Hit NameLength (aa)HSP LengthHSP ScoreHSP Significance
YIL044C (AGE2)29829411681e-163
Scas_704.423111255021e-61
CAGL0L00825g2651244798e-59
Kwal_47.181722732374712e-57
Sklu_2260.42692334484e-54
KLLA0F27555g2791624312e-51
ADL084W2331204115e-49
Kwal_33.131018731172068e-18
CAGL0H01617g3491091974e-17
KLLA0D18942g357701931e-16
ABL164C3601331931e-16
YDR524C (AGE1)4821131932e-16
CAGL0G05445g354751913e-16
AFR725C8731251934e-16
Sklu_2267.4359701843e-15
Scas_677.6357711833e-15
Scas_685.258771131854e-15
Kwal_23.4569370701826e-15
YDL226C (GCS1)352711782e-14
KLLA0E06787g515841613e-12
AGL279C451801571e-11
YNL204C (SPS18)300761523e-11
ACL055W4711171534e-11
Kwal_27.10676466821524e-11
CAGL0G03707g486711524e-11
Scas_672.9485711454e-10
YER122C (GLO3)493901454e-10
Sklu_2181.34141221436e-10
Scas_707.333961371364e-09
Scas_602.104471031357e-09
YGL181W (GTS1)3961221348e-09
CAGL0L06028g5051321286e-08
Kwal_47.172483111171266e-08
KLLA0C17138g3831331223e-07
CAGL0C02277g82351710.65
YGL107C (RMD9)646116653.1
KLLA0C08635g30668634.5
YFL022C (FRS2)503105627.9
CAGL0J08613g73768629.0
BLASTP 2.2.26 [Sep-21-2011]

Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, 
Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), 
"Gapped BLAST and PSI-BLAST: a new generation of protein database search
programs",  Nucleic Acids Res. 25:3389-3402.

Reference for compositional score matrix adjustment: Altschul, Stephen F., 
John C. Wootton, E. Michael Gertz, Richa Agarwala, Aleksandr Morgulis,
Alejandro A. Schaffer, and Yi-Kuo Yu (2005) "Protein database searches
using compositionally adjusted substitution matrices", FEBS J. 272:5101-5109.

Query= YIL044C
         (294 letters)

Database: blastdb 
           34,618 sequences; 16,596,109 total letters

Searching..................................................done

                                                                 Score    E
Sequences producing significant alignments:                      (bits) Value

YIL044C (AGE2) [2623] chr9 complement(272949..273845) GTPase-act...   454   e-163
Scas_704.42                                                           197   1e-61
CAGL0L00825g complement(102709..103506) similar to sp|P40529 Sac...   189   8e-59
Kwal_47.18172                                                         186   2e-57
Sklu_2260.4 YIL044C, Contig c2260 5970-6779                           177   4e-54
KLLA0F27555g complement(2554571..2555410) some similarities with...   170   2e-51
ADL084W [1657] [Homologous to ScYIL044C (AGE2) - SH] complement(...   162   5e-49
Kwal_33.13101                                                          84   8e-18
CAGL0H01617g 157279..158328 similar to tr|Q04412 Saccharomyces c...    80   4e-17
KLLA0D18942g 1594560..1595633 similar to sp|P35197 Saccharomyces...    79   1e-16
ABL164C [428] [Homologous to ScYDL226C (GCS1) - SH; ScYNL204C (S...    79   1e-16
YDR524C (AGE1) [1336] chr4 complement(1487530..1488978) ADP-ribo...    79   2e-16
CAGL0G05445g complement(514769..515833) similar to sp|P35197 Sac...    78   3e-16
AFR725C [3918] [Homologous to ScYDR524C (AGE1) - SH] (1771660..1...    79   4e-16
Sklu_2267.4 YDL226C, Contig c2267 4691-5770 reverse complement         75   3e-15
Scas_677.6                                                             75   3e-15
Scas_685.25                                                            76   4e-15
Kwal_23.4569                                                           75   6e-15
YDL226C (GCS1) [649] chr4 complement(51116..52174) GTPase-activa...    73   2e-14
KLLA0E06787g 618131..619678 similar to sp|P38682 Saccharomyces c...    67   3e-12
AGL279C [4033] [Homologous to ScYER122C (GLO3) - SH] (182187..18...    65   1e-11
YNL204C (SPS18) [4399] chr14 complement(258374..259276) Sporulat...    63   3e-11
ACL055W [994] [Homologous to ScYGL181W (GTS1) - SH] complement(2...    64   4e-11
Kwal_27.10676                                                          63   4e-11
CAGL0G03707g complement(355469..356929) similar to sp|P38682 Sac...    63   4e-11
Scas_672.9                                                             60   4e-10
YER122C (GLO3) [1552] chr5 complement(402867..404348) GTPase-act...    60   4e-10
Sklu_2181.3 YGL181W, Contig c2181 6465-7709                            60   6e-10
Scas_707.33                                                            57   4e-09
Scas_602.10                                                            57   7e-09
YGL181W (GTS1) [1810] chr7 (157910..159100) Putative zinc-finger...    56   8e-09
CAGL0L06028g complement(675584..677101) weakly similar to sp|P40...    54   6e-08
Kwal_47.17248                                                          53   6e-08
KLLA0C17138g 1497245..1498396 some similarities with sp|P40956 S...    52   3e-07
CAGL0C02277g complement(230496..232967) weakly similar to sp|P18...    32   0.65 
YGL107C (RMD9) [1877] chr7 complement(304334..306274) Protein po...    30   3.1  
KLLA0C08635g complement(755556..756476) some similarities with s...    29   4.5  
YFL022C (FRS2) [1661] chr6 complement(93497..95008) Phenylalanyl...    28   7.9  
CAGL0J08613g 851406..853619 similar to tr|Q12324 Saccharomyces c...    28   9.0  

>YIL044C (AGE2) [2623] chr9 complement(272949..273845)
           GTPase-activating protein for Arf1p, has overlapping
           function with Gcs1p in transport from the trans-Golgi
           network (TGN), involved in endocytosis [897 bp, 298 aa]
          Length = 298

 Score =  454 bits (1168), Expect = e-163,   Method: Compositional matrix adjust.
 Identities = 229/294 (77%), Positives = 229/294 (77%)

Query: 1   MSTSVPVKKALSALLRDPGNSHCADCKAQLHPRWASWSLGVFICIKCAGIHRSLGTHISK 60
           MSTSVPVKKALSALLRDPGNSHCADCKAQLHPRWASWSLGVFICIKCAGIHRSLGTHISK
Sbjct: 1   MSTSVPVKKALSALLRDPGNSHCADCKAQLHPRWASWSLGVFICIKCAGIHRSLGTHISK 60

