Hit NameLength (aa)HSP LengthHSP ScoreHSP Significance
YIL041W32632115970.0
CAGL0L00891g34129910571e-145
Sklu_2174.33303189811e-133
Kwal_47.181483233189371e-127
Scas_704.453293029021e-121
ADL115W3333178631e-115
KLLA0E04433g3023037631e-101
Kwal_55.212273762422022e-17
CAGL0L08492g3852431685e-13
KLLA0E04543g3892331661e-12
AFR309C3642631622e-12
Scas_676.184442461553e-11
YPR148C435661375e-09
KLLA0C10692g520136720.56
Kwal_56.2261874060701.1
AFR342C64987644.6
BLASTP 2.2.26 [Sep-21-2011]

Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, 
Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), 
"Gapped BLAST and PSI-BLAST: a new generation of protein database search
programs",  Nucleic Acids Res. 25:3389-3402.

Reference for compositional score matrix adjustment: Altschul, Stephen F., 
John C. Wootton, E. Michael Gertz, Richa Agarwala, Aleksandr Morgulis,
Alejandro A. Schaffer, and Yi-Kuo Yu (2005) "Protein database searches
using compositionally adjusted substitution matrices", FEBS J. 272:5101-5109.

Query= YIL041W
         (321 letters)

Database: blastdb 
           34,618 sequences; 16,596,109 total letters

Searching..................................................done

                                                                 Score    E
Sequences producing significant alignments:                      (bits) Value

YIL041W (YIL041W) [2626] chr9 (276524..277504) Cytoplasmic prote...   619   0.0  
CAGL0L00891g 106804..107829 similar to sp|P40531 Saccharomyces c...   411   e-145
Sklu_2174.3 YIL041W, Contig c2174 2044-3036                           382   e-133
Kwal_47.18148                                                         365   e-127
Scas_704.45                                                           352   e-121
ADL115W [1626] [Homologous to ScYIL041W - SH] complement(483166....   337   e-115
KLLA0E04433g complement(406764..407672) similar to sp|P40531 Sac...   298   e-101
Kwal_55.21227                                                          82   2e-17
CAGL0L08492g 929051..930208 similar to tr|Q06523 Saccharomyces c...    69   5e-13
KLLA0E04543g 412009..413178 similar to sgd|S0006352 Saccharomyce...    69   1e-12
AFR309C [3501] [Homologous to ScYPR148C - SH] (1000084..1001178)...    67   2e-12
Scas_676.18                                                            64   3e-11
YPR148C (YPR148C) [5564] chr16 complement(826827..828134) Protei...    57   5e-09
KLLA0C10692g complement(916718..918280) weakly similar to sp|P21...    32   0.56 
Kwal_56.22618                                                          32   1.1  
AFR342C [3534] [Homologous to ScYDR496C (PUF6) - SH] (1058347..1...    29   4.6  

>YIL041W (YIL041W) [2626] chr9 (276524..277504) Cytoplasmic protein
           with possible role in cell-cycle regulation [981 bp, 326
           aa]
          Length = 326

 Score =  619 bits (1597), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 305/321 (95%), Positives = 305/321 (95%)

Query: 1   MSFNAFASSLSKKLQEISTSVSEKTQELPSLAQSTQRMVQERLGQVTDISQLPREYTELE 60
           MSFNAFASSLSKKLQEISTSVSEKTQELPSLAQSTQRMVQERLGQVTDISQLPREYTELE
Sbjct: 1   MSFNAFASSLSKKLQEISTSVSEKTQELPSLAQSTQRMVQERLGQVTDISQLPREYTELE 60

Query: 61  DKVDTIKLIYNHFLGVTAIYENGSYDYPKYINESVNEFSRSVASKLTELTHATSASEAQN 120
           DKVDTIKLIYNHFLGVTAIYENGSYDYPKYINESVNEFSRSVASKLTELTHATSASEAQN
Sbjct: 61  DKVDTIKLIYNHFLGVTAIYENGSYDYPKYINESVNEFSRSVASKLTELTHATSASEAQN 120

Query: 121 ILVAPGPIKEPKTLNYALSKVALNSSECLNKMFPTEEQPLASALLQFSDVQAKIAQARIQ 180
           ILVAPGPIKEPKTLNYALSKVALNSSECLNKMFPTEEQPLASALLQFSDVQAKIAQARIQ
Sbjct: 121 ILVAPGPIKEPKTLNYALSKVALNSSECLNKMFPTEEQPLASALLQFSDVQAKIAQARIQ 180

Query: 181 QDTLIQTKFNKNLRERLSFEIGKADKCRKDVHSMRLRYDVARTNLANNKKPEKEASLRVQ 240
           QDTLIQTKFNKNLRERLSFEIGKADKCRKDVHSMRLRYDVARTNLANNKKPEKEASLRVQ
Sbjct: 181 QDTLIQTKFNKNLRERLSFEIGKADKCRKDVHSMRLRYDVARTNLANNKKPEKEASLRVQ 240

Query: 241 METLEDQFAQVTEDATVCLQEVISHANFSEDLKELAKAQAEYFETSAGLMKEFLSNSFXX 300
           METLEDQFAQVTEDATVCLQEVISHANFSEDLKELAKAQAEYFETSAGLMKEFLSNSF  
Sbjct: 241 METLEDQFAQVTEDATVCLQEVISHANFSEDLKELAKAQAEYFETSAGLMKEFLSNSFAE 300

Query: 301 XXXXXXXXXXXXXXQTAISMN 321
                         QTAISMN
Sbjct: 301 EPEAKPEVAEEEKPQTAISMN 321

>CAGL0L00891g 106804..107829 similar to sp|P40531 Saccharomyces
           cerevisiae YIL041w, hypothetical start
          Length = 341

 Score =  411 bits (1057), Expect = e-145,   Method: Compositional matrix adjust.
 Identities = 208/299 (69%), Positives = 248/299 (82%), Gaps = 8/299 (2%)

Query: 2   SFNAFASSLSKKLQEISTSVSEKTQEL----PSLAQSTQRMVQERLGQVTDISQLPREYT 57
           +FN+FA+SL + LQ  S +VS+KT EL    P+LAQSTQRMVQE+LGQVTDISQLP+EY 
Sbjct: 3   NFNSFANSLRENLQSFSNTVSQKTHELSTNIPTLAQSTQRMVQEKLGQVTDISQLPQEYL 62

Query: 58  ELEDKVDTIKLIYNHFLGVTAIYENGSYDYPKYINESVNEFSRSVASKLTELTHATSASE 117
           ELE+KVDTIK++Y HFL VTA+YEN SYDYPKY++ESVNEFS+++A+K+ EL+ ATSA+E
Sbjct: 63  ELENKVDTIKIVYEHFLQVTAVYENESYDYPKYVSESVNEFSKNMAAKVQELSKATSATE 122

Query: 118 AQNILVAPGPIKEPKTLNYALSKVALNSSECLNKMF--PTEEQPLASALLQFSDVQAKIA 175
           AQNILVAPGP+KEPKTLNYA+SKVALN+SE LN  F  P + + L+  LL +SDVQ K+A
Sbjct: 123 AQNILVAPGPVKEPKTLNYAMSKVALNASEYLNHSFDDPMDAK-LSKVLLNYSDVQTKVA 181

Query: 176 QARIQQDTLIQTKFNKNLRERLSFEIGKADKCRKDVHSMRLRYDVARTNLANNKKPEKEA 235
           QAR+QQDT IQTKFNK +RE L+  I +A+K RKDV S RL+YDVARTNL  N KPEKEA
Sbjct: 182 QARLQQDTQIQTKFNKVIRENLAESIARANKARKDVQSKRLQYDVARTNL-QNAKPEKEA 240

Query: 236 SLRVQMETLEDQFAQVTEDATVCLQEVISHANFSEDLKELAKAQAEYFETSAGLMKEFL 294
            LRVQMETLEDQFAQ TEDATV +QEVI+ ANF   LKELA AQ EY+E SA LMKEF+
Sbjct: 241 GLRVQMETLEDQFAQATEDATVVMQEVIASANFLPSLKELATAQLEYYEQSAKLMKEFI 299

>Sklu_2174.3 YIL041W, Contig c2174 2044-3036
          Length = 330

 Score =  382 bits (981), Expect = e-133,   Method: Compositional matrix adjust.
 Identities = 196/318 (61%), Positives = 245/318 (77%), Gaps = 26/318 (8%)

Query: 1   MSFNAFASSLSKKLQEISTSVSEKTQE------------------------LPSLAQSTQ 36
           MSFNAFA SL+KK QE+STSVS+K QE                        LPSLAQSTQ
Sbjct: 1   MSFNAFADSLNKKFQELSTSVSQKAQEAQLDKKFKDLSQAVSQRTQDLTTSLPSLAQSTQ 60

Query: 37  RMVQERLGQVTDISQLPREYTELEDKVDTIKLIYNHFLGVTAIYENGSYDYPKYINESVN 96
           R+VQERLGQVTDISQLP+EY ELE+++D I+L+Y +FL VT +YE+ SYDYP  + +SVN
Sbjct: 61  RLVQERLGQVTDISQLPQEYLELENRIDRIRLVYENFLKVTQVYEHESYDYPNNVRDSVN 120

Query: 97  EFSRSVASKLTELTHATSASEAQNILVAPGPIKEPKTLNYALSKVALNSSECLNKMFPTE 156
           EFS++V+SKL EL+HA+S  EAQNIL++PGP K+PKTLNYALSKVAL SSE L+K    E
Sbjct: 121 EFSKTVSSKLHELSHASSTDEAQNILISPGPAKDPKTLNYALSKVALTSSEYLSKS-GHE 179

Query: 157 EQPLASALLQFSDVQAKIAQARIQQDTLIQTKFNKNLRERLSFEIGKADKCRKDVHSMRL 216
           ++ +A+ALL++SDVQAKIAQAR+QQDTLIQTKFNK LRE L+ ++ KA K RK+V + RL
Sbjct: 180 DETIATALLKYSDVQAKIAQARLQQDTLIQTKFNKKLRETLASDLNKAVKARKEVENKRL 239

Query: 217 RYDVARTNLANNKKPEKEASLRVQMETLEDQFAQVTEDATVCLQEVISHANFSEDLKELA 276
           +YD+AR NLA N KPEKEASLRVQME+LED+FAQ TEDAT  +Q+VI+ + F +DL EL 
Sbjct: 240 QYDIARANLA-NAKPEKEASLRVQMESLEDEFAQATEDATGVMQDVIASSEFLKDLSELV 298

Query: 277 KAQAEYFETSAGLMKEFL 294
            AQ  Y++ S  L+ +FL
Sbjct: 299 SAQLAYYKLSTELLSDFL 316

>Kwal_47.18148
          Length = 323

 Score =  365 bits (937), Expect = e-127,   Method: Compositional matrix adjust.
 Identities = 184/318 (57%), Positives = 239/318 (75%), Gaps = 25/318 (7%)

Query: 1   MSFNAFASSLSKKLQEISTSVSEKTQE------------------------LPSLAQSTQ 36
           MSFN+FA S+++K QEIS+ VS++ QE                        LPSLAQSTQ
Sbjct: 1   MSFNSFADSVNRKFQEISSQVSQRAQEAQLDKKFKDLSTAVSQKTQDFTTQLPSLAQSTQ 60

Query: 37  RMVQERLGQVTDISQLPREYTELEDKVDTIKLIYNHFLGVTAIYENGSYDYPKYINESVN 96
           R++QE+LGQVTDISQLP++Y ELE+K+D +KL+Y +FL VT +YEN SYDYP  + +SVN
Sbjct: 61  RLMQEKLGQVTDISQLPQDYVELENKIDRMKLVYENFLKVTQVYENESYDYPNNVRDSVN 120

Query: 97  EFSRSVASKLTELTHATSASEAQNILVAPGPIKEPKTLNYALSKVALNSSECLNKMFPTE 156
           EFS  V +KL EL+ ATS +EAQ++L++PGP K+PKTLNYALSKVAL SSE LNK    E
Sbjct: 121 EFSSIVGTKLHELSRATSTNEAQSVLISPGPHKDPKTLNYALSKVALTSSEYLNKSPGAE 180

Query: 157 EQPLASALLQFSDVQAKIAQARIQQDTLIQTKFNKNLRERLSFEIGKADKCRKDVHSMRL 216
           +  ++S+LL++SDVQAKIAQAR+ QDTLIQTKFNK LR  L+ ++ +A K RK+V + RL
Sbjct: 181 DSEVSSSLLKYSDVQAKIAQARLHQDTLIQTKFNKKLRAALADDLNRAQKARKNVENKRL 240

Query: 217 RYDVARTNLANNKKPEKEASLRVQMETLEDQFAQVTEDATVCLQEVISHANFSEDLKELA 276
           +YD+AR NLA N +PEKEASLRVQME+LED+FAQ T+DA V +Q+V   +   +DL+EL 
Sbjct: 241 QYDIARANLA-NARPEKEASLRVQMESLEDEFAQATDDAVVIMQKVAESSELLKDLRELV 299

Query: 277 KAQAEYFETSAGLMKEFL 294
            AQAEY++ SA L+ EFL
Sbjct: 300 AAQAEYYKQSAELLSEFL 317

>Scas_704.45
          Length = 329

 Score =  352 bits (902), Expect = e-121,   Method: Compositional matrix adjust.
 Identities = 189/302 (62%), Positives = 229/302 (75%), Gaps = 7/302 (2%)

Query: 2   SFNAFASSLSKKLQEISTSVSEKTQEL----PSLAQSTQRMVQERLGQVTDISQLPREYT 57
           SFN+F +S SK L E+S++VS+KTQEL    P+LAQSTQRMVQERLGQVTDISQLP EY 
Sbjct: 3   SFNSFTNSFSKTLSELSSTVSQKTQELSTNLPNLAQSTQRMVQERLGQVTDISQLPEEYL 62

Query: 58  ELEDKVDTIKLIYNHFLGVTAIYENGSYDYPKYINESVNEFSRSVASKLTELTHATSASE 117
           ELE K+D+IK IY++FL V+++YE  SYDYP    ES+ EFS++ ASK+ EL+HA+SA E
Sbjct: 63  ELEMKLDSIKQIYDNFLAVSSVYEQQSYDYPYVAKESLIEFSKTAASKVEELSHASSAHE 122

Query: 118 AQNILVAPGP-IKEPKTLNYALSKVALNSSECLNKMFPTEE-QPLASALLQFSDVQAKIA 175
           AQNIL      IKEPKTLN+ALSKVAL SSE LN+    E  +  ASALL FS++QAKIA
Sbjct: 123 AQNILTTSSTQIKEPKTLNFALSKVALKSSEHLNQFNDNEAFKSSASALLNFSNIQAKIA 182

Query: 176 QARIQQDTLIQTKFNKNLRERLSFEIGKADKCRKDVHSMRLRYDVARTNLANNKKPEKEA 235
           QAR+QQD LI+ KFN  LR  L+  I KA K RK+V S RL+YD+ARTNL  N KPEKEA
Sbjct: 183 QARLQQDLLIKQKFNDALRHDLATNIAKATKVRKEVQSKRLQYDIARTNLM-NAKPEKEA 241

Query: 236 SLRVQMETLEDQFAQVTEDATVCLQEVISHANFSEDLKELAKAQAEYFETSAGLMKEFLS 295
           SLRVQMETLED FAQ TE AT+ +Q+VI +++    + ELA+AQ  YFE S+ LMKEF  
Sbjct: 242 SLRVQMETLEDDFAQATEHATIVMQDVIDNSDIVSRVNELARAQLAYFELSSSLMKEFTE 301

Query: 296 NS 297
            S
Sbjct: 302 GS 303

>ADL115W [1626] [Homologous to ScYIL041W - SH]
           complement(483166..484167) [1002 bp, 333 aa]
          Length = 333

 Score =  337 bits (863), Expect = e-115,   Method: Compositional matrix adjust.
 Identities = 175/317 (55%), Positives = 225/317 (70%), Gaps = 26/317 (8%)

Query: 1   MSFNAFASSLSKKLQEISTSVSEKTQE------------------------LPSLAQSTQ 36
           MSFNAFA S SK+ QEIS++V +K QE                        LPSLAQ+TQ
Sbjct: 1   MSFNAFADSFSKRFQEISSTVQQKAQEAQLDKKLKDLSLSVSQRTQDLTSNLPSLAQTTQ 60

Query: 37  RMVQERLGQVTDISQLPREYTELEDKVDTIKLIYNHFLGVTAIYENGSYDYPKYINESVN 96
           R VQERLGQVTDISQ+P EY ELE +VD  KLIY++FL V+ IYE+ SYDYP++I++SVN
Sbjct: 61  RRVQERLGQVTDISQMPEEYVELEQRVDRTKLIYDNFLKVSQIYESESYDYPQHISDSVN 120

Query: 97  EFSRSVASKLTELTHATSASEAQNILVAPGPIKEPKTLNYALSKVALNSSECLNKMFPTE 156
           +FS++V  K+ ELT AT+  EAQ+IL++PGP + PKTLNYALSKVAL SSE L+K   ++
Sbjct: 121 DFSKTVTGKVQELTKATTTEEAQSILISPGPARNPKTLNYALSKVALTSSEYLSKS-GSD 179

Query: 157 EQPLASALLQFSDVQAKIAQARIQQDTLIQTKFNKNLRERLSFEIGKADKCRKDVHSMRL 216
           +   A  LL++SDVQAKIAQAR+QQDTLIQT+FN+ LRE+L+ +  +A + RK V   RL
Sbjct: 180 DVVTADILLKYSDVQAKIAQARLQQDTLIQTRFNRRLREKLNTQFAEAMQSRKQVDQKRL 239

Query: 217 RYDVARTNLANNKKPEKEASLRVQMETLEDQFAQVTEDATVCLQEVISHANFSEDLKELA 276
           +YD+AR N     +PEK+ASLRVQMETLEDQFAQ TEDA   +Q VI    F ++ +EL 
Sbjct: 240 QYDIARANF-TAARPEKQASLRVQMETLEDQFAQSTEDAVALMQAVIDDTEFLKEFQELV 298

Query: 277 KAQAEYFETSAGLMKEF 293
            AQ  + + +A L+  F
Sbjct: 299 TAQLGFHKAAAELLSGF 315

>KLLA0E04433g complement(406764..407672) similar to sp|P40531
           Saccharomyces cerevisiae YIL041w singleton, start by
           similarity
          Length = 302

 Score =  298 bits (763), Expect = e-101,   Method: Compositional matrix adjust.
 Identities = 158/303 (52%), Positives = 215/303 (70%), Gaps = 19/303 (6%)

Query: 6   FASSLSKKLQEISTSVSEKTQE-------------LPSLAQSTQRMVQERLGQVTDISQL 52
           +  S SKK+QE+STSVS+K QE             LP LA STQRM+QE+LGQVTDISQL
Sbjct: 4   YFDSFSKKVQELSTSVSQKAQEAQLDQKFKDLKTNLPLLANSTQRMLQEKLGQVTDISQL 63

Query: 53  PREYTELEDKVDTIKLIYNHFLGVTAIYENGSYDYPKYINESVNEFSRSVASKLTELTHA 112
           P EY +LE +V+TIKLIY +FL VT IYEN SYDYP  + ESV+EFS+ V  KL +L+  
Sbjct: 64  PDEYVQLEHRVETIKLIYENFLKVTKIYENESYDYPSNVKESVDEFSKLVGGKLHDLSKV 123

Query: 113 TSASEAQNILVAPGPIKEPKTLNYALSKVALNSSECLNKMFPTEEQPLASALLQFSDVQA 172
           T+  +AQN+L++   +KEPKTLNYALSKVAL SSE +      E++ LA+ L ++SD Q 
Sbjct: 124 TNREQAQNVLLSSPQMKEPKTLNYALSKVALTSSEHV------EDESLANFLAKYSDSQT 177

Query: 173 KIAQARIQQDTLIQTKFNKNLRERLSFEIGKADKCRKDVHSMRLRYDVARTNLANNKKPE 232
           KIAQ R+QQDT+IQTKFNK ++E+L  +I  + K RK V   RL+YDV R+N   N KPE
Sbjct: 178 KIAQLRLQQDTMIQTKFNKAIKEKLEQDIETSTKARKLVEQKRLQYDVVRSNRLKNTKPE 237

Query: 233 KEASLRVQMETLEDQFAQVTEDATVCLQEVISHANFSEDLKELAKAQAEYFETSAGLMKE 292
           K+A+L+V+  T E++FA+ T+DA + + +V+  A+FS +L EL  AQ  Y ++SA +++E
Sbjct: 238 KQAALQVEESTHEEEFAKATDDAIIAMSKVVELADFSANLHELVAAQLAYHKSSAEILEE 297

Query: 293 FLS 295
            ++
Sbjct: 298 LVN 300

>Kwal_55.21227
          Length = 376

 Score = 82.4 bits (202), Expect = 2e-17,   Method: Compositional matrix adjust.
 Identities = 65/242 (26%), Positives = 113/242 (46%), Gaps = 22/242 (9%)

Query: 2   SFNAFASSLS----KKLQEISTSVS----EKTQELPSLAQSTQRMVQERLGQVTDISQLP 53
           SFN    +L+    K    +ST+++    +  Q + SL ++ +  +QE LG + DIS+LP
Sbjct: 9   SFNKLTDTLTNAAHKTQDTLSTAIANIQLDDPQAILSL-KARKHYLQETLGTIEDISKLP 67

Query: 54  REYTELEDKVDTIKLIYNHFLGVTAIYENGSYDYPKYINESVNEFSRSVASKLTELTHAT 113
            +Y  LE K D+++      L VT  +E   YDYP  ++ES++++  S    L  L  ++
Sbjct: 68  PQYQLLEKKCDSLEKACRRMLVVTKTFEVEGYDYPPNLSESLSDWWSSNKEGLFGLMSSS 127

Query: 114 SASEAQNILVAPGPIKEPKTLNYALSKVALNSSECLNKMFPTEEQ-------------PL 160
              +      A      P++   A++K A +S + L  +   E+Q             PL
Sbjct: 128 KKDKGAESAAAAKSALMPRSFAQAIAKAAKDSGDVLAALKDQEQQASADEEDEDEDITPL 187

Query: 161 ASALLQFSDVQAKIAQARIQQDTLIQTKFNKNLRERLSFEIGKADKCRKDVHSMRLRYDV 220
                 +S+ Q KI Q + + D L+  +FN+ L   +  +   A   R+ V   RL++D 
Sbjct: 188 IKMFSAWSECQYKIDQGKAEMDALMAKEFNQKLNALIEEKFKNASVLRRKVEDSRLKFDT 247

Query: 221 AR 222
            R
Sbjct: 248 MR 249

>CAGL0L08492g 929051..930208 similar to tr|Q06523 Saccharomyces
           cerevisiae YPR148c, start by similarity
          Length = 385

 Score = 69.3 bits (168), Expect = 5e-13,   Method: Compositional matrix adjust.
 Identities = 67/243 (27%), Positives = 108/243 (44%), Gaps = 26/243 (10%)

Query: 14  LQEISTSVSEKTQEL------PSLAQSTQ---RMVQERLGQVTDISQLPREYTELEDKVD 64
           L+ I+ S+SE TQ L      P    S +   R +QE +G   DIS+LP +Y  LE K D
Sbjct: 6   LESITQSISEGTQSLVQQFNDPKTKLSIKAKTRFLQEAIGNERDISKLPPQYVVLEKKCD 65

Query: 65  TIKLIYNHFLGVTAIYENGSYDYPKYINESVNEFSRSVAS-KLTELT------HAT---S 114
           +I+ +    L VT  YE   YDYP  I+ES++ + ++     ++ELT      H     +
Sbjct: 66  SIEKVLKRILIVTKTYEIEGYDYPPNISESLSSWWQTKEWFNISELTKNVIPKHGNVEKA 125

Query: 115 ASEAQNILVAPGPIKE-PKTLNYALSKVALNSS------ECLNKMFPTEEQPLASALLQF 167
            +EA   L       E P +   A+++   +S       E  ++    +   L      +
Sbjct: 126 GTEASKTLTDKEVSHEGPPSFASAIARAGKDSQLIFESIETKDEDEKEDIDELVKIFKIW 185

Query: 168 SDVQAKIAQARIQQDTLIQTKFNKNLRERLSFEIGKADKCRKDVHSMRLRYDVARTNLAN 227
           SD   +I+ ++ + D ++  +FN  L + L     K    R  V   RL +D  R  +A 
Sbjct: 186 SDCFYEISDSKTEMDQMMIKEFNVKLEDYLQKNFQKIHTLRAKVEESRLNFDTMRYEVAQ 245

Query: 228 NKK 230
             K
Sbjct: 246 TSK 248

>KLLA0E04543g 412009..413178 similar to sgd|S0006352 Saccharomyces
           cerevisiae YPR148c, start by similarity
          Length = 389

 Score = 68.6 bits (166), Expect = 1e-12,   Method: Compositional matrix adjust.
 Identities = 63/233 (27%), Positives = 98/233 (42%), Gaps = 54/233 (23%)

Query: 36  QRMVQERLGQVTDISQLPREYTELEDKVDTIKLIYNHFLGVTAIYENGSYDYPKYINESV 95
           +  +QE LG V DISQLP +Y  LE K D ++ I    L VT  +E   YDYP  + ES 
Sbjct: 47  RHQLQETLGTVHDISQLPIQYKFLEQKSDALEKICKRLLLVTKTFEVEGYDYPPNLTESF 106

Query: 96  NEFSR-------SVASKLTELTHATSASEAQNILVAPGPIKEPKTLNYALSKVALNSSEC 148
           N++         S + K  E++     + A+N L+       P++   ALSK A +S+  
Sbjct: 107 NDWWSGNKDSIFSFSKKKAEVSPEVKET-AENGLL-------PRSFAQALSKAATDSALI 158

Query: 149 LNKM------------------FPTEE---QP------------------LASALLQFSD 169
           L ++                   P EE   +P                  L  A   ++ 
Sbjct: 159 LKQLKAEETRTNQEESQEGADQKPAEETKAEPELEAEADEDEDEDEDVDNLIKAFESWTK 218

Query: 170 VQAKIAQARIQQDTLIQTKFNKNLRERLSFEIGKADKCRKDVHSMRLRYDVAR 222
            Q  I Q++ + D+L+  +FN  L + +  +  K  + R  V   RL +D  R
Sbjct: 219 CQLSIDQSKAEMDSLMVKEFNAKLSKLIETDFKKGHELRAKVQDARLNFDTLR 271

>AFR309C [3501] [Homologous to ScYPR148C - SH] (1000084..1001178)
           [1095 bp, 364 aa]
          Length = 364

 Score = 67.0 bits (162), Expect = 2e-12,   Method: Compositional matrix adjust.
 Identities = 64/263 (24%), Positives = 104/263 (39%), Gaps = 53/263 (20%)

Query: 1   MSFNAFASSLSKKLQEISTSVSEKTQELPSLAQ--------------STQRMVQERLGQV 46
           +S +  A++L+   Q+    +SE  + L    Q              + +R +QE LG  
Sbjct: 8   ISLDKLANTLNNAAQKTQQKLSETQEHLTHAIQNIKIDDPKTILSLKTRKRQLQETLGSA 67

Query: 47  TDISQLPREYTELEDKVDTIKLIYNHFLGVTAIYENGSYDYPKYINESVNEFSRSVASKL 106
            DISQLP +Y  LE K D I+ +    L V+  +E   YDYP    ES++++  +   + 
Sbjct: 68  KDISQLPPQYGFLERKCDAIEQVCKKILVVSKTFEVEGYDYPPNPTESISDWWNTSTKET 127

Query: 107 TELTHATSASEAQ---NILVAPGPIKEPKTLNYALSKVALNSS----------------- 146
             L      ++ Q       A G   +P +  +AL + A  S                  
Sbjct: 128 RFLKFGKGGTDKQKEDKQKQAAGS-SDPPSFAHALHRAAKGSQGIIQELKEQAEEEQEQE 186

Query: 147 -------ECLNKMFPTEEQPLASALLQFSDVQAKIAQARIQQDTLIQTKFNKNLRERLSF 199
                  E L KMF T           ++D Q  +  A+ + D  +  +FN+ L+  L  
Sbjct: 187 VEIDEDVESLIKMFGT-----------WADAQYNMDIAKREMDQFMVKEFNEKLKHLLEV 235

Query: 200 EIGKADKCRKDVHSMRLRYDVAR 222
           E  K    R+ V   RL +D  +
Sbjct: 236 EFKKGHTLRRKVEESRLTFDTLK 258

>Scas_676.18
          Length = 444

 Score = 64.3 bits (155), Expect = 3e-11,   Method: Compositional matrix adjust.
 Identities = 59/246 (23%), Positives = 107/246 (43%), Gaps = 36/246 (14%)

Query: 4   NAFASSLSKKLQEISTSVSEKTQELPSLA-QSTQRMVQERLGQVTDISQLPREYTELEDK 62
           N+ A++  K    +S +++  T     L+ +S +R+ QE +G V DIS LP +YT LE +
Sbjct: 12  NSLATAAQKTSDTLSNAITTATDPATKLSLRSQKRLFQESIGTVHDISTLPEQYTTLEAR 71

Query: 63  VDTIKLIYNHFLGVTAIYENGSYDYPKYINESVNEFSRSVASKLTELTHATSASEAQNIL 122
            D ++      L V+  +E   YDYP  ++ES +++           + ++   + Q   
Sbjct: 72  TDALEKCLRRILIVSKTFEMEGYDYPPNLSESFSDW----------WSLSSKKKKEQEKE 121

Query: 123 VAPGPIKEPKTLNYALSKVALNSSECLNKMFPTEEQPLASA------------------- 163
              G +  P++   A+S  A +  E    +   +++                        
Sbjct: 122 DKKGFL--PRSFAQAISNSAEDCVEIYQHVNDGDDEDKEENANNEEENEEEDEEDEDVKN 179

Query: 164 LLQFSDVQAK----IAQARIQQDTLIQTKFNKNLRERLSFEIGKADKCRKDVHSMRLRYD 219
           L++  D  AK    I Q + + D+++  +FN  L + L+ E  K    RK V   RL++D
Sbjct: 180 LIKTFDSWAKCYKNIDQGKAEMDSMMMKEFNAKLEKLLNEEFKKVHTLRKRVKDSRLKFD 239

Query: 220 VARTNL 225
             R  L
Sbjct: 240 TVRYEL 245

>YPR148C (YPR148C) [5564] chr16 complement(826827..828134) Protein
           of unknown function [1308 bp, 435 aa]
          Length = 435

 Score = 57.4 bits (137), Expect = 5e-09,   Method: Compositional matrix adjust.
 Identities = 27/66 (40%), Positives = 42/66 (63%)

Query: 33  QSTQRMVQERLGQVTDISQLPREYTELEDKVDTIKLIYNHFLGVTAIYENGSYDYPKYIN 92
           +S  R VQE LG V+DIS+LP +Y  LE K D+++ +    L V+  +E   YDYP  + 
Sbjct: 49  KSRTRFVQESLGTVSDISKLPPQYQFLEKKSDSLEKVCKRILLVSKTFEVEGYDYPPNLT 108

Query: 93  ESVNEF 98
           ES++++
Sbjct: 109 ESISDW 114

 Score = 31.6 bits (70), Expect = 0.77,   Method: Compositional matrix adjust.
 Identities = 15/56 (26%), Positives = 28/56 (50%)

Query: 167 FSDVQAKIAQARIQQDTLIQTKFNKNLRERLSFEIGKADKCRKDVHSMRLRYDVAR 222
           +S     I + + + D+++  +FNK L   ++ +  K    RK V   RL++D  R
Sbjct: 221 WSTCYKNIDEGKAEMDSMMVKEFNKKLETLINQDFKKVHDLRKKVEESRLKFDTMR 276

>KLLA0C10692g complement(916718..918280) weakly similar to sp|P21147
           Saccharomyces cerevisiae YGL055w OLE1 stearoyl-CoA
           desaturase singleton, hypothetical start
          Length = 520

 Score = 32.3 bits (72), Expect = 0.56,   Method: Compositional matrix adjust.
 Identities = 36/136 (26%), Positives = 53/136 (38%), Gaps = 28/136 (20%)

Query: 9   SLSKKLQEISTSVSEKTQELPSLAQSTQRMVQE---RLGQVTDISQLPR----------- 54
           +L+K L  +ST   EK      L Q  Q+M+ E   RL     I +LPR           
Sbjct: 346 NLAKNLHTVSTEQIEK-----CLVQQQQKMIDEESARLKWGIPIERLPRMTSLQFVKLAK 400

Query: 55  --------EYTELEDKV-DTIKLIYNHFLGVTAIYENGSYDYPKYINESVNEFSRSVASK 105
                    Y  +E  V D    IY+H  GVT +  +   D  +  N +V   S +  + 
Sbjct: 401 DEYIKNRKAYVAIEGIVHDVTPFIYDHPGGVTLVETSIGKDATQAFNGAVYRHSNAARNL 460

Query: 106 LTELTHATSASEAQNI 121
           L  +  A    ++ NI
Sbjct: 461 LATMRVAVITDQSSNI 476

>Kwal_56.22618
          Length = 740

 Score = 31.6 bits (70), Expect = 1.1,   Method: Compositional matrix adjust.
 Identities = 19/60 (31%), Positives = 31/60 (51%), Gaps = 7/60 (11%)

Query: 45  QVTDISQLPREYTELEDKVDTIKL-----IYNHFLGVTAIYENGSYDYPