID
Sbjct: 38  GLIYVANLNFEKSLEIKFTFNNWRDVH-----YVAAHHHRSITDAIDEFKFTID 86

>CAGL0F04917g complement(499132..501180) weakly similar to sp|P28006
           Saccharomyces cerevisiae YOR178c GAC1 ser/thr
           phosphoprotein phosphatase 1, hypothetical start
          Length = 682

 Score = 32.7 bits (73), Expect = 0.85,   Method: Compositional matrix adjust.
 Identities = 15/54 (27%), Positives = 31/54 (57%), Gaps = 5/54 (9%)

Query: 410 GKVFVKNIYFDKKIIVRYTWDAWRTFHESECVYFSNANGILPGSNMDIFKFSID 463
           G ++V N+ F+K I V+++++ W+  H +   Y  +        ++D F+F+ID
Sbjct: 194 GLIYVNNLNFEKFIEVKFSFNNWKDIHYATATYNKSI-----TDHIDEFRFTID 242

>KLLA0D09240g complement(775848..778094) some similarities with
           sp|P28006 Saccharomyces cerevisiae YOR178c GAC1 ser/thr
           phosphoprotein phosphatase 1, regulatory chain,
           hypothetical start
          Length = 748

 Score = 29.3 bits (64), Expect = 9.0,   Method: Compositional matrix adjust.
 Identities = 8/29 (27%), Positives = 20/29 (68%)

Query: 408 IIGKVFVKNIYFDKKIIVRYTWDAWRTFH 436
           + G ++V N+ F+K I ++++++ W+  H
Sbjct: 472 LTGLIYVNNLSFEKFIEIKFSFNGWKDIH 500

  Database: blastdb
    Posted date:  Apr 3, 2006  3:33 PM
  Number of letters in database: 16,596,109
  Number of sequences in database:  34,618
  
Lambda     K      H
   0.317    0.135    0.400 

Gapped
Lambda     K      H
   0.267   0.0410    0.140 

Matrix: BLOSUM62
Gap Penalties: Existence: 11, Extension: 1
Number of Sequences: 34618
Number of Hits to DB: 17,609,183
Number of extensions: 812954
Number of successful extensions: 2435
Number of sequences better than 10.0: 29
Number of HSP's gapped: 2439
Number of HSP's successfully gapped: 40
Length of query: 529
Length of database: 16,596,109
Length adjustment: 106
Effective length of query: 423
Effective length of database: 12,926,601
Effective search space: 5467952223
Effective search space used: 5467952223
Neighboring words threshold: 11
Window for multiple hits: 40
X1: 16 ( 7.3 bits)
X2: 38 (14.6 bits)
X3: 64 (24.7 bits)
S1: 41 (21.6 bits)
S2: 64 (29.3 bits)