Query: 61  VKSVDLDTWKEEHLVKLIQFKNNLRANSYYEATLADELKQRKITDTSSLQNFIKNKYEYK 120
           VKSVDLDTWKEEHLVKLIQFKNNLRANSYYEATLADELKQRKITDTSSLQNFIKNKYEYK
Sbjct: 61  VKSVDLDTWKEEHLVKLIQFKNNLRANSYYEATLADELKQRKITDTSSLQNFIKNKYEYK 120

Query: 121 KWIGDLSSIEGLNDSTEPVLHKPSANHSLPASNARLDQSSNSLQKTQTQPPXXXXXXXXX 180
           KWIGDLSSIEGLNDSTEPVLHKPSANHSLPASNARLDQSSNSLQKTQTQPP         
Sbjct: 121 KWIGDLSSIEGLNDSTEPVLHKPSANHSLPASNARLDQSSNSLQKTQTQPPSHLLSTSRS 180

Query: 181 XXXXXXXQVXXXXXXXXXXXXXXXXXXIGAANTKTGNRVGEFGQRNDLKKSILSLYSKPX 240
                  QV                  IGAANTKTGNRVGEFGQRNDLKKSILSLYSKP 
Sbjct: 181 NTSLLNLQVSSLSKTTSNTSVTSSATSIGAANTKTGNRVGEFGQRNDLKKSILSLYSKPS 240

Query: 241 XXXXXXXXXXXXXXXXPCNTPSPFVNTGITATXXXXXXXXXXXXXXLDDNELFK 294
                           PCNTPSPFVNTGITAT              LDDNELFK
Sbjct: 241 AQTQSQNSFFTSTTPQPCNTPSPFVNTGITATNNNSMNSNSSSNISLDDNELFK 294

>Scas_704.42
          Length = 311

 Score =  197 bits (502), Expect = 1e-61,   Method: Compositional matrix adjust.
 Identities = 92/125 (73%), Positives = 104/125 (83%), Gaps = 1/125 (0%)

Query: 1   MSTSVPVKKALSALLRDPGNSHCADCKAQLHPRWASWSLGVFICIKCAGIHRSLGTHISK 60
           MSTS  VKKAL+ALLRDPGNS+CADCK Q HPRWASWSLGVF+CIKCAG+HRSLGTHI+K
Sbjct: 1   MSTSPSVKKALTALLRDPGNSNCADCKLQSHPRWASWSLGVFVCIKCAGVHRSLGTHITK 60

Query: 61  VKSVDLDTWKEEHLVKLIQFKNNLRANSYYEATLADELKQRK-ITDTSSLQNFIKNKYEY 119
           VKSVDLDTWKEEHL  LI+ +NN+ AN YYEA L D    +  ITDT+ LQ FI+ KYE 
Sbjct: 61  VKSVDLDTWKEEHLEMLIKMRNNVEANRYYEANLPDSSSLKNGITDTNKLQLFIRTKYEL 120

Query: 120 KKWIG 124
           KKW+G
Sbjct: 121 KKWVG 125

 Score = 32.0 bits (71), Expect = 0.49,   Method: Compositional matrix adjust.
 Identities = 15/16 (93%), Positives = 15/16 (93%)

Query: 224 QRNDLKKSILSLYSKP 239
           QR DLKKSILSLYSKP
Sbjct: 211 QRPDLKKSILSLYSKP 226

>CAGL0L00825g complement(102709..103506) similar to sp|P40529
           Saccharomyces cerevisiae YIL044c AGE2, hypothetical
           start
          Length = 265

 Score =  189 bits (479), Expect = 8e-59,   Method: Compositional matrix adjust.
 Identities = 87/124 (70%), Positives = 100/124 (80%), Gaps = 3/124 (2%)

Query: 3   TSVPVKKALSALLRDPGNSHCADCKAQLHPRWASWSLGVFICIKCAGIHRSLGTHISKVK 62
           TSVPVKKAL+ LLRDPGN+ CADCK+Q HPRWASWSLGVFICIKCAG+HRSLGTHISKVK
Sbjct: 2   TSVPVKKALTTLLRDPGNASCADCKSQSHPRWASWSLGVFICIKCAGVHRSLGTHISKVK 61

Query: 63  SVDLDTWKEEHLVKLIQFKNNLRANSYYEATLADELK---QRKITDTSSLQNFIKNKYEY 119
           SVDLDTWKEEHL +L+Q +NN+ AN  YEA L D  K   +    D + LQ FI+ KYE 
Sbjct: 62  SVDLDTWKEEHLKELVQMRNNVNANRVYEAKLPDSSKFNGKSLGNDINLLQEFIRQKYER 121

Query: 120 KKWI 123
           K+W+
Sbjct: 122 KRWM 125

 Score = 33.9 bits (76), Expect = 0.100,   Method: Compositional matrix adjust.
 Identities = 24/71 (33%), Positives = 30/71 (42%), Gaps = 13/71 (18%)

Query: 224 QRNDLKKSILSLYSKPXXXXXXXXXXXXXXXXXPCNTPSPFVNTGITATXXXXXXXXXXX 283
           QRNDLKKSILSLYS                     N  +  V++G+  T           
Sbjct: 204 QRNDLKKSILSLYSSANASKSN-------------NNSTMNVSSGMGMTTPFNTTPQNNS 250

Query: 284 XXXLDDNELFK 294
              +DD+ELFK
Sbjct: 251 SLSIDDDELFK 261

>Kwal_47.18172
          Length = 273

 Score =  186 bits (471), Expect = 2e-57,   Method: Compositional matrix adjust.
 Identities = 105/237 (44%), Positives = 126/237 (53%), Gaps = 22/237 (9%)

Query: 3   TSVPVKKALSALLRDPGNSHCADCKAQLHPRWASWSLGVFICIKCAGIHRSLGTHISKVK 62
           +S  VKK LSALLRDP N  CADCK   HPRWASWSLGVFICI+CAGIHRSLGTHISKVK
Sbjct: 2   SSPAVKKVLSALLRDPANGTCADCKTAGHPRWASWSLGVFICIRCAGIHRSLGTHISKVK 61

Query: 63  SVDLDTWKEEHLVKLIQFKNNLRANSYYEATLADELKQRKITDTSSLQNFIKNKYEYKKW 122
           SVDLDTW+EEHL K+++F NN  AN+ YE  L+         D S L +FI++KYE KKW
Sbjct: 62  SVDLDTWQEEHLRKVVEFGNNAAANAVYECKLSGN----HTPDASKLSDFIRSKYELKKW 117

Query: 123 IGDLSSIEGLNDSTEPVLHKPSANHSLPASNARLDQSSNSLQKTQTQPPXXXXXXXXXXX 182
           +G                   SAN + PAS +    +++  ++TQ +             
Sbjct: 118 LGS------------------SANATTPASGSNSVVTNSKPERTQEKTQVSQQTHNSQTS 159

Query: 183 XXXXXQVXXXXXXXXXXXXXXXXXXIGAANTKTGNRVGEFGQRNDLKKSILSLYSKP 239
                                         T T     E   R DLKKSILSLYS+P
Sbjct: 160 LLSQTTSVSIGSGSSSQVDLNLAPPRAPTRTTTSQAARELNGRPDLKKSILSLYSRP 216

>Sklu_2260.4 YIL044C, Contig c2260 5970-6779
          Length = 269

 Score =  177 bits (448), Expect = 4e-54,   Method: Compositional matrix adjust.
 Identities = 101/233 (43%), Positives = 129/233 (55%), Gaps = 25/233 (10%)

Query: 7   VKKALSALLRDPGNSHCADCKAQLHPRWASWSLGVFICIKCAGIHRSLGTHISKVKSVDL 66
           VKK L+ LLRDP N+ CADCK   HPRW SWSLGVF+CIKCAGIHRSLGTHISKVKSVDL
Sbjct: 6   VKKVLATLLRDPDNARCADCKVSSHPRWCSWSLGVFVCIKCAGIHRSLGTHISKVKSVDL 65

Query: 67  DTWKEEHLVKLIQFKNNLRANSYYEATLADELKQRKITDTSSLQNFIKNKYEYKKWIGDL 126
           DTW+E+HL ++I++ NN RAN YYEA    +L+     D S LQ+FI+ KYE KKW G+ 
Sbjct: 66  DTWQEQHLQQVIRWGNNKRANLYYEA----KLQGSHTPDPSKLQSFIRTKYELKKWCGEA 121

Query: 127 SSIEGLNDSTEPVLHKPSANHSLPASNARLDQSSNSLQKTQTQPPXXXXXXXXXXXXXXX 186
             +    ++T      P A  + P   A + + S  +  T T PP               
Sbjct: 122 DEVLSATETT--TAPNPVAETAPP---ALVREFSTGIPAT-TAPP--------------- 160

Query: 187 XQVXXXXXXXXXXXXXXXXXXIGAANTKTGNRVGEFGQRNDLKKSILSLYSKP 239
                                + ++  +       +  R +LKKSILSLY+KP
Sbjct: 161 VTTSSTSSSCSSSLLDLNLTPVASSTQQRVTHTHSYSTRPELKKSILSLYAKP 213

>KLLA0F27555g complement(2554571..2555410) some similarities with
           sp|P40529 Saccharomyces cerevisiae YIL044c AGE2,
           hypothetical start
          Length = 279

 Score =  170 bits (431), Expect = 2e-51,   Method: Compositional matrix adjust.
 Identities = 83/162 (51%), Positives = 106/162 (65%), Gaps = 15/162 (9%)

Query: 3   TSVPVKKALSALLRDPGNSHCADCKAQLHPRWASWSLGVFICIKCAGIHRSLGTHISKVK 62
           TSV VKK L+ LLRDP N+ C DCK   HPRWASWSLGVF+CIKCAG HRS+GTHISKVK
Sbjct: 2   TSVEVKKVLTTLLRDPENNRCGDCKVATHPRWASWSLGVFVCIKCAGFHRSMGTHISKVK 61

Query: 63  SVDLDTWKEEHLVKLIQFKNNLRANSYYEATLADELKQRKITDTSSLQNFIKNKYEYKKW 122
           SVDLDTW EEHL  +++F NN + N YYE  L        + D S +  FI+ KYE KKW
Sbjct: 62  SVDLDTWTEEHLEAVLEFGNNKKFNEYYENKLGG---GTYVPDQSKIGQFIRTKYELKKW 118

Query: 123 IGDLSSIEGLNDSTEPVLHKPSANHSLPASNARLDQSSNSLQ 164
           +GD           +P++   S+ H+  A + R+ Q + +++
Sbjct: 119 VGD-----------DPIVDVKSSKHTAEAKD-RVAQKAAAVR 148

>ADL084W [1657] [Homologous to ScYIL044C (AGE2) - SH]
           complement(536243..536944) [702 bp, 233 aa]
          Length = 233

 Score =  162 bits (411), Expect = 5e-49,   Method: Compositional matrix adjust.
 Identities = 73/120 (60%), Positives = 87/120 (72%), Gaps = 3/120 (2%)

Query: 3   TSVPVKKALSALLRDPGNSHCADCKAQLHPRWASWSLGVFICIKCAGIHRSLGTHISKVK 62
           TSV V++ L  LLRDP N  CADCK   HPRWASWSLGVF+CI+CAG HRSLGTH+SKVK
Sbjct: 2   TSVEVRRVLEQLLRDPCNQQCADCKNSAHPRWASWSLGVFVCIRCAGFHRSLGTHVSKVK 61

Query: 63  SVDLDTWKEEHLVKLIQFKNNLRANSYYEATLADELKQRKITDTSSLQNFIKNKYEYKKW 122
           SVDLDTWKEEHL ++++F NN +AN  +E  L        + D S +  FIK KYE +KW
Sbjct: 62  SVDLDTWKEEHLQQVVRFGNNQQANKVFEGRLGG---GSYVPDQSKMGQFIKTKYEVRKW 118

 Score = 29.3 bits (64), Expect = 2.9,   Method: Compositional matrix adjust.
 Identities = 13/15 (86%), Positives = 14/15 (93%)

Query: 225 RNDLKKSILSLYSKP 239
           R DLKKSILSLY+KP
Sbjct: 178 RPDLKKSILSLYAKP 192

>Kwal_33.13101
          Length = 873

 Score = 84.0 bits (206), Expect = 8e-18,   Method: Compositional matrix adjust.
 Identities = 45/117 (38%), Positives = 68/117 (58%), Gaps = 7/117 (5%)

Query: 17  DPGNSHCADCKAQLHPRWASWSLGVFICIKCAGIHRSLGTHISKVKSVDLDTWKEEHLVK 76
           D  N+ C DC       W S +L   +CI+C+ +HRSLG+HISKV+S+ LD++    + +
Sbjct: 575 DASNTTCCDCGDSNQVEWISINLLCVLCIQCSAVHRSLGSHISKVRSLLLDSFTSREIKE 634

Query: 77  LIQFKNNLRANSYYEATLADELKQRKITDTSSLQN---FIKNKYEYKKWIGDLSSIE 130
           L+++ +N   NS YEA    EL Q+ I   SS+ +   FI +KY  KK++  L   E
Sbjct: 635 LLKYVSNKNLNSIYEA----ELTQKSIIPGSSVADRTRFITDKYVSKKYVSPLQEDE 687

>CAGL0H01617g 157279..158328 similar to tr|Q04412 Saccharomyces
           cerevisiae YDR524c AGE1, hypothetical start
          Length = 349

 Score = 80.5 bits (197), Expect = 4e-17,   Method: Compositional matrix adjust.
 Identities = 40/109 (36%), Positives = 63/109 (57%), Gaps = 2/109 (1%)

Query: 17  DPGNSHCADCKAQLHPRWASWSLGVFICIKCAGIHRSLGTHISKVKSVDLDTWKEEHLVK 76
           D  N  C DC ++ +  W S +L   +CI+C+G+HRSLG+HISKV+S+++D       +K
Sbjct: 18  DESNKRCCDCGSRHNVDWVSINLLCVVCIQCSGVHRSLGSHISKVRSLNMDDLHSNRELK 77

Query: 77  --LIQFKNNLRANSYYEATLADELKQRKITDTSSLQNFIKNKYEYKKWI 123
             L+    N   NS YEA +   +K RK    +    +I +KY +KK++
Sbjct: 78  YLLVNHLINRNVNSVYEARIPAGIKIRKDAQPADRARYIVDKYMHKKYV 126

>KLLA0D18942g 1594560..1595633 similar to sp|P35197 Saccharomyces
          cerevisiae YDL226c GCS1 ADP-ribosylation factor
          GTPase-activating protein (ARF-GAP), start by
          similarity
          Length = 357

 Score = 79.0 bits (193), Expect = 1e-16,   Method: Compositional matrix adjust.
 Identities = 34/70 (48%), Positives = 48/70 (68%), Gaps = 1/70 (1%)

Query: 8  KKALSALLRDPGNSHCADCKAQLHPRWASWSLGVFICIKCAGIHRSLGTHISKVKSVDLD 67
          ++ L  L +  GN  C DC A  +P+WAS   GVFIC++CAGIHR LG HIS V+S+ +D
Sbjct: 11 RRRLLQLQKVGGNKKCLDCGAH-NPQWASPKFGVFICLECAGIHRGLGVHISFVRSITMD 69

Query: 68 TWKEEHLVKL 77
           +K + LV++
Sbjct: 70 QFKSDELVRM 79

>ABL164C [428] [Homologous to ScYDL226C (GCS1) - SH; ScYNL204C
           (SPS18) - SH] (91566..92648) [1083 bp, 360 aa]
          Length = 360

 Score = 79.0 bits (193), Expect = 1e-16,   Method: Compositional matrix adjust.
 Identities = 47/133 (35%), Positives = 68/133 (51%), Gaps = 15/133 (11%)

Query: 8   KKALSALLRDPGNSHCADCKAQLHPRWASWSLGVFICIKCAGIHRSLGTHISKVKSVDLD 67
           ++ L  L +  GN  CADC A  +P+WAS   G+FIC++CAGIHR LG HIS V+S+ +D
Sbjct: 11  RRRLLQLQKLGGNKKCADCGAP-NPQWASPKFGIFICLECAGIHRGLGVHISFVRSITMD 69

Query: 68  TWKEEHLVKLIQFKNNLRANSYYEATLADELKQRKITDTSSLQNFIKNKY--------EY 119
            +K E L ++         N+ +   LA     +K+   +   N +   Y        E 
Sbjct: 70  QFKPEELERM-----EHGGNAQFHEYLAKHGVDQKLPQKAKYDNPVAASYKEKLTCVCEG 124

Query: 120 KKWIG-DLSSIEG 131
           K W+  DLS   G
Sbjct: 125 KDWVEPDLSGAGG 137

>YDR524C (AGE1) [1336] chr4 complement(1487530..1488978)
           ADP-ribosylation factor (ARF) GTPase activating protein
           (GAP) with effector functions, involved in endocytosis
           and protein secretion [1449 bp, 482 aa]
          Length = 482

 Score = 79.0 bits (193), Expect = 2e-16,   Method: Compositional matrix adjust.
 Identities = 45/113 (39%), Positives = 67/113 (59%), Gaps = 5/113 (4%)

Query: 17  DPGNSHCADCKAQLHPRWASWSLGVFICIKCAGIHRSLGTHISKVKSVDLDTWKEEHLVK 76
           D  N  C DC +     W S +L   +CIKC+G+HRSLG+HISK++S+ LD +    L+ 
Sbjct: 180 DKSNLKCCDCGSTATVEWVSINLLCILCIKCSGVHRSLGSHISKIRSLTLDNFTSLELMH 239

Query: 77  LIQ-FKNNLRANSYYEATLADELKQRKIT---DTSSLQNFIKNKYEYKKWIGD 125
           L+Q   +N   N+ YE+ L +    +KIT   D S    FI +KY++KK++ D
Sbjct: 240 LLQNNVSNSNVNAIYESNLRN-FPVKKITANSDDSERSKFIIDKYQFKKFVID 291

>CAGL0G05445g complement(514769..515833) similar to sp|P35197
          Saccharomyces cerevisiae YDL226c GCS1 ADP-ribosylation
          factor GTPase-activating protein, start by similarity
          Length = 354

 Score = 78.2 bits (191), Expect = 3e-16,   Method: Compositional matrix adjust.
 Identities = 34/75 (45%), Positives = 50/75 (66%), Gaps = 1/75 (1%)

Query: 8  KKALSALLRDPGNSHCADCKAQLHPRWASWSLGVFICIKCAGIHRSLGTHISKVKSVDLD 67
          ++ L  L +   N  C DC A  +P+WAS   G+FIC++CAG HRSLG HIS V+S+ +D
Sbjct: 11 RRRLLQLQKIGANKKCVDCGAP-NPQWASPKFGIFICLECAGTHRSLGVHISFVRSITMD 69

Query: 68 TWKEEHLVKLIQFKN 82
           +K+E LV++ +  N
Sbjct: 70 QFKQEELVRMEEGGN 84

>AFR725C [3918] [Homologous to ScYDR524C (AGE1) - SH]
           (1771660..1774281) [2622 bp, 873 aa]
          Length = 873

 Score = 79.0 bits (193), Expect = 4e-16,   Method: Compositional matrix adjust.
 Identities = 40/125 (32%), Positives = 68/125 (54%), Gaps = 2/125 (1%)

Query: 17  DPGNSHCADCKAQLHPRWASWSLGVFICIKCAGIHRSLGTHISKVKSVDLDTWKEEHLVK 76
           DP NS C DC++     W S ++   +CI C+G+HRSLG H+SK++S+ LD++     ++
Sbjct: 559 DPSNSACCDCRSDKQVEWISLNILCVVCINCSGVHRSLGAHVSKMRSLTLDSFSSPESLQ 618

Query: 77  LIQFKNNLRANSYYEATLADELKQRKITDTSSLQNFIKNKYEYKKWIGDLSSIEGLNDST 136
           L++  +N   NS YE+     +      D    +++I +KY  KK++     I  L+ S 
Sbjct: 619 LLKCVSNQNVNSLYESEDLPPIFPENSIDQR--KSYITDKYVSKKYVNRTEDISKLHISL 676

Query: 137 EPVLH 141
              +H
Sbjct: 677 IKAIH 681

>Sklu_2267.4 YDL226C, Contig c2267 4691-5770 reverse complement
          Length = 359

 Score = 75.5 bits (184), Expect = 3e-15,   Method: Compositional matrix adjust.
 Identities = 32/70 (45%), Positives = 46/70 (65%), Gaps = 1/70 (1%)

Query: 8  KKALSALLRDPGNSHCADCKAQLHPRWASWSLGVFICIKCAGIHRSLGTHISKVKSVDLD 67
          ++ L  L +   N  C DC A  +P+WAS   G+FIC++CAGIHR LG HIS V+S+ +D
Sbjct: 12 RRRLLQLQKIGSNKKCIDCNAP-NPQWASPKFGIFICLECAGIHRGLGVHISFVRSITMD 70

Query: 68 TWKEEHLVKL 77
           +K E L ++
Sbjct: 71 QFKPEELARM 80

>Scas_677.6
          Length = 357

 Score = 75.1 bits (183), Expect = 3e-15,   Method: Compositional matrix adjust.
 Identities = 33/71 (46%), Positives = 46/71 (64%), Gaps = 1/71 (1%)

Query: 7  VKKALSALLRDPGNSHCADCKAQLHPRWASWSLGVFICIKCAGIHRSLGTHISKVKSVDL 66
           ++ L  L +   N  C DC A  +P+WAS   GVFIC++CAG HRSLG HIS V+S+ +
Sbjct: 10 TRRRLLQLQKIGANKKCVDCHAP-NPQWASPKFGVFICLECAGTHRSLGVHISFVRSITM 68

Query: 67 DTWKEEHLVKL 77
          D +K E L ++
Sbjct: 69 DQFKPEELERM 79

>Scas_685.25
          Length = 877

 Score = 75.9 bits (185), Expect = 4e-15,   Method: Compositional matrix adjust.
 Identities = 42/113 (37%), Positives = 67/113 (59%), Gaps = 9/113 (7%)

Query: 18  PGNSHCADCK-AQLHPRWASWSLGVFICIKCAGIHRSLGTHISKVKSVDLDTWKEEHLVK 76
           P N  C DC  +     W S +L   +CIKC+G+HRS+G HISK++S+ LD +  + ++ 
Sbjct: 590 PSNQRCCDCNTSDGTVEWISLNLLCLVCIKCSGVHRSMGAHISKIRSLTLDNFTSKEMIY 649

Query: 77  LIQ-FKNNLRANSYYEATLADELKQRKI----TDTSSLQNFIKNKYEYKKWIG 124
           LI+ + +N + NS YE+   +   Q +I    TD+   Q +I +KY +KK+I 
Sbjct: 650 LIKNYISNEKVNSIYESGTNN--TQTRISSNATDSRRSQ-YINDKYRFKKFIN 699

>Kwal_23.4569
          Length = 370

 Score = 74.7 bits (182), Expect = 6e-15,   Method: Compositional matrix adjust.
 Identities = 31/70 (44%), Positives = 47/70 (67%), Gaps = 1/70 (1%)

Query: 8  KKALSALLRDPGNSHCADCKAQLHPRWASWSLGVFICIKCAGIHRSLGTHISKVKSVDLD 67
          ++ L  L +   N  C DC+A  +P+WAS   G+FIC++CAG+HR LG HIS V+S+ +D
Sbjct: 12 RRRLLQLQKVGSNKKCVDCEAP-NPQWASPKFGIFICLECAGLHRGLGVHISFVRSITMD 70

Query: 68 TWKEEHLVKL 77
           +K E L ++
Sbjct: 71 QFKPEELERM 80

>YDL226C (GCS1) [649] chr4 complement(51116..52174)
          GTPase-activating protein (GAP) for ADP-ribosylation
          factors Arf1p and Arf2p, involved in endocytosis,
          exocytosis, secretion, and mitochondrial and vacuolar
          organization, member of the Gcs1p/Glo3p/Sps18p family
          [1059 bp, 352 aa]
          Length = 352

 Score = 73.2 bits (178), Expect = 2e-14,   Method: Compositional matrix adjust.
 Identities = 31/71 (43%), Positives = 46/71 (64%), Gaps = 1/71 (1%)

Query: 7  VKKALSALLRDPGNSHCADCKAQLHPRWASWSLGVFICIKCAGIHRSLGTHISKVKSVDL 66
           ++ L  L +   N  C DC A  +P+WA+   G FIC++CAGIHR LG HIS V+S+ +
Sbjct: 10 TRRRLLQLQKIGANKKCMDCGAP-NPQWATPKFGAFICLECAGIHRGLGVHISFVRSITM 68

Query: 67 DTWKEEHLVKL 77
          D +K E L+++
Sbjct: 69 DQFKPEELLRM 79

>KLLA0E06787g 618131..619678 similar to sp|P38682 Saccharomyces
          cerevisiae YER122c GLO3 zinc finger protein, start by
          similarity
          Length = 515

 Score = 66.6 bits (161), Expect = 3e-12,   Method: Compositional matrix adjust.
 Identities = 32/84 (38%), Positives = 47/84 (55%), Gaps = 2/84 (2%)

Query: 7  VKKALSALLRDPGNSHCADCKAQLHPRWASWSLGVFICIKCAGIHRSLGTHISKVKSVDL 66
          V K  + L     N  C DC A+ +P W S   GV +CI C+G HR++GTHI+ VKS +L
Sbjct: 17 VTKVFARLTTKSENRACFDCGAK-NPTWTSVPFGVLLCIDCSGEHRNMGTHITFVKSSNL 75

Query: 67 DTWKEEHLVKLIQFKNNLRANSYY 90
          D W   +L +  +   N +A  ++
Sbjct: 76 DKWTVNNLRRF-KLGGNDKAKDFF 98

>AGL279C [4033] [Homologous to ScYER122C (GLO3) - SH]
          (182187..183542) [1356 bp, 451 aa]
          Length = 451

 Score = 65.1 bits (157), Expect = 1e-11,   Method: Compositional matrix adjust.
 Identities = 31/80 (38%), Positives = 43/80 (53%), Gaps = 2/80 (2%)

Query: 11 LSALLRDPGNSHCADCKAQLHPRWASWSLGVFICIKCAGIHRSLGTHISKVKSVDLDTWK 70
           S L   P N  C DC    +P W S   G+ +CI+C+G HR LG HI+ VKS +LD W 
Sbjct: 19 FSKLNSKPENRTCFDC-GNKNPTWTSVPFGIMLCIQCSGEHRKLGVHITFVKSSNLDKWT 77

Query: 71 EEHLVKLIQFKNNLRANSYY 90
            +L +  +   N RA  ++
Sbjct: 78 INNL-RRFKMGGNHRAREFF 96

>YNL204C (SPS18) [4399] chr14 complement(258374..259276)
          Sporulation-specific zinc finger protein involved in
          activation of sporulation, member of Gcs1p/Glo3p/Sps18p
          family of zinc-finger proteins [903 bp, 300 aa]
          Length = 300

 Score = 63.2 bits (152), Expect = 3e-11,   Method: Compositional matrix adjust.
 Identities = 27/76 (35%), Positives = 51/76 (67%), Gaps = 1/76 (1%)

Query: 8  KKALSALLRDPGNSHCADCKAQLHPRWASWSLGVFICIKCAGIHRSLGTHISKVKSVDLD 67
          +K L    +  GN++C +CK+ ++P++ S S G+FIC+ CA + R +GT+I  VKS+ +D
Sbjct: 13 RKRLLRAKKAAGNNNCFECKS-VNPQFVSCSFGIFICVNCANLLRGMGTNIFCVKSITMD 71

Query: 68 TWKEEHLVKLIQFKNN 83
           ++E+ + ++ +  NN
Sbjct: 72 NFEEKDVRRVEKSGNN 87

>ACL055W [994] [Homologous to ScYGL181W (GTS1) - SH]
           complement(267925..269340) [1416 bp, 471 aa]
          Length = 471

 Score = 63.5 bits (153), Expect = 4e-11,   Method: Compositional matrix adjust.
 Identities = 38/117 (32%), Positives = 60/117 (51%), Gaps = 8/117 (6%)

Query: 7   VKKALSALLRDPGNSH-CADCKAQLHPRWASWSLGVFICIKCAGIHRSL-----GTHISK 60
           V++ L AL+  P N++ C +C A  +P W S +LG F+C +CA +HR +     G   S 
Sbjct: 9   VERELKALVSSPENANRCGECGA-TYPTWCSVNLGAFLCGRCAAVHRKVLTGEQGGPESH 67

Query: 61  VKSVDLDTWKEEHLVKLIQFKNNLRANSYYEATLADELKQRKITDTSSLQNFIKNKY 117
           VKS+ LD W  + L ++     N R +  +              D S +++FI+NKY
Sbjct: 68  VKSLTLDRWTVDELEEITNSGGNRRNHHTWNVRNV-AFPYDGDDDRSRVEDFIRNKY 123

>Kwal_27.10676
          Length = 466

 Score = 63.2 bits (152), Expect = 4e-11,   Method: Compositional matrix adjust.
 Identities = 29/82 (35%), Positives = 44/82 (53%), Gaps = 2/82 (2%)

Query: 9  KALSALLRDPGNSHCADCKAQLHPRWASWSLGVFICIKCAGIHRSLGTHISKVKSVDLDT 68
          K    L     N  C DC  + +P W S   GV +CI+C+ +HR+LG HI+ VKS +LD 
Sbjct: 17 KVFQKLASKQDNRACFDCGTK-NPTWTSVPFGVMLCIQCSAVHRNLGVHITFVKSSNLDK 75

Query: 69 WKEEHLVKLIQFKNNLRANSYY 90
          W   +L +  +   N +A  ++
Sbjct: 76 WTVNNL-RRFKLGGNHKAREFF 96

>CAGL0G03707g complement(355469..356929) similar to sp|P38682
          Saccharomyces cerevisiae YER122c GLO3, hypothetical
          start
          Length = 486

 Score = 63.2 bits (152), Expect = 4e-11,   Method: Compositional matrix adjust.
 Identities = 28/71 (39%), Positives = 41/71 (57%), Gaps = 2/71 (2%)

Query: 20 NSHCADCKAQLHPRWASWSLGVFICIKCAGIHRSLGTHISKVKSVDLDTWKEEHLVKLIQ 79
          N  C DC    +P W S   GV +CI+C+ +HR+LG HI+ VKS  LD W   +L +  +
Sbjct: 26 NRVCFDC-GNKNPTWTSVPFGVLLCIQCSAVHRNLGVHITFVKSSTLDKWTVNNL-RRFK 83

Query: 80 FKNNLRANSYY 90
          +  N +A  Y+
Sbjct: 84 YGGNHKAKEYF 94

>Scas_672.9
          Length = 485

 Score = 60.5 bits (145), Expect = 4e-10,   Method: Compositional matrix adjust.
 Identities = 27/71 (38%), Positives = 40/71 (56%), Gaps = 2/71 (2%)

Query: 20 NSHCADCKAQLHPRWASWSLGVFICIKCAGIHRSLGTHISKVKSVDLDTWKEEHLVKLIQ 79
          N  C DC    +P W S   GV +CI+C+ +HR+LG HI+ VKS  LD W   +L +  +
Sbjct: 28 NRVCFDC-GNKNPTWTSVPFGVMLCIQCSAVHRNLGVHITFVKSSTLDKWTINYLRRF-K 85

Query: 80 FKNNLRANSYY 90
             N +A  ++
Sbjct: 86 LGGNNKARDFF 96

>YER122C (GLO3) [1552] chr5 complement(402867..404348)
          GTPase-activating protein (GAP) for ADP-ribosylation
          factors Arf1p and Arf2p, involved in retrograde
          transport between Golgi and ER as well as endocytosis
          [1482 bp, 493 aa]
          Length = 493

 Score = 60.5 bits (145), Expect = 4e-10,   Method: Compositional matrix adjust.
 Identities = 28/90 (31%), Positives = 46/90 (51%), Gaps = 2/90 (2%)

Query: 1  MSTSVPVKKALSALLRDPGNSHCADCKAQLHPRWASWSLGVFICIKCAGIHRSLGTHISK 60
           +T    ++    L  +  N  C DC    +P W S   GV +CI+C+ +HR++G HI+ 
Sbjct: 9  FATEQTTQQVFQKLGSNMENRVCFDC-GNKNPTWTSVPFGVMLCIQCSAVHRNMGVHITF 67

Query: 61 VKSVDLDTWKEEHLVKLIQFKNNLRANSYY 90
          VKS  LD W   +L +  +   N +A  ++
Sbjct: 68 VKSSTLDKWTINNLRRF-KLGGNHKARDFF 96

>Sklu_2181.3 YGL181W, Contig c2181 6465-7709
          Length = 414

 Score = 59.7 bits (143), Expect = 6e-10,   Method: Compositional matrix adjust.
 Identities = 43/122 (35%), Positives = 61/122 (50%), Gaps = 8/122 (6%)

Query: 7   VKKALSALLRDPGNSH-CADCKAQLHPRWASWSLGVFICIKCAGIHRS-LGTHI----SK 60
           V+K L  L+  P N + C +C A  +P W S +LGVF+C +CA +HR  LG       S 
Sbjct: 9   VEKELKDLVNLPENGNRCGECGAP-YPTWCSVNLGVFLCGRCASVHRKVLGNRDDDAHSD 67

Query: 61  VKSVDLDTWKEEHLVKLIQFKNNLRANSYYEATLADELKQRKITDTSSLQNFIKNKYEYK 120
           VKS+ LD WKE  L  +     N R  S +              D S+++ FI++KY   
Sbjct: 68  VKSLTLDRWKESDLDCVNNGGGNRRNKSVWNPK-DHPFPFDGDDDKSAVEKFIRDKYILG 126

Query: 121 KW 122
           K+
Sbjct: 127 KF 128

>Scas_707.33
          Length = 396

 Score = 57.0 bits (136), Expect = 4e-09,   Method: Compositional matrix adjust.
 Identities = 38/137 (27%), Positives = 64/137 (46%), Gaps = 8/137 (5%)

Query: 7   VKKALSALLRDPGNSH-CADCKAQLHPRWASWSLGVFICIKCAGIHRSL-----GTHISK 60
           ++  L  LL  P N++ C +C +   P W S +LGVF+C +CA +HR +         S 
Sbjct: 21  IENELRDLLNAPENANKCGECGSTF-PTWCSINLGVFLCGRCASVHRKILNGREDDVFSN 79

Query: 61  VKSVDLDTWKEEHLVKLIQFKNNLRANSYYEATLADELKQRKITDTSSLQNFIKNKYEYK 120
           +KS+ LD W  + +  L +   N + N  +     +        D S +++FI++KY   
Sbjct: 80  LKSLSLDKWNNDDMDILAELGGN-KGNHKFWNPKHEPFPFDGDDDKSIVEHFIRDKYILG 138

Query: 121 KWIGDLSSIEGLNDSTE 137
           K+  D    E   +  E
Sbjct: 139 KFRYDEVKPEDFGERDE 155

>Scas_602.10
          Length = 447

 Score = 56.6 bits (135), Expect = 7e-09,   Method: Compositional matrix adjust.
 Identities = 30/103 (29%), Positives = 52/103 (50%), Gaps = 10/103 (9%)

Query: 23  CADCKAQLHPRWASWSLGVFICIKCAGIHRSLGTH---ISKVKSVDLDTWKEEHLVKLIQ 79
           C +C    +P W S +  +F+C +CA +H+ +  H   +S +KS+ LD W  + L K I 
Sbjct: 25  CGEC-GLPNPTWCSTTYNLFLCTRCATVHKKILNHDPDLSIIKSIKLDYWTNDELNKFIN 83

Query: 80  FKNNLRANSYYEATLADELKQRKITDTSSLQNFIKNKYEYKKW 122
              N     ++        K  K  D ++ +NF+++KY  KK+
Sbjct: 84  SGGNAYNKRFWNP------KDIKNFDDANWENFLRDKYILKKF 120

>YGL181W (GTS1) [1810] chr7 (157910..159100) Putative zinc-finger
           transcription factor of the Gcs1p/Glo3p/Sps18p family,
           involved in heat resistance, flocculation, timing of bud
           emergence, and regulation of biological rhythms [1191
           bp, 396 aa]
          Length = 396

 Score = 56.2 bits (134), Expect = 8e-09,   Method: Compositional matrix adjust.
 Identities = 34/122 (27%), Positives = 61/122 (50%), Gaps = 8/122 (6%)

Query: 7   VKKALSALLRDPGNSH-CADCKAQLHPRWASWSLGVFICIKCAGIHRS-LGTH----ISK 60
           V + L  L+    N++ C +C    +P W S +LGVF+C +CA +HR   G+      S 
Sbjct: 13  VDRELKELINSSENANKCGEC-GNFYPTWCSVNLGVFLCGRCASVHRKVFGSRDDDAFSN 71

Query: 61  VKSVDLDTWKEEHLVKLIQFKNNLRANSYYEATLADELKQRKITDTSSLQNFIKNKYEYK 120
           VKS+ +D W  E + +L+    N + N+ +              D + ++++I++KY   
Sbjct: 72  VKSLSMDRWTREDIDELVSLGGN-KGNARFWNPKNVPFPFDGDDDKAIVEHYIRDKYILG 130

Query: 121 KW 122
           K+
Sbjct: 131 KF 132

>CAGL0L06028g complement(675584..677101) weakly similar to sp|P40956
           Saccharomyces cerevisiae YGL181w GTS1, start by
           similarity
          Length = 505

 Score = 53.9 bits (128), Expect = 6e-08,   Method: Compositional matrix adjust.
 Identities = 39/132 (29%), Positives = 64/132 (48%), Gaps = 19/132 (14%)

Query: 7   VKKALSALLRDPGNSH-CADCKAQLHPRWASWSLGVFICIKCAGIHRS-LGTH------- 57
           +   L  ++  P N + C +C + + P W S +LGVF+C +CA +HR  LGT        
Sbjct: 16  IDGELKDIVNAPENGNRCGECGSAV-PTWCSTNLGVFLCGRCASVHRKILGTDPDEESGI 74

Query: 58  ISKVKSVDLDTWKEEHLVKLIQF---KNNLRA-NSYYEATLADELKQRKITDTSSLQNFI 113
            S VKS+ ++ W+ E +  +      K N+R  N   E    D  +     D S+++ F+
Sbjct: 75  FSNVKSLSMERWEAEDIDSVASSGGNKGNMRKWNPKNEPFPFDGDE-----DKSAVERFV 129

Query: 114 KNKYEYKKWIGD 125
           + KY   K+  D
Sbjct: 130 REKYIIGKYRND 141

>Kwal_47.17248
          Length = 311

 Score = 53.1 bits (126), Expect = 6e-08,   Method: Compositional matrix adjust.
 Identities = 33/117 (28%), Positives = 55/117 (47%), Gaps = 8/117 (6%)

Query: 7   VKKALSALLRDPGNSH-CADCKAQLHPRWASWSLGVFICIKCAGIHRS-LGTH----ISK 60
            ++ L  +L  P N + C +C     P W S +LGVF+C +CA +HR+ LG       S 
Sbjct: 10  AERELKNILNSPENGNKCGEC-GNTFPTWCSINLGVFLCGRCASVHRNILGNRDDEIYSD 68

Query: 61  VKSVDLDTWKEEHLVKLIQFKNNLRANSYYEATLADELKQRKITDTSSLQNFIKNKY 117
           V+S+ +D W    L ++ +   N R    +              D S+++ F++ KY
Sbjct: 69  VRSLTMDRWSTRDLDEIAESGGNRRNRMLWNPQNV-PFPFDGDEDKSAVEQFVREKY 124

>KLLA0C17138g 1497245..1498396 some similarities with sp|P40956
           Saccharomyces cerevisiae YGL181w GTS1 transcription
           factor of the GCS1P/GLO3P/SPS18P family singleton,
           hypothetical start
          Length = 383

 Score = 51.6 bits (122), Expect = 3e-07,   Method: Compositional matrix adjust.
 Identities = 38/133 (28%), Positives = 63/133 (47%), Gaps = 8/133 (6%)

Query: 7   VKKALSALLRDPGNSH-CADCKAQLHPRWASWSLGVFICIKCAGIHRS-LGTH----ISK 60
           V+  L  LL    NS+ C +C     P + S +LGVF+C +CA +HR  LG+      S 
Sbjct: 9   VEHDLKFLLNAGENSNKCGECGTPF-PTYCSVNLGVFLCGRCASVHRKVLGSREDGATSI 67

Query: 61  VKSVDLDTWKEEHLVKLIQFKNNLRANSYYEATLADELKQRKITDTSSLQNFIKNKYEYK 120
           VKS+ LD W +  +  +     N   +S++     +        D ++++ FI++KY   
Sbjct: 68  VKSLSLDRWSKRDVQTVADLGGNKHNSSFWNPK-KEPFPFDGDEDRTAVEMFIRDKYLKG 126

Query: 121 KWIGDLSSIEGLN 133
           K+      +E  N
Sbjct: 127 KFRHTAVKVEDFN 139

>CAGL0C02277g complement(230496..232967) weakly similar to sp|P18494
           Saccharomyces cerevisiae YER040w GLN3 transcription
           factor for positive nitrogen regulation, hypothetical
           start
          Length = 823

 Score = 32.0 bits (71), Expect = 0.65,   Method: Compositional matrix adjust.
 Identities = 16/51 (31%), Positives = 23/51 (45%), Gaps = 2/51 (3%)

Query: 8   KKALSALLR--DPGNSHCADCKAQLHPRWASWSLGVFICIKCAGIHRSLGT 56
           +K++S+  R  DP   HC +CK    P W     G  +C  C    +  GT
Sbjct: 321 RKSVSSSERPPDPDAVHCDNCKTYKTPLWRRSPEGKVLCNACGLFQKLHGT 371

>YGL107C (RMD9) [1877] chr7 complement(304334..306274) Protein
           possibly involved in meiotic nuclear division, or
           respiration, as suggested by mutant phenotypes [1941 bp,
           646 aa]
          Length = 646

 Score = 29.6 bits (65), Expect = 3.1,   Method: Compositional matrix adjust.
 Identities = 28/116 (24%), Positives = 51/116 (43%), Gaps = 7/116 (6%)

Query: 5   VPVKKALSALLRDPGN--SHCADCKAQLHPRWASWSLGVFICIKCAGIHRSL---GTHIS 59
           +P+  A +  L +P    +     K  +HP   S  + VFI  K     ++L   G    
Sbjct: 259 LPLLYAKTRSLTEPNELYNQIIQSKEFIHPNLYSGLIKVFI--KAEDYEKALSLFGQLCE 316

Query: 60  KVKSVDLDTWKEEHLVKLIQFKNNLRANSYYEATLADELKQRKITDTSSLQNFIKN 115
           K +  +     E HL  +   KN   A S+++  + DE+  + I   S++ +F++N
Sbjct: 317 KAEVRNYGYLIETHLSFIGDSKNLTLAESFFDKIINDEMPYKIILQVSTVNSFLQN 372

>KLLA0C08635g complement(755556..756476) some similarities with
           sp|P25334 Saccharomyces cerevisiae YCR069w SCC3
           peptidyl-prolyl cis-trans isomerase precursor,
           hypothetical start
          Length = 306

 Score = 28.9 bits (63), Expect = 4.5,   Method: Compositional matrix adjust.
 Identities = 15/68 (22%), Positives = 37/68 (54%), Gaps = 3/68 (4%)

Query: 56  THISKVKSVDLDTWKEEHLVKLIQFKNNLRANSYYEATLADELKQRKITDTSSLQNFIKN 115
           T+  +++  D++   EE++ K+ QF+N    ++    TL +ELK+    +     ++  +
Sbjct: 211 TYTEELRIADIEKMHEEYIKKVEQFRN---GDTSVGITLEEELKEGAKNEVELENDYYYS 267

Query: 116 KYEYKKWI 123
           ++ Y K++
Sbjct: 268 QHPYAKFV 275

>YFL022C (FRS2) [1661] chr6 complement(93497..95008)
           Phenylalanyl-tRNA synthetase, beta subunit, cytoplasmic
           [1512 bp, 503 aa]
          Length = 503

 Score = 28.5 bits (62), Expect = 7.9,   Method: Compositional matrix adjust.
 Identities = 25/105 (23%), Positives = 50/105 (47%), Gaps = 6/105 (5%)

Query: 11  LSALLRDPGNSHCADCKAQLHPRWASWSLGVFICIKCAGIHRSLGTHI---SKVKSVDLD 67
           L  L+++ G     D  ++L P+     +G     K   I ++    +   +K+++ DL+
Sbjct: 75  LVKLIQELGQLQIKDVMSKLGPQVGK--VGQARAFKNGWIAKNASNELELSAKLQNTDLN 132

Query: 68  TWKEEHLVKLIQFKNNLRANSYYEATLADELKQRKITDTSSLQNF 112
              +E    L Q KNN   +S  +A + ++LK+RK+     + +F
Sbjct: 133 ELTDETQSILAQIKNNSHLDS-IDAKILNDLKKRKLIAQGKITDF 176

>CAGL0J08613g 851406..853619 similar to tr|Q12324 Saccharomyces
           cerevisiae YOR088w, hypothetical start
          Length = 737

 Score = 28.5 bits (62), Expect = 9.0,   Method: Compositional matrix adjust.
 Identities = 23/68 (33%), Positives = 34/68 (50%), Gaps = 2/68 (2%)

Query: 65  DLDTWKEEHLVKLIQFKNNLRANSYYEATLADELKQRKITDTSSLQNFIKNKYEYKKWIG 124
           DL     E LVKL   K  L  NS   +TL DE+ +   TD   L N ++   + K+ + 
Sbjct: 663 DLSEKVSELLVKLS--KVGLSVNSSGSSTLPDEVFKEFKTDVEKLGNMVQELNDLKRELK 720

Query: 125 DLSSIEGL 132
           D+S ++ L
Sbjct: 721 DISDMKSL 728

  Database: blastdb
    Posted date:  Apr 3, 2006  3:33 PM
  Number of letters in database: 16,596,109
  Number of sequences in database:  34,618
  
Lambda     K      H
   0.313    0.128    0.381 

Gapped
Lambda     K      H
   0.267   0.0410    0.140 

Matrix: BLOSUM62
Gap Penalties: Existence: 11, Extension: 1
Number of Sequences: 34618
Number of Hits to DB: 7,640,239
Number of extensions: 277943
Number of successful extensions: 855
Number of sequences better than 10.0: 56
Number of HSP's gapped: 835
Number of HSP's successfully gapped: 61
Length of query: 294
Length of database: 16,596,109
Length adjustment: 101
Effective length of query: 193
Effective length of database: 13,099,691
Effective search space: 2528240363
Effective search space used: 2528240363
Neighboring words threshold: 11
Window for multiple hits: 40
X1: 16 ( 7.2 bits)
X2: 38 (14.6 bits)
X3: 64 (24.7 bits)
S1: 42 (21.9 bits)
S2: 61 (28.1 bits)