Hit NameLength (aa)HSP LengthHSP ScoreHSP Significance
YIL043C (CBR1)32231716340.0
Scas_704.433162449021e-121
Sklu_2260.23502518671e-116
Kwal_47.181592872528501e-114
KLLA0F27621g2812528341e-112
CAGL0L00847g2852438181e-109
ADL087W2872607881e-105
Sklu_2184.23102424641e-55
Kwal_33.142603082594483e-53
YML125C3122674457e-53
YML087C3122324441e-52
Scas_692.63142524405e-52
KLLA0C16918g3102294397e-52
AFR439C3102424196e-49
CAGL0B02519g3122484022e-46
ACR054C3062153803e-43
KLLA0D04488g2962223793e-43
Kwal_23.54713122493622e-40
YKL150W (MCR1)3022073446e-38
Scas_678.62992173402e-37
CAGL0E06424g2982093384e-37
CAGL0L06666g3982151054e-05
Scas_699.413181961036e-05
CAGL0I00990g343216974e-04
Scas_595.11398233940.001
YOR037W (CYC2)366240920.002
CAGL0H08580g621117890.005
YGR234W (YHB1)399258860.008
KLLA0E21901g357114850.011
Kwal_55.21561349114820.026
Scas_718.19616168720.47
ACR090C36668700.74
YOL027C (MDM38)57375653.4
Scas_662.23115836645.9
BLASTP 2.2.26 [Sep-21-2011]

Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, 
Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), 
"Gapped BLAST and PSI-BLAST: a new generation of protein database search
programs",  Nucleic Acids Res. 25:3389-3402.

Reference for compositional score matrix adjustment: Altschul, Stephen F., 
John C. Wootton, E. Michael Gertz, Richa Agarwala, Aleksandr Morgulis,
Alejandro A. Schaffer, and Yi-Kuo Yu (2005) "Protein database searches
using compositionally adjusted substitution matrices", FEBS J. 272:5101-5109.

Query= YIL043C
         (317 letters)

Database: blastdb 
           34,618 sequences; 16,596,109 total letters

Searching..................................................done

                                                                 Score    E
Sequences producing significant alignments:                      (bits) Value

YIL043C (CBR1) [2624] chr9 complement(274071..275039) Cytochrome...   634   0.0  
Scas_704.43                                                           352   e-121
Sklu_2260.2 YIL043C, Contig c2260 2185-3237                           338   e-116
Kwal_47.18159                                                         332   e-114
KLLA0F27621g complement(2560055..2560900) similar to sp|P38626 S...   325   e-112
CAGL0L00847g complement(104034..104891) similar to sp|P38626 Sac...   319   e-109
ADL087W [1654] [Homologous to ScYIL043C (CBR1) - SH] complement(...   308   e-105
Sklu_2184.2 YML125C, Contig c2184 1732-2664 reverse complement        183   1e-55
Kwal_33.14260                                                         177   3e-53
YML125C (YML125C) [3847] chr13 complement(20762..21700) Protein ...   176   7e-53
YML087C (YML087C) [3882] chr13 complement(94431..95369) Protein ...   175   1e-52
Scas_692.6                                                            174   5e-52
KLLA0C16918g 1478540..1479472 similar to sp|Q12746 Saccharomyces...   173   7e-52
AFR439C [3631] [Homologous to ScYML125C - SH; ScYML087C - SH] (1...   166   6e-49
CAGL0B02519g 240486..241424 highly similar to sp|Q12746 Saccharo...   159   2e-46
ACR054C [1102] [Homologous to ScYKL150W (MCR1) - SH] (454023..45...   150   3e-43
KLLA0D04488g complement(381861..382751) similar to sp|P36060 Sac...   150   3e-43
Kwal_23.5471                                                          144   2e-40
YKL150W (MCR1) [3118] chr11 (166549..167457) NADH-cytochrome b5 ...   137   6e-38
Scas_678.6                                                            135   2e-37
CAGL0E06424g 644026..644922 similar to sp|P36060 Saccharomyces c...   134   4e-37
CAGL0L06666g 752336..753532 highly similar to sp|P39676 Saccharo...    45   4e-05
Scas_699.41                                                            44   6e-05
CAGL0I00990g complement(81437..82468) similar to sp|P38909 Sacch...    42   4e-04
Scas_595.11                                                            41   0.001
YOR037W (CYC2) [4849] chr15 (401554..402654) Cytochrome c mitoch...    40   0.002
CAGL0H08580g complement(841038..842903) highly similar to tr|Q12...    39   0.005
YGR234W (YHB1) [2182] chr7 (959906..961105) Flavohemoglobin invo...    38   0.008
KLLA0E21901g 1946190..1947263 similar to sp|P38909 Saccharomyces...    37   0.011
Kwal_55.21561                                                          36   0.026
Scas_718.19                                                            32   0.47 
ACR090C [1137] [Homologous to ScYOR037W (CYC2) - SH] (519431..52...    32   0.74 
YOL027C (MDM38) [4789] chr15 complement(272003..273724) Protein ...    30   3.4  
Scas_662.23                                                            29   5.9  

>YIL043C (CBR1) [2624] chr9 complement(274071..275039) Cytochrome b5
           reductase, converts 2 ferricytochrome B5 + NADH to 2
           ferrocytochrome B5 + NAD(+), uses FAD cofactor [969 bp,
           322 aa]
          Length = 322

 Score =  634 bits (1634), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 308/317 (97%), Positives = 308/317 (97%)

Query: 1   MYKYSYYIRRKNEREKKVLKVCIQLALQQETQSIKQSKMAIDAQKLXXXXXXXXXPLLFK 60
           MYKYSYYIRRKNEREKKVLKVCIQLALQQETQSIKQSKMAIDAQKL         PLLFK
Sbjct: 1   MYKYSYYIRRKNEREKKVLKVCIQLALQQETQSIKQSKMAIDAQKLVVVIVIVVVPLLFK 60

Query: 61  FIIGPKTKPVLDPKRNDFQSFPLVEKTILTHNTSMYKFGLPHADDVLGLPIGQHIVIKAN 120
           FIIGPKTKPVLDPKRNDFQSFPLVEKTILTHNTSMYKFGLPHADDVLGLPIGQHIVIKAN
Sbjct: 61  FIIGPKTKPVLDPKRNDFQSFPLVEKTILTHNTSMYKFGLPHADDVLGLPIGQHIVIKAN 120

Query: 121 INGKDITRSYTPTSLDGDTKGNFELLVKSYPTGNVSKMIGELKIGDSIQIKGPRGNYHYE 180
           INGKDITRSYTPTSLDGDTKGNFELLVKSYPTGNVSKMIGELKIGDSIQIKGPRGNYHYE
Sbjct: 121 INGKDITRSYTPTSLDGDTKGNFELLVKSYPTGNVSKMIGELKIGDSIQIKGPRGNYHYE 180

Query: 181 RNCRSHLGMIAGGTGIAPMYQIMKAIAMDPHDTTKVSLVFGNVHEEDILLKKELEALVAM 240
           RNCRSHLGMIAGGTGIAPMYQIMKAIAMDPHDTTKVSLVFGNVHEEDILLKKELEALVAM
Sbjct: 181 RNCRSHLGMIAGGTGIAPMYQIMKAIAMDPHDTTKVSLVFGNVHEEDILLKKELEALVAM 240

Query: 241 KPSQFKIVYYLDSPDREDWTGGVGYITKDVIKEHLPAATMDNVQILICGPPAMVASVRRS 300
           KPSQFKIVYYLDSPDREDWTGGVGYITKDVIKEHLPAATMDNVQILICGPPAMVASVRRS
Sbjct: 241 KPSQFKIVYYLDSPDREDWTGGVGYITKDVIKEHLPAATMDNVQILICGPPAMVASVRRS 300

Query: 301 TVDLGFRRSKPLSKMED 317
           TVDLGFRRSKPLSKMED
Sbjct: 301 TVDLGFRRSKPLSKMED 317

>Scas_704.43
          Length = 316

 Score =  352 bits (902), Expect = e-121,   Method: Compositional matrix adjust.
 Identities = 158/244 (64%), Positives = 199/244 (81%)

Query: 74  KRNDFQSFPLVEKTILTHNTSMYKFGLPHADDVLGLPIGQHIVIKANINGKDITRSYTPT 133
           K+  F  F LV KT+LTHNT++Y FGLP+ADDVLGLPIGQHI IK NI+GKDI RSYTPT
Sbjct: 68  KKGTFHKFCLVSKTVLTHNTAIYNFGLPNADDVLGLPIGQHISIKENIDGKDIMRSYTPT 127

Query: 134 SLDGDTKGNFELLVKSYPTGNVSKMIGELKIGDSIQIKGPRGNYHYERNCRSHLGMIAGG 193
           SLD +TKG+FELLVKSYP GN+SK IG L IGD I + GP GNYHYE NCR+ LGMIAGG
Sbjct: 128 SLDSETKGSFELLVKSYPNGNISKFIGNLNIGDEINVCGPAGNYHYEPNCRNKLGMIAGG 187

Query: 194 TGIAPMYQIMKAIAMDPHDTTKVSLVFGNVHEEDILLKKELEALVAMKPSQFKIVYYLDS 253
           TGIAPM+QIMKAI ++P DTT+V+L++GNV E DILL+KEL+ +V M+P QFK++Y LD 
Sbjct: 188 TGIAPMFQIMKAIYLNPKDTTEVTLLYGNVQEADILLRKELDEMVKMRPDQFKVIYLLDK 247

Query: 254 PDREDWTGGVGYITKDVIKEHLPAATMDNVQILICGPPAMVASVRRSTVDLGFRRSKPLS 313
            DR+DW G +GY+T D++++++P+   + VQ+L+CGPP MV S +R+ V +G+ R KPLS
Sbjct: 248 TDRDDWEGEIGYVTLDLMEKYMPSPKEEGVQMLLCGPPRMVGSAKRNAVTMGYARGKPLS 307

Query: 314 KMED 317
           KMED
Sbjct: 308 KMED 311

>Sklu_2260.2 YIL043C, Contig c2260 2185-3237
          Length = 350

 Score =  338 bits (867), Expect = e-116,   Method: Compositional matrix adjust.
 Identities = 159/251 (63%), Positives = 199/251 (79%), Gaps = 3/251 (1%)

Query: 67  TKPVLDPKRNDFQSFPLVEKTILTHNTSMYKFGLPHADDVLGLPIGQHIVIKANINGKDI 126
            +PVL   ++ FQ FPL+ KT+LTHNT++Y+FGLP   DVLGLPIGQHI I+  I+GK+I
Sbjct: 34  ARPVL--IKDQFQDFPLISKTVLTHNTAVYRFGLPKPTDVLGLPIGQHISIQGIIDGKEI 91

Query: 127 TRSYTPTSLDGDTKGNFELLVKSYPTGNVSKMIGELKIGDSIQIKGPRGNYHYERNCRSH 186
            RSYTPTSLD D  G+FELL+KSY  GN+SKMIGELKIGD I+++GP+G Y Y  N  S 
Sbjct: 92  VRSYTPTSLDSDATGHFELLIKSYEKGNISKMIGELKIGDRIKVRGPKGFYTYTANMNSS 151

Query: 187 LGMIAGGTGIAPMYQIMKAIAMDPHDTTKVSLVFGNVHEEDILLKKELEALVAMKPSQFK 246
           L M+AGGTGIAPMYQI+KAI+++  D TKV+LV+GNV EEDILLKKEL+A+V   P QFK
Sbjct: 152 LAMVAGGTGIAPMYQIIKAISVNLQDKTKVALVYGNVSEEDILLKKELDAIVESNPDQFK 211

Query: 247 IVYYLDSPDREDWTGGVGYITKDVIKEHLPAATMDNVQILICGPPAMVASVRRSTVDLGF 306
           I Y LD P  E W GG+GY+T DV+KE+LPAA  + VQ+L+CGPP MV+S++R+ V LGF
Sbjct: 212 IHYMLDKPTSETWNGGIGYVTADVMKEYLPAAG-EGVQLLVCGPPPMVSSIKRNAVALGF 270

Query: 307 RRSKPLSKMED 317
            R+KP+SKM D
Sbjct: 271 ERAKPISKMGD 281

>Kwal_47.18159
          Length = 287

 Score =  332 bits (850), Expect = e-114,   Method: Compositional matrix adjust.
 Identities = 157/252 (62%), Positives = 202/252 (80%), Gaps = 4/252 (1%)

Query: 67  TKPVLDPKRNDFQSFPLVEKTILTHNTSMYKFGLPHADDVLGLPIGQHIVIKANI-NGKD 125
           +KP+L   +++FQ FPLV KT+LTHNT++Y+FGLP   DVLGLPIGQHI I+  + +GK+
Sbjct: 34  SKPIL--LKDEFQEFPLVSKTVLTHNTAVYRFGLPKHTDVLGLPIGQHISIQGTLKDGKE 91

Query: 126 ITRSYTPTSLDGDTKGNFELLVKSYPTGNVSKMIGELKIGDSIQIKGPRGNYHYERNCRS 185
           I RSYTPTSLD D+ G FELL+KSY  GNVSKMIGEL+IGD I+++GP+G Y Y  N  S
Sbjct: 92  IMRSYTPTSLDSDSVGFFELLIKSYEQGNVSKMIGELQIGDKIKVRGPKGFYTYTPNMNS 151

Query: 186 HLGMIAGGTGIAPMYQIMKAIAMDPHDTTKVSLVFGNVHEEDILLKKELEALVAMKPSQF 245
            +GMIAGGTGIAPMYQI+K+I  DP D TKVS+++G+  E+DILLKKE++A+V   P QF
Sbjct: 152 EIGMIAGGTGIAPMYQIIKSIHSDPKDRTKVSIIYGSQTEDDILLKKEIDAIVESNPDQF 211

Query: 246 KIVYYLDSPDREDWTGGVGYITKDVIKEHLPAATMDNVQILICGPPAMVASVRRSTVDLG 305
           K+ Y LD P R+ WTGGVGY+T +V+KEHLPAA  D VQ+L+CGPP MV+S++R+ V LG
Sbjct: 212 KVHYLLDKPARDTWTGGVGYVTAEVMKEHLPAAG-DGVQLLVCGPPGMVSSIKRNAVALG 270

Query: 306 FRRSKPLSKMED 317
           F ++KP+SKM D
Sbjct: 271 FEKAKPISKMGD 282

>KLLA0F27621g complement(2560055..2560900) similar to sp|P38626
           Saccharomyces cerevisiae YIL043c CBR1 cytochrome-b5
           reductase, hypothetical start
          Length = 281

 Score =  325 bits (834), Expect = e-112,   Method: Compositional matrix adjust.
 Identities = 158/252 (62%), Positives = 193/252 (76%), Gaps = 4/252 (1%)

Query: 66  KTKPVLDPKRNDFQSFPLVEKTILTHNTSMYKFGLPHADDVLGLPIGQHIVIKANINGKD 125
           K KPVLD  +   Q FPLV KT+LTHNT++Y+FGLP +  VLGLPIGQHI ++ANINGKD
Sbjct: 29  KDKPVLD--KEKLQEFPLVAKTVLTHNTAIYRFGLPKSTQVLGLPIGQHISVQANINGKD 86

Query: 126 ITRSYTPTSLDGDTKGNFELLVKSYPTGNVSKMIGELKIGDSIQIKGPRGNYHYERNCRS 185
           I RSYTPTSLD D  G+FELL+KSY  GN+SK   +L IGD I+++GP+G YHY+ N   
Sbjct: 87  ILRSYTPTSLDSDAVGHFELLIKSYEKGNISKHFAQLNIGDKIKVRGPKGFYHYQPNMNE 146

Query: 186 HLGMIAGGTGIAPMYQIMKAIAMDPHDTTKVSLVFGNVHEEDILLKKELEALVAMKPSQF 245
            +GMIAGGTGIAPMYQIMK+I  +  D TKVSLV+GN  EEDILLKKEL+A V  KP QF
Sbjct: 147 EIGMIAGGTGIAPMYQIMKSIFANDSDKTKVSLVYGNQTEEDILLKKELDAFVERKPDQF 206

Query: 246 KIVYYLDSPDREDWTGGVGYITKDVIKEHLPAATMDNVQILICGPPAMVASVRRSTVDLG 305
           K+ Y LD    E WTGGVGYIT D +KE LPA   + VQ+L+CGPP MV+S++R+ V LG
Sbjct: 207 KVYYLLDKAP-EAWTGGVGYITVDTMKERLPAPA-EGVQLLVCGPPPMVSSIKRNAVTLG 264

Query: 306 FRRSKPLSKMED 317
           + ++KP+SKM D
Sbjct: 265 YEKAKPISKMGD 276

>CAGL0L00847g complement(104034..104891) similar to sp|P38626
           Saccharomyces cerevisiae YIL043c CBR1 cytochrome-b5
           reductase, hypothetical start
          Length = 285

 Score =  319 bits (818), Expect = e-109,   Method: Compositional matrix adjust.
 Identities = 152/243 (62%), Positives = 186/243 (76%), Gaps = 1/243 (0%)

Query: 75  RNDFQSFPLVEKTILTHNTSMYKFGLPHADDVLGLPIGQHIVIKANINGKDITRSYTPTS 134
           + +F+ F LVEK  LTHNT+ YKF L     VLGLPIGQHI +K  I GK ++RSYTPTS
Sbjct: 39  KTEFREFELVEKEQLTHNTAKYKFKLADESHVLGLPIGQHITVKTIIGGKPVSRSYTPTS 98

Query: 135 LDGDTKGNFELLVKSYPTGNVSKMIGELKIGDSIQIKGPRGNYHYERNCRSHLGMIAGGT 194
           LD +  G FELLVKSYP GN+SK IG++KIG+ I I GPRG Y Y  N   HL M+AGGT
Sbjct: 99  LDEECVGFFELLVKSYPEGNISKHIGDMKIGEKINISGPRGFYEYVPNVHKHLAMVAGGT 158

Query: 195 GIAPMYQIMKAIAMDPHDTTKVSLVFGNVHEEDILLKKELEALVAMKPSQFKIVYYLDSP 254
           GI PM+QIMKAIA DP D T+V+L++GNV EEDILLK+EL+ LV  +P QFKI Y LD P
Sbjct: 159 GITPMFQIMKAIARDPSDKTRVTLLYGNVLEEDILLKQELDDLVKQRPDQFKITYLLDKP 218

Query: 255 DREDWTGGVGYITKDVIKEHLPAATMDNVQILICGPPAMVASVRRSTVDLGFRRSKPLSK 314
           +R+DW GGVGY+T D++KE  P+A  D VQ+L+CGPP MV+SV+R+ V LGF R+KP+SK
Sbjct: 219 ERDDWEGGVGYVTLDLMKESFPSAEED-VQLLVCGPPGMVSSVKRNAVALGFPRAKPVSK 277

Query: 315 MED 317
           MED
Sbjct: 278 MED 280

>ADL087W [1654] [Homologous to ScYIL043C (CBR1) - SH]
           complement(532195..533058) [864 bp, 287 aa]
          Length = 287

 Score =  308 bits (788), Expect = e-105,   Method: Compositional matrix adjust.
 Identities = 148/260 (56%), Positives = 194/260 (74%), Gaps = 3/260 (1%)

Query: 60  KFIIGPKTKPVLDPKRN-DFQSFPLVEKTILTHNTSMYKFGLPHADDVLGLPIGQHIVIK 118
           KF    +++P +    N D+Q F L+ KT+LTHNT++Y+FGLP AD VLGLPIGQHI I 
Sbjct: 24  KFSGAKQSQPAVKTTLNKDWQEFSLLTKTVLTHNTAIYRFGLPEADAVLGLPIGQHISIS 83

Query: 119 ANINGKDITRSYTPTSLDGDTKGNFELLVKSYPTGNVSKMIGELKIGDSIQIKGPRGNYH 178
             I+GK++ RSYTPTSLD D  G FELLVKSY  GN+SKM+ EL IGD I+++GP+G YH
Sbjct: 84  GVIDGKEMLRSYTPTSLDSDATGYFELLVKSYEKGNISKMLAELAIGDRIKVRGPKGFYH 143

Query: 179 YERNCRSHLGMIAGGTGIAPMYQIMKAIAMDPHDTTKVSLVFGNVHEEDILLKKELEALV 238
           YE N    +GMIAGGTGI+PMYQI++AI  +P D T+V LV+GN  ++DILLK EL+A+V
Sbjct: 144 YEPNMYKEIGMIAGGTGISPMYQIIRAIFSNPRDKTRVCLVYGNQTKDDILLKPELDAMV 203

Query: 239 AMKPSQFKIVYYLDS-PDREDWTGGVGYITKDVIKEHLPAATMDNVQILICGPPAMVASV 297
           A KP QFKI+Y LD   + E W G +GYIT+ +++EHLPA +  + Q+L+CGPP MV+S 
Sbjct: 204 AAKPDQFKILYMLDKVAEGEQWEGKLGYITEAIMREHLPAPS-SSAQLLLCGPPPMVSSA 262

Query: 298 RRSTVDLGFRRSKPLSKMED 317
           +R  V LGF ++KP+SK  D
Sbjct: 263 KRIAVSLGFEKAKPISKKGD 282

>Sklu_2184.2 YML125C, Contig c2184 1732-2664 reverse complement
          Length = 310

 Score =  183 bits (464), Expect = 1e-55,   Method: Compositional matrix adjust.
 Identities = 96/242 (39%), Positives = 150/242 (61%), Gaps = 4/242 (1%)

Query: 76  NDFQSFPLVEKTILTHNTSMYKFGLPHADDVLGLPIGQHIVIKANINGKDITRSYTPTSL 135
           N + +  L ++ +++ N+++Y+F L  + + L +P+G H+ +K  I GK+  R YTP + 
Sbjct: 68  NAWTALELEDQILISKNSAIYRFKLKTSLETLKIPVGHHLAVKIPIEGKNEIRYYTPITQ 127

Query: 136 DGDTKGNFELLVKSYPTGNVSKMIGELKIGDSIQIKGPRGNYHYERNCRSHLGMIAGGTG 195
             DT G+F+++VKSY  G VSK    LK G  ++ +GP G ++Y  N    +GMIAGG+G
Sbjct: 128 RYDT-GHFDIIVKSYTDGKVSKYFASLKPGQLVEFQGPVGRFNYATNSSKAIGMIAGGSG 186

Query: 196 IAPMYQIMKAIAMDPHDTTKVSLVFGNVHEEDILLKKELEALVAMKPSQFKIVYYLDSPD 255
           I PM Q++  I   P DTTKVSL++ N  E DILLK EL+ +    P+ F++ Y L  P 
Sbjct: 187 ITPMLQVLSQIVTTPEDTTKVSLIYANETENDILLKDELDEMADKYPN-FEVHYVLHKPS 245

Query: 256 REDWTGGVGYITKDVIKEHLPAATMDNVQILICGPPAMVASVRRSTVDLGFRRSKPLSKM 315
              WTG  GY+TKD ++++LP  + +N ++LICGP AM+  +   + +LG+ R    SK 
Sbjct: 246 -PGWTGDTGYVTKDQMQKYLPGPSDEN-RLLICGPLAMINMLLNYSEELGWPRGIVKSKP 303

Query: 316 ED 317
           +D
Sbjct: 304 DD 305

>Kwal_33.14260
          Length = 308

 Score =  177 bits (448), Expect = 3e-53,   Method: Compositional matrix adjust.
 Identities = 95/259 (36%), Positives = 154/259 (59%), Gaps = 6/259 (2%)

Query: 59  FKFIIGPKTKPVLDPKRNDFQSFPLVEKTILTHNTSMYKFGLPHADDVLGLPIGQHIVIK 118
           F+F+   K +  + P +  + +  L ++T+L+ NT+MY+F +  + + L  P+G H+ ++
Sbjct: 51  FRFLTAYKRRKSVFPDK--WSALELEDQTLLSKNTAMYRFKMKTSFETLNFPVGHHLAVR 108

Query: 119 ANINGKDITRSYTPTSLDGDTKGNFELLVKSYPTGNVSKMIGELKIGDSIQIKGPRGNYH 178
             I+GKD  R YTP S      G F+++VKSY  G VSK    LK G ++  KGP G ++
Sbjct: 109 VPIDGKDQIRYYTPVSPQYQ-PGYFDIIVKSYADGQVSKYFAGLKAGSAVDFKGPVGRFN 167

Query: 179 YERNCRSHLGMIAGGTGIAPMYQIMKAIAMDPHDTTKVSLVFGNVHEEDILLKKELEALV 238
           Y  N    +GMIAGG+GI PM QI+  I   P D TKVSL++ N  E DILLK+E++  +
Sbjct: 168 YVVNSYKQIGMIAGGSGITPMLQILNKIITTPEDLTKVSLIYANETENDILLKEEIDE-I 226

Query: 239 AMKPSQFKIVYYLDSPDREDWTGGVGYITKDVIKEHLPAATMDNVQILICGPPAMVASVR 298
           A K   F++ Y L +P    W G VG +T ++++++LP ++ DN ++++ G P M+  + 
Sbjct: 227 AEKYPNFEVHYVLRTPS-STWKGDVGLVTNELMQKYLPISSSDN-RLVMSGKPEMIRMLL 284

Query: 299 RSTVDLGFRRSKPLSKMED 317
               +LG+ +    SK +D
Sbjct: 285 EYAEELGWPKGIEKSKGDD 303

>YML125C (YML125C) [3847] chr13 complement(20762..21700) Protein
           with similarity to NADH-cytochrome b5 reductase [939 bp,
           312 aa]
          Length = 312

 Score =  176 bits (445), Expect = 7e-53,   Method: Compositional matrix adjust.
 Identities = 103/267 (38%), Positives = 151/267 (56%), Gaps = 11/267 (4%)

Query: 56  PLLFKFII-----GPKTKPVLDPKRNDFQSFPLVEKTILTHNTSMYKFGLPHADDVLGLP 110
           P+LF  I        K +  L P R  + S  L ++TI++ NT++Y+F L    + L +P
Sbjct: 47  PILFMIIFVRAYSAYKRRRSLYPDR--WTSLELEDQTIISKNTALYRFKLKTRLESLDIP 104

Query: 111 IGQHIVIKANINGKDITRSYTPTSLDGDTKGNFELLVKSYPTGNVSKMIGELKIGDSIQI 170
            G H+ ++  I+GK   R Y P S   ++ G  +L+VK+Y  G VSK    L  GD++  
Sbjct: 105 AGHHVAVRVPIDGKQEVRYYNPISSKLES-GYLDLVVKAYVDGKVSKYFAGLNSGDTVDF 163

Query: 171 KGPRGNYHYERNCRSHLGMIAGGTGIAPMYQIMKAIAMDPHDTTKVSLVFGNVHEEDILL 230
           KGP G  +YE N   HLG++AGG+GI P+ QI+  I   P D TKVSL++ N  E DILL
Sbjct: 164 KGPIGTLNYEPNSSKHLGIVAGGSGITPVLQILNEIITVPEDLTKVSLLYANETENDILL 223

Query: 231 KKELEALVAMKPSQFKIVYYLDSPDREDWTGGVGYITKDVIKEHLPAATMDNVQILICGP 290
           K EL+ +    P  F++ Y +  P  + WTG VGYITKD +  +LP  + DN ++LICGP
Sbjct: 224 KDELDEMAEKYP-HFQVHYVVHYPS-DRWTGDVGYITKDQMNRYLPEYSEDN-RLLICGP 280

Query: 291 PAMVASVRRSTVDLGFRRSKPLSKMED 317
             M     +   +LG++ +   S  +D
Sbjct: 281 DGMNNLALQYAKELGWKVNSTRSSGDD 307

>YML087C (YML087C) [3882] chr13 complement(94431..95369) Protein
           containing an oxidoreductase FAD-binding domain and an
           oxidoreductase FAD or NAD-binding domain, has moderate
           similarity to cytochrome b5 reductase (S. cerevisiae
           Cbr1p), which converts 2 ferricytochrome B5 + NADH to 2
           ferrocytochrome B5 + NAD(+) [939 bp, 312 aa]
          Length = 312

 Score =  175 bits (444), Expect = 1e-52,   Method: Compositional matrix adjust.
 Identities = 90/232 (38%), Positives = 146/232 (62%), Gaps = 4/232 (1%)

Query: 75  RNDFQSFPLVEKTILTHNTSMYKFGLPHADDVLGLPIGQHIVIKANINGKDITRSYTPTS 134
           RN + + PL +KT ++ NTS+Y F L +  + L +P+G H+ ++  ING+ + R YTP +
Sbjct: 69  RNKWVALPLSKKTRISRNTSLYCFKLKYPFERLHIPMGYHLAVRVTINGERLVRYYTPVN 128

Query: 135 LDGDTKGNFELLVKSYPTGNVSKMIGELKIGDSIQIKGPRGNYHYERNCRSHLGMIAGGT 194
           +  +T+G+ EL+VK+Y  G VSK   +LKI   ++ KGP G   Y+++  + LG+IAGG+
Sbjct: 129 VP-NTEGHLELVVKTYKHGVVSKYFDKLKIRQYVEFKGPLGELEYDQDTATELGIIAGGS 187

Query: 195 GIAPMYQIMKAIAMDPHDTTKVSLVFGNVHEEDILLKKELEALVAMKPSQFKIVYYLDSP 254
           GI P+ Q+++ I   P D T +SL++ N  E+DIL+K +L+ +    P  FK+ Y +  P
Sbjct: 188 GITPVLQVLQEIIPSPEDLTHISLIYANETEDDILMKSQLDHMAKEYP-HFKVHYVIHKP 246

Query: 255 DREDWTGGVGYITKDVIKEHLPAATMDNVQILICGPPAMVASVRRSTVDLGF 306
           + + W G VGY+T + +K +LP    D+ ++LICGPP M   V     +LG+
Sbjct: 247 NGK-WNGDVGYVTLEEMKRYLPKQAEDH-RLLICGPPKMNEMVLNYAKELGW 296

>Scas_692.6
          Length = 314

 Score =  174 bits (440), Expect = 5e-52,   Method: Compositional matrix adjust.
 Identities = 98/252 (38%), Positives = 153/252 (60%), Gaps = 6/252 (2%)

Query: 66  KTKPVLDPKRNDFQSFPLVEKTILTHNTSMYKFGLPHADDVLGLPIGQHIVIKANINGKD 125
           + K  L P R  + S  L ++T+++ NT++Y+F L    + L +P G HI ++  I+ K+
Sbjct: 64  QRKRSLFPDR--WTSLELDDQTVVSKNTALYRFKLKTNLESLDIPAGYHIAVRVFIDDKE 121

Query: 126 ITRSYTPTSLDGDTKGNFELLVKSYPTGNVSKMIGELKIGDSIQIKGPRGNYHYERNCRS 185
             R Y P S   DT G+F+LL+KSY  G VSK    LK GD+++ KGP G  HY  N   
Sbjct: 122 EIRYYNPISSKLDT-GHFDLLIKSYADGKVSKYFAGLKPGDTVEFKGPIGELHYAPNSSK 180

Query: 186 HLGMIAGGTGIAPMYQIMKAIAMDPHDTTKVSLVFGNVHEEDILLKKELEALVAMKPSQF 245
            LG++AGG+GI P+ Q++  I   P D TK+SL++ N  E DILLK EL+ +    P  F
Sbjct: 181 ALGIVAGGSGITPVLQMLNEIITVPEDLTKLSLIYANDTENDILLKDELDEMSEKYP-HF 239

Query: 246 KIVYYLDSPDREDWTGGVGYITKDVIKEHLPAATMDNVQILICGPPAMVASVRRSTVDLG 305
           ++ Y + +P  E W G VG ++K+ ++++LP  + D+ ++LICGP AM   V +   +LG
Sbjct: 240 EVHYVVRNP-SESWEGDVGLVSKEQMEKYLPKYS-DDHRLLICGPEAMEKMVVKYAEELG 297

Query: 306 FRRSKPLSKMED 317
           +++S   +K +D
Sbjct: 298 WKQSVSKNKGDD 309

>KLLA0C16918g 1478540..1479472 similar to sp|Q12746 Saccharomyces
           cerevisiae YML125c, start by similarity
          Length = 310

 Score =  173 bits (439), Expect = 7e-52,   Method: Compositional matrix adjust.
 Identities = 86/229 (37%), Positives = 142/229 (62%), Gaps = 4/229 (1%)

Query: 78  FQSFPLVEKTILTHNTSMYKFGLPHADDVLGLPIGQHIVIKANINGKDITRSYTPTSLDG 137
           + +  L ++TI++ NT++Y+F L  + + L +P G H+ ++  +  KD  R YTP S   
Sbjct: 70  WTALELEDQTIVSKNTAIYRFKLKTSLECLDIPTGHHLAVRIPLEDKDEIRYYTPISNKF 129

Query: 138 DTKGNFELLVKSYPTGNVSKMIGELKIGDSIQIKGPRGNYHYERNCRSHLGMIAGGTGIA 197
           +T G+F+++VKSY  G VSK    L+ G ++  KGP G + YE N   H+GMIAGG+G+ 
Sbjct: 130 ET-GHFDIMVKSYADGQVSKYFASLRPGQTVDFKGPVGRFAYEANSSKHIGMIAGGSGLT 188

Query: 198 PMYQIMKAIAMDPHDTTKVSLVFGNVHEEDILLKKELEALVAMKPSQFKIVYYLDSPDRE 257
           PM Q++  I   P D T+V+L++ N  E DILLK EL+ +    P+   +V+YL +    
Sbjct: 189 PMLQVLNTIITTPTDLTRVTLLYANETENDILLKDELDEISEKYPNF--LVHYLVNHPSS 246

Query: 258 DWTGGVGYITKDVIKEHLPAATMDNVQILICGPPAMVASVRRSTVDLGF 306
            W G VG++TK+++ ++LP  + +N ++LICG P M  ++ +   +LG+
Sbjct: 247 SWQGEVGWVTKEIMSKYLPDPSAEN-RLLICGKPEMKKTLLKYAEELGW 294

>AFR439C [3631] [Homologous to ScYML125C - SH; ScYML087C - SH]
           (1228716..1229648) [933 bp, 310 aa]
          Length = 310

 Score =  166 bits (419), Expect = 6e-49,   Method: Compositional matrix adjust.
 Identities = 89/242 (36%), Positives = 139/242 (57%), Gaps = 4/242 (1%)

Query: 76  NDFQSFPLVEKTILTHNTSMYKFGLPHADDVLGLPIGQHIVIKANINGKDITRSYTPTSL 135
           N++    L E+ +L+ N ++Y+F L  + + L +P G H+  K  ++G +  R YTP S 
Sbjct: 68  NEWTPLELEERIVLSKNAAIYRFKLRSSVETLDIPTGFHLAAKVMLDGVEEVRYYTPIS- 126

Query: 136 DGDTKGNFELLVKSYPTGNVSKMIGELKIGDSIQIKGPRGNYHYERNCRSHLGMIAGGTG 195
           +   +G+F+++VKSY  G VSK    L+ G +++ KGP G + Y  N    +GM+ GG+ 
Sbjct: 127 NKFAEGHFDIIVKSYVDGKVSKWFAGLQPGQTVEFKGPVGRFSYVTNAYKKIGMVTGGSA 186

Query: 196 IAPMYQIMKAIAMDPHDTTKVSLVFGNVHEEDILLKKELEALVAMKPSQFKIVYYLDSPD 255
           I PM  ++  I   P DTT+V L++ N  E DILLK EL+ L +  P+ F++ Y +  P 
Sbjct: 187 ITPMLSVLNKIVTTPEDTTQVCLIYANETENDILLKDELDDLASKYPN-FEVHYVVRKPS 245

Query: 256 REDWTGGVGYITKDVIKEHLPAATMDNVQILICGPPAMVASVRRSTVDLGFRRSKPLSKM 315
              WTG VGY+TK  ++++LP     + ++LICGPP M   V      LG+ +    SK 
Sbjct: 246 -ASWTGEVGYVTKQHLEKYLPPCNPAH-RLLICGPPKMKQMVLEYAEQLGWPKGAMKSKP 303

Query: 316 ED 317
           ED
Sbjct: 304 ED 305

>CAGL0B02519g 240486..241424 highly similar to sp|Q12746
           Saccharomyces cerevisiae YML125c, start by similarity
          Length = 312

 Score =  159 bits (402), Expect = 2e-46,   Method: Compositional matrix adjust.
 Identities = 86/248 (34%), Positives = 145/248 (58%), Gaps = 6/248 (2%)

Query: 60  KFIIGPKTKPVLDPKRNDFQSFPLVEKTILTHNTSMYKFGLPHADDVLGLPIGQHIVIKA 119
           +F    K +  L P +  + S  L ++T+++ NT++Y+F L    + + +P G H+ ++ 
Sbjct: 56  RFFAAFKRRRSLYPDK--WTSLELEDQTLISRNTAIYRFKLKTPLETIDIPSGHHVQVRV 113

Query: 120 NINGKDITRSYTPTSLDGDTKGNFELLVKSYPTGNVSKMIGELKIGDSIQIKGPRGNYHY 179
            I+GK+  R+Y P S   + KG+ +LLVKSY  G VSK    +K G+++  +GP G+  Y
Sbjct: 114 FIDGKEEVRNYNPISTRFE-KGHIDLLVKSYKDGKVSKYFASMKPGETVDFRGPVGSLVY 172

Query: 180 ERNCRSHLGMIAGGTGIAPMYQIMKAIAMDPHDTTKVSLVFGNVHEEDILLKKELEALVA 239
           + N   ++GM+ GG+GI P  Q++  I   P D TK+SL++ N  E+DILLK+EL+ +  
Sbjct: 173 KPNTYKNIGMVCGGSGITPALQMLNDIITVPEDLTKLSLIYCNETEKDILLKEELDEMAE 232

Query: 240 MKPSQFKIVYYLDSPDREDWTGGVGYITKDVIKEHLPAATMDNVQILICGPPAMVASVRR 299
             P  F + Y +  P  + W G VG+I+K+ + +HLP    D+ ++LICGP      V  
Sbjct: 233 KYP-HFNVHYIVSQPTGQ-WEGEVGHISKETMVKHLPHPA-DDSRLLICGPEGFTQKVFD 289

Query: 300 STVDLGFR 307
              ++G++
Sbjct: 290 QAKEIGWK 297

>ACR054C [1102] [Homologous to ScYKL150W (MCR1) - SH]
           (454023..454943) [921 bp, 306 aa]
          Length = 306

 Score =  150 bits (380), Expect = 3e-43,   Method: Compositional matrix adjust.
 Identities = 79/215 (36%), Positives = 124/215 (57%), Gaps = 4/215 (1%)

Query: 89  LTHNTSMYKFGLPHADDVLGLPIGQHIVIK-ANINGKDITRSYTPTSLDGDTKGNFELLV 147
           ++H+T  + F LP  D V GL     ++ K     G ++ R YTP S D   +G F+L++
Sbjct: 70  VSHDTRRFTFALPSQDHVTGLTTASALLAKYVTPKGSNVIRPYTPVS-DNMARGMFQLVI 128

Query: 148 KSYPTGNVSKMIGELKIGDSIQIKGPRGNYHYERNCRSHLGMIAGGTGIAPMYQIMKAIA 207
           K Y  G  +  +  LK  D+++ KGP   + ++ N    + ++  GTGI P++Q+M  IA
Sbjct: 129 KHYDGGKFTTHLFGLKENDTVEFKGPIQKWRWDPNMFDSIVLMGAGTGITPLFQMMHHIA 188

Query: 208 MDPHDTTKVSLVFGNVHEEDILLKKELEALVAMKPSQFKIVYYLDSPDREDWTGGVGYIT 267
            +P D TKV L++GN   +DILL+KELE L +  P Q K+ Y++D P+  D+ G  G+IT
Sbjct: 189 ENPTDNTKVHLLYGNKTPQDILLRKELEELASKYPDQVKVTYFVDKPE-GDYKGEKGFIT 247

Query: 268 KDVIKEHLPAATMDNVQILICGPPAMVASVRRSTV 302
           KD +K++LP     N  I +CGPP  + +   + V
Sbjct: 248 KDFLKQNLPTPG-SNSHIFVCGPPPFMDAFSGNKV 281

>KLLA0D04488g complement(381861..382751) similar to sp|P36060
           Saccharomyces cerevisiae YKL150w MCR1 cytochrome-b5
           reductase, start by similarity
          Length = 296

 Score =  150 bits (379), Expect = 3e-43,   Method: Compositional matrix adjust.
 Identities = 81/222 (36%), Positives = 122/222 (54%), Gaps = 4/222 (1%)

Query: 76  NDFQSFPLVEKTILTHNTSMYKFGLPHADDVLGLPIGQHIVIK-ANINGKDITRSYTPTS 134
           N++   P+++   L+H+T  + F LP  D V GL     I+ K     G ++ R YTP S
Sbjct: 47  NEWIDLPIIKIEKLSHDTKRFTFALPKKDQVSGLITASCILAKFVTPKGSNVIRPYTPVS 106

Query: 135 LDGDTKGNFELLVKSYPTGNVSKMIGELKIGDSIQIKGPRGNYHYERNCRSHLGMIAGGT 194
            D  TKG  EL+VK Y  G  +  +  LK  D++  KGP   + ++ N    + ++  GT
Sbjct: 107 -DNGTKGKMELVVKHYENGKFTSHLFGLKENDTVSFKGPITKWEWKPNSYDSITLLGAGT 165

Query: 195 GIAPMYQIMKAIAMDPHDTTKVSLVFGNVHEEDILLKKELEALVAMKPSQFKIVYYLDSP 254
           GI P+YQ++  IA +P D TK+ L +GN   EDILLK EL+ L    P Q KI Y++D  
Sbjct: 166 GINPLYQLVHHIAENPEDNTKIHLYYGNKTPEDILLKSELDNLQKKYPDQVKITYFVDKA 225

Query: 255 DREDWTGGVGYITKDVIKEHLPAATMDNVQILICGPPAMVAS 296
           +  ++ G  G+ITKD +    P  +  N Q+ +CGPP  + +
Sbjct: 226 EG-NFEGETGFITKDYLSHQAPKPSEKN-QVFVCGPPPFMKA 265

>Kwal_23.5471
          Length = 312

 Score =  144 bits (362), Expect = 2e-40,   Method: Compositional matrix adjust.
 Identities = 79/249 (31%), Positives = 136/249 (54%), Gaps = 17/249 (6%)

Query: 76  NDFQSFPLVEKTILTHNTSMYKFGLPHADDVLGLPIGQHIVIKANI-NGKDITRSYTPTS 134
           + +   P+ +   ++H+T  + F LP  D V GL     ++ K     G ++ R YTP S
Sbjct: 63  DSWVELPIAKIEDVSHDTRRFVFSLPQEDQVSGLITASALLAKLQTPKGSNVIRPYTPVS 122

Query: 135 LDGDTKGNFELLVKSYPTGNVSKMIGELKIGDSIQIKGPRGNYHYERNCRSHLGMIAGGT 194
            D  TKG+ E ++K Y  G +++M+ + K  D++  KGP   + ++ N    + +I  G+
Sbjct: 123 -DVSTKGHIEFVIKHYKGGKMTEMLFDKKPSDTVAFKGPIIKWEWKPNSFDSITLIGAGS 181

Query: 195 GIAPMYQIMKAIAMDPHDTTKVSLVFGNVHEEDILLKKELEALVAMKPSQFKIVYYLDSP 254
           GI P+YQ++  I+ +P D TK+ L++GN    DILLKKELE + A    Q KI +++D  
Sbjct: 182 GITPLYQLLHHISQNPEDKTKIHLLYGNKTPNDILLKKELEEVQAKYADQVKIHFFVDKA 241

Query: 255 DREDWTGGVGYITKDVIKEHLPAATMDNVQILICGPPAMVASVRRSTV------------ 302
           +   + G +G+ITK+ +++++P A+  N Q+ +CGPP  + +     V            
Sbjct: 242 EGP-FDGEIGFITKEFLEKNVPKASEKN-QVFVCGPPPFMQAYSGPKVSPKDQGELTGIL 299

Query: 303 -DLGFRRSK 310
            DLGF + +
Sbjct: 300 KDLGFSKEQ 308

>YKL150W (MCR1) [3118] chr11 (166549..167457) NADH-cytochrome b5
           reductase, mitochondrial protein that may be involved in
           the response to oxidative damage [909 bp, 302 aa]
          Length = 302

 Score =  137 bits (344), Expect = 6e-38,   Method: Compositional matrix adjust.
 Identities = 72/207 (34%), Positives = 119/207 (57%), Gaps = 4/207 (1%)

Query: 90  THNTSMYKFGLPHADDVLGLPIGQHIVIK-ANINGKDITRSYTPTSLDGDTKGNFELLVK 148
           +H+T  + F LP  D  +GL +   +  K     G ++ R YTP S D   KG+F+L+VK
Sbjct: 65  SHDTRRFTFKLPTEDSEMGLVLASALFAKFVTPKGSNVVRPYTPVS-DLSQKGHFQLVVK 123

Query: 149 SYPTGNVSKMIGELKIGDSIQIKGPRGNYHYERNCRSHLGMIAGGTGIAPMYQIMKAIAM 208
            Y  G ++  +  LK  D++  KGP   + ++ N    + ++  GTGI P+YQ+   I  
Sbjct: 124 HYEGGKMTSHLFGLKPNDTVSFKGPIMKWKWQPNQFKSITLLGAGTGINPLYQLAHHIVE 183

Query: 209 DPHDTTKVSLVFGNVHEEDILLKKELEALVAMKPSQFKIVYYLDSPDREDWTGG-VGYIT 267
           +P+D TKV+L++GN   +DILL+KEL+AL    P +F + Y++D    +    G + +I+
Sbjct: 184 NPNDKTKVNLLYGNKTPQDILLRKELDALKEKYPDKFNVTYFVDDKQDDQDFDGEISFIS 243

Query: 268 KDVIKEHLPAATMDNVQILICGPPAMV 294
           KD I+EH+P    ++  + +CGPP  +
Sbjct: 244 KDFIQEHVPGPK-ESTHLFVCGPPPFM 269

>Scas_678.6
          Length = 299

 Score =  135 bits (340), Expect = 2e-37,   Method: Compositional matrix adjust.
 Identities = 74/217 (34%), Positives = 113/217 (52%), Gaps = 4/217 (1%)

Query: 82  PLVEKTILTHNTSMYKFGLPHADDVLGLPIGQHIVIK-ANINGKDITRSYTPTSLDGDTK 140
           P+V+    +H+T  + F LP  D + GL +   I  K     G ++ R YTP S   D +
Sbjct: 54  PIVKIEDESHDTKRFTFKLPSEDAITGLTLASAIFTKYVTAKGNNVVRPYTPVS-PLDQQ 112

Query: 141 GNFELLVKSYPTGNVSKMIGELKIGDSIQIKGPRGNYHYERNCRSHLGMIAGGTGIAPMY 200
           G FEL++K Y  G +S  +  LK  D +  KGP   + +  N    + ++  GTG  P+Y
Sbjct: 113 GTFELVIKHYNDGKMSSHLFSLKPNDVVSFKGPIKKWQWVPNSFKSITLLGAGTGTTPLY 172

Query: 201 QIMKAIAMDPHDTTKVSLVFGNVHEEDILLKKELEALVAMKPSQFKIVYYLDSPDREDWT 260
           Q+   IA +P D TK+++ +GN    DILLKKE   L    P Q K+ Y++D  D     
Sbjct: 173 QLASHIARNPEDKTKINVFYGNKTSSDILLKKEWNELQEKYPDQVKVTYFVDKLDDGKEN 232

Query: 261 G-GVGYITKDVIKEHLPAATMDNVQILICGPPAMVAS 296
           G  +G+I+K+ I ++ P    D   + ICGPP  + +
Sbjct: 233 GVELGFISKEFIAKNAPGPKED-THLFICGPPPFMKA 268

>CAGL0E06424g 644026..644922 similar to sp|P36060 Saccharomyces
           cerevisiae YKL150w MCR1 cytochrome-b5 reductase, start
           by similarity
          Length = 298

 Score =  134 bits (338), Expect = 4e-37,   Method: Compositional matrix adjust.
 Identities = 71/209 (33%), Positives = 114/209 (54%), Gaps = 3/209 (1%)

Query: 90  THNTSMYKFGLPHADDVLGLPIGQHIVIK-ANINGKDITRSYTPTSLDGDTKGNFELLVK 148
           +H+T  + F LP  D V GL +   ++ K     G  + R YTP S D   KG  E ++K
Sbjct: 62  SHDTKRFFFKLPTDDSVSGLTLASAVLTKFMTPKGNPVIRPYTPVS-DLSEKGYIEFVIK 120

Query: 149 SYPTGNVSKMIGELKIGDSIQIKGPRGNYHYERNCRSHLGMIAGGTGIAPMYQIMKAIAM 208
            Y  G ++  + +LK  D++  +GP   + ++ N    + ++ GGTGI P+YQ++  I  
Sbjct: 121 HYEGGKMTDHLFQLKPKDTLAFQGPIPKWQWKPNSFDTITLLGGGTGITPLYQLVHHITQ 180

Query: 209 DPHDTTKVSLVFGNVHEEDILLKKELEALVAMKPSQFKIVYYLDSPDREDWTGGVGYITK 268
           +  D TK++L +G+    DILLKKEL+ L    P Q  I Y++D  D   + G  G+ITK
Sbjct: 181 NKEDKTKINLFYGSKTPSDILLKKELDDLQKKYPEQLNIQYFVDKDDTGKFDGNKGFITK 240

Query: 269 DVIKEHLPAATMDNVQILICGPPAMVASV 297
           D + ++ P    +  Q+ +CGPP  + S+
Sbjct: 241 DFLAKNAPGPK-EKTQVFVCGPPPFMDSL 268

>CAGL0L06666g 752336..753532 highly similar to sp|P39676
           Saccharomyces cerevisiae YGR234w YHB1 flavohemoglobin,
           start by similarity
          Length = 398

 Score = 45.1 bits (105), Expect = 4e-05,   Method: Compositional matrix adjust.
 Identities = 50/215 (23%), Positives = 98/215 (45%), Gaps = 36/215 (16%)

Query: 95  MYKFGL-PHAD---DVLGLPI--GQHIVIKANI----NGKDITRSYTPTSLDGDTKGNFE 144
           +Y+F + P  D   D+  LPI  GQ+I + ++     N  D  R Y+  S   DT    +
Sbjct: 164 IYEFTVKPTGDSGVDLAKLPIIPGQYITVNSHPVRQDNKYDALRHYSICS--ADTTNGLK 221

Query: 145 LLVK-----SYPTGNVSKMIG-ELKIGDSIQIKGPRGNYHYERNCRSH----LGMIAGGT 194
             VK     + P G VS+ +  ++K+GD +++  P G++   ++  +     L +++ G 
Sbjct: 222 FAVKLQTSTNNPDGLVSEFLHKDVKVGDVLKLSAPAGDFAVNKDLINQNDIPLVLLSSGV 281

Query: 195 GIAPMYQIMKAIAMDPHDTTKVSLVFGNVHEEDILLKKELEALVAMKPSQFKIVYYLDSP 254
           G+ P+  +++A  +  + +  +  +    +E  +  K  ++ L+       K+V   DS 
Sbjct: 282 GVTPIVSMLEA-QVKENPSRPIVWIQSAYNEPHVAFKNHVDNLLKQAKDAKKVVVLTDSQ 340

Query: 255 DREDWTGGVGYITKDVIKEHLPAATMDNVQILICG 289
            R         I    +KE++PA    +  + ICG
Sbjct: 341 PR---------IDDKFLKENVPA----HADVYICG 362

>Scas_699.41
          Length = 318

 Score = 44.3 bits (103), Expect = 6e-05,   Method: Compositional matrix adjust.
 Identities = 39/196 (19%), Positives = 77/196 (39%), Gaps = 18/196 (9%)

Query: 126 ITRSYTPTSL-------------DGDTKGNFELLVKSYPTGNVSKMIGELKIGDSIQIKG 172
           + R+YTP  L             D +  G     +K Y  G V++ +  L +  +++I+G
Sbjct: 101 VVRNYTPVPLSFVQDHNDLIPMTDKNDTGKLVFYLKQYSNGEVARWLHRLPVNSTVEIRG 160

Query: 173 PRGNYHYER--NCRSHLGMIAGGTGIAPMYQIMKAIAM--DPHDTTKVSLVFGNVHEEDI 228
           P  +Y ++   N +  + M   G G+   +Q++ + +   D   + ++    G+++E   
Sbjct: 161 PFIDYKFQETDNTKFDVSMFTAGAGVVTAFQLLLSPSSKNDFRGSVRLFHSCGSLNELGP 220

Query: 229 LLKKELEALVAMKPSQFKIVYYLDSPDREDWTGGVGYITKDVIKEHLPAATMDNVQILIC 288
           L K          P   K        D       V  +        L  + +  +  L+C
Sbjct: 221 LKKIMFSLQHDNGPIDMKFFESEKGDDIRTQLKSVSQLFPQFKPSQLGRSNLRQLA-LVC 279

Query: 289 GPPAMVASVRRSTVDL 304
           GP   + +V  ++VDL
Sbjct: 280 GPEGFIDTVAGASVDL 295

>CAGL0I00990g complement(81437..82468) similar to sp|P38909
           Saccharomyces cerevisiae YOR037w CYC2, hypothetical
           start
          Length = 343

 Score = 42.0 bits (97), Expect = 4e-04,   Method: Compositional matrix adjust.
 Identities = 49/216 (22%), Positives = 82/216 (37%), Gaps = 54/216 (25%)

Query: 126 ITRSYTPTSLDGDTKGNFELL--------------VKSYPTGNVSKMIGELKIGDSIQIK 171
           + R+YTP  L   + GN   L              +KSY  G V++ I  L +G +++++
Sbjct: 120 VVRNYTPLPLQLKSNGNIVPLDLNDPVESKKLLFYIKSYNNGEVARWIKSLPVGSTLELR 179

Query: 172 GPRGNYHYERNCRSH-----------------LGMIAGGTGIAPMYQIMKAIAMDPHDTT 214
           GP  +Y +  +   H                 +   AGGTGI    Q +    ++P+   
Sbjct: 180 GPFIDYKFRNDLSKHHRDANGSTLINKTQLSNVPFFAGGTGIVTALQPI----LNPYGQF 235

Query: 215 KVSLVFGNVHE-EDILLKKELEALVAMKPSQFKIVYYLDSPDREDWTGGVGYITKDVI-- 271
             ++     H  + I     L  LV     Q KI Y+L    + D          ++I  
Sbjct: 236 NYNMTL--FHSCKSIQELGCLYHLVNGLAQQNKITYHLFETSKGD----------NIIDF 283

Query: 272 KEHLPAATMDNVQIL----ICGPPAMVASVRRSTVD 303
           K+ +P     N   L    +CGP   + +V  +  D
Sbjct: 284 KQLIPGPNTSNAGNLDTSIVCGPEGYITTVAGAKYD 319

>Scas_595.11
          Length = 398

 Score = 40.8 bits (94), Expect = 0.001,   Method: Compositional matrix adjust.
 Identities = 50/233 (21%), Positives = 107/233 (45%), Gaps = 40/233 (17%)

Query: 78  FQSFPLVEKTILTHNTSMYKFGL-PHAD---DVLGLPI--GQHIVIKANI----NGKDIT 127
           ++ F +V+K ++ ++  +Y F + P  +   ++  LPI  GQ+I +  +     N  D  
Sbjct: 149 WKPFTVVDKELVAND--VYAFTVKPTTESGINLSTLPIVAGQYITVNTHPVRQDNQYDAL 206

Query: 128 RSYTPTSLDGDTKGNFELLVK-----SYPTGNVSKMIG-ELKIGDSIQIKGPRGNYHYER 181
           R Y+  S+   TK   +  VK     ++P G VS+ +  ++K+GD +++  P G++    
Sbjct: 207 RHYSLCSIS--TKDGLKFAVKLETDKTHPAGLVSEFLHKDVKVGDELKLSAPAGDFALTD 264

Query: 182 NCRSH----LGMIAGGTGIAPMYQIM-KAIAMDPHDTTKVSLVFGNVHEEDILLKKELEA 236
                    L +++ G G+ P+  ++ K +  +P+    +  +  + +E     KK ++ 
Sbjct: 265 KLIHQNEIPLVLLSAGVGVTPILAMLEKQVTENPN--RPIYWIQSSYNEGTQSFKKHVDE 322

Query: 237 LVAMKPSQFKIVYYLDSPDREDWTGGVGYITKDVIKEHLPAATMDNVQILICG 289
           L+    +  K + Y D+            I  + ++E +PA    N  + +CG
Sbjct: 323 LLDKATTTKKTILYTDTQPA---------IDAEFLQEQIPA----NADVYLCG 362

>YOR037W (CYC2) [4849] chr15 (401554..402654) Cytochrome c
           mitochondrial import factor, primarily involved in
           import of Cyc1p and also involved in import of Cyc7p
           [1101 bp, 366 aa]
          Length = 366

 Score = 40.0 bits (92), Expect = 0.002,   Method: Compositional matrix adjust.
 Identities = 58/240 (24%), Positives = 89/240 (37%), Gaps = 71/240 (29%)

Query: 126 ITRSYTPTSL-------------DGDTK-GNFELLVKSYPTGNVSKMIGELKIGDSIQIK 171
           + R+YTP  L             DGD   G     +K Y  G V++ +  L  G  I+I+
Sbjct: 116 VVRNYTPLPLKFNPASKEIEILKDGDNADGKLSFYIKKYENGEVARWLHHLPKGHIIEIR 175

Query: 172 GPRGNYHY---------ERNC-----RSHLG-----------------MIAGGTGIAPMY 200
           GP  +Y +          R+C     R+  G                 M   GTGI    
Sbjct: 176 GPFIDYEFPHLPNELKRSRDCLYMDNRNERGNNVRENSQFIYQPYDIMMFTAGTGIVTAL 235

Query: 201 QIMKAIAMDP-HDTTKVSLVFGNVHE----EDILLKKELEALVAMKPSQFKIVYYLDSPD 255
           Q++  +   P   T K+     N+ +      ILL+     L A    Q KI       D
Sbjct: 236 QLL--LTESPFRGTIKLFHTDKNIKQLGPLYPILLR-----LQASNRVQLKIF----ETD 284

Query: 256 REDWTGGVGYITKDVIKEH-----LPAATMDNVQI-----LICGPPAMVASVRRSTVDLG 305
           R+     +  I K + K +     LP + ++N  I     L+CGP + ++S+     DL 
Sbjct: 285 RQTKQDVLKSIQKSITKPYPYKGLLPFSNVNNKNIMPVLALVCGPESYISSISGRKYDLN 344

>CAGL0H08580g complement(841038..842903) highly similar to tr|Q12181
           Saccharomyces cerevisiae YPR048w TAH18, hypothetical
           start
          Length = 621

 Score = 38.9 bits (89), Expect = 0.005,   Method: Compositional matrix adjust.
 Identities = 31/117 (26%), Positives = 58/117 (49%), Gaps = 9/117 (7%)

Query: 143 FELLVKSYPTGNVSKMIGELKIGDSIQIKGPRGNYHYERNCRSHLGMIAGGTGIAPMYQI 202
           ++ +++   TG  +  I +LK+GD I+ K  + +   E    +   M+  G G+AP+   
Sbjct: 433 YKTILRKIRTGVCTDFISKLKVGDKIRYKIQQNDLIKEEYRSNPFVMVGPGVGLAPLLSA 492

Query: 203 MKAIAMDPHDTTKVSLVFG-NVHEEDILLKKELEALVAMKPSQFKIVYYLDSPDRED 258
           +++       + ++SL FG    ++D L  KELE +      +F  V+   S DRE+
Sbjct: 493 VRSKV-----SPEMSLYFGCRFKDKDYLHGKELEDMANQGLIKFYPVF---SRDREN 541

>YGR234W (YHB1) [2182] chr7 (959906..961105) Flavohemoglobin
           involved in protection from nitrosative stress,
           distantly related to animal hemoglobins [1200 bp, 399
           aa]
          Length = 399

 Score = 37.7 bits (86), Expect = 0.008,   Method: Compositional matrix adjust.
 Identities = 56/258 (21%), Positives = 110/258 (42%), Gaps = 44/258 (17%)

Query: 58  LFKFIIGPKTKPVLDPKRNDFQSFPLVEKTILTHNTSMYKFGLPHADDVLGLPI--GQHI 115
           +++  + P  KP  D    ++ +  +VE T+        KFG     ++  LPI  GQ+I
Sbjct: 140 MYEEALWPGWKP-FDITAKEYVASDIVEFTVKP------KFG--SGIELESLPITPGQYI 190

Query: 116 VIKAN----INGKDITRSYTPTSLDGDTKGNFELLVK------SYPTGNVSKMIG-ELKI 164
            +  +     N  D  R Y+  S    TK      VK      ++P G VS+ +  + K+
Sbjct: 191 TVNTHPIRQENQYDALRHYSLCS--ASTKNGLRFAVKMEAARENFPAGLVSEYLHKDAKV 248

Query: 165 GDSIQIKGPRGNYHYERNCRSH----LGMIAGGTGIAPMYQIMKA-IAMDPHDTTKVSLV 219
           GD I++  P G++   +         L +++ G G+ P+  +++  +  +P+    +  +
Sbjct: 249 GDEIKLSAPAGDFAINKELIHQNEVPLVLLSSGVGVTPLLAMLEEQVKCNPN--RPIYWI 306

Query: 220 FGNVHEEDILLKKELEALVAMKPSQFKIVYYLDSPDREDWTGGVGYITKDVIKEHLPAAT 279
             +  E+    KK ++ L+A   +  KI+ + D+            I    +KE  PA  
Sbjct: 307 QSSYDEKTQAFKKHVDELLAECANVDKIIVHTDTEP---------LINAAFLKEKSPA-- 355

Query: 280 MDNVQILICGPPAMVASV 297
             +  +  CG  A + ++
Sbjct: 356 --HADVYTCGSLAFMQAM 371

>KLLA0E21901g 1946190..1947263 similar to sp|P38909 Saccharomyces
           cerevisiae YOR037w CYC2 cytochrome-c mitochondrial
           import factor singleton, hypothetical start
          Length = 357

 Score = 37.4 bits (85), Expect = 0.011,   Method: Compositional matrix adjust.
 Identities = 29/114 (25%), Positives = 43/114 (37%), Gaps = 37/114 (32%)

Query: 126 ITRSYTPTSLDGDTKGNFELL-------------VKSYPTGNVSKMIGELKIGDSIQIKG 172
           + RSYTP  L  +  G  E+L             +K Y  G V++ I  L +G  ++++G
Sbjct: 116 VVRSYTPLPLTIEENGAVEVLRDEENASGALTFYIKQYKQGEVARWINHLPLGHVLELRG 175

Query: 173 PRGNYHYERNC------RSHLG------------------MIAGGTGIAPMYQI 202
           P   Y +          RS L                      GGTGI P+ Q+
Sbjct: 176 PFVEYEFPDTADEITRDRSFLWGNEDCVKDNYKYQPFDILFFTGGTGIVPLLQM 229

>Kwal_55.21561
          Length = 349

 Score = 36.2 bits (82), Expect = 0.026,   Method: Compositional matrix adjust.
 Identities = 29/114 (25%), Positives = 46/114 (40%), Gaps = 36/114 (31%)

Query: 126 ITRSYTPTSL------------DGDT-KGNFELLVKSYPTGNVSKMIGELKIGDSIQIKG 172
           + R+YTP  L            DGD  +G     +K Y  G V++ +  L  G  ++++G
Sbjct: 109 VVRNYTPLPLQHVGSGEFKVLADGDNGQGKLSFYLKKYQYGEVARWLSRLPEGHILELRG 168

Query: 173 PRGNYHY------ERNCRSHL-----------------GMIAGGTGIAPMYQIM 203
           P  +Y +      E+  RS L                      GTGIAP+ Q++
Sbjct: 169 PYIDYEFPSMDNGEKLDRSFLWGAKPSSDKLMIQPFDISAFTAGTGIAPIMQLL 222

>Scas_718.19
          Length = 616

 Score = 32.3 bits (72), Expect = 0.47,   Method: Compositional matrix adjust.
 Identities = 39/168 (23%), Positives = 74/168 (44%), Gaps = 16/168 (9%)

Query: 143 FELLVKSYPTGNVSKMIGELKIGDSIQIKGPRGNYHYERNCRSHLGMIAGGTGIAPMYQI 202
           +  +++    G  +  I  LK GD ++ K    N   +      + +++ G GIAP+  I
Sbjct: 428 YRTILRKIRKGVCTDYIAHLKEGDHLRYKIQHNNLVRDNYHGRPMILVSPGVGIAPLMSI 487

Query: 203 MKAIAMDPHDTTKVSLVFG-NVHEEDILLKKELEALVAMKPSQFKIVYYLDSPDREDWTG 261
           +KA       +  ++  FG    ++D L +  LE     K  +   V+   S DRE+ + 
Sbjct: 488 VKAKL-----SEDINFFFGCRFKDKDYLYQNLLEEWEKEKRIKLHPVF---SRDREN-SP 538

Query: 262 GVGYITKDVIKEHLPAAT----MDNVQILICGPPA-MVASVRRSTVDL 304
              Y+ +DV+ +  P  T     +N  + +CG    M   VR + +++
Sbjct: 539 DTKYV-QDVLWKLGPEMTNLIVKENAIMCLCGASGKMPVQVRLTFIEM 585

>ACR090C [1137] [Homologous to ScYOR037W (CYC2) - SH]
           (519431..520531) [1101 bp, 366 aa]
          Length = 366

 Score = 31.6 bits (70), Expect = 0.74,   Method: Compositional matrix adjust.
 Identities = 18/68 (26%), Positives = 31/68 (45%), Gaps = 14/68 (20%)

Query: 126 ITRSYTPTSL-------------DGDTKGN-FELLVKSYPTGNVSKMIGELKIGDSIQIK 171
           + R YTP  L             DGD  G    L +K Y +G V++ + +L  G  ++++
Sbjct: 124 VVRQYTPLPLVADEDGEQLRALRDGDNGGGKLMLYIKEYGSGEVARWLRKLPKGHIVEVR 183

Query: 172 GPRGNYHY 179
           GP   + +
Sbjct: 184 GPYPEFEF 191

>YOL027C (MDM38) [4789] chr15 complement(272003..273724) Protein
           essential for maintaining wild-type mitochondrial
           morphology, has moderate similarity to uncharacterized
           C. albicans Orf6.7216p [1722 bp, 573 aa]
          Length = 573

 Score = 29.6 bits (65), Expect = 3.4,   Method: Compositional matrix adjust.
 Identities = 23/75 (30%), Positives = 34/75 (45%), Gaps = 6/75 (8%)

Query: 123 GKDITRSYTPTSLDGDTKGNFELLVKSYPT----GNVSKMIG-ELKIGDSIQIKGPRGNY 177
            K +T+   PTS D   K    L+VK         N +K++G E+K+   + IK  +G Y
Sbjct: 61  SKSVTKPVAPTSTDAPAKPKETLMVKVKHALKHYANGTKLLGYEIKVSTKLLIKFAQG-Y 119

Query: 178 HYERNCRSHLGMIAG 192
              R  R+ L    G
Sbjct: 120 ELSRRERNQLRRTMG 134

>Scas_662.23
          Length = 1158

 Score = 29.3 bits (64), Expect = 5.9,   Method: Compositional matrix adjust.
 Identities = 14/36 (38%), Positives = 21/36 (58%)

Query: 111 IGQHIVIKANINGKDITRSYTPTSLDGDTKGNFELL 146
           + Q +VIKAN+ G  I  S +  S   DT+  F+L+
Sbjct: 252 VNQKVVIKANVFGVTIPVSVSDISFKADTRVRFKLM 287

  Database: blastdb
    Posted date:  Apr 3, 2006  3:33 PM
  Number of letters in database: 16,596,109
  Number of sequences in database:  34,618
  
Lambda     K      H
   0.319    0.137    0.398 

Gapped
Lambda     K      H
   0.267   0.0410    0.140 

Matrix: BLOSUM62
Gap Penalties: Existence: 11, Extension: 1
Number of Sequences: 34618
Number of Hits to DB: 10,158,081
Number of extensions: 432449
Number of successful extensions: 1147
Number of sequences better than 10.0: 36
Number of HSP's gapped: 1106
Number of HSP's successfully gapped: 36
Length of query: 317
Length of database: 16,596,109
Length adjustment: 102
Effective length of query: 215
Effective length of database: 13,065,073
Effective search space: 2808990695
Effective search space used: 2808990695
Neighboring words threshold: 11
Window for multiple hits: 40
X1: 16 ( 7.4 bits)
X2: 38 (14.6 bits)
X3: 64 (24.7 bits)
S1: 41 (21.7 bits)
S2: 61 (28.1 bits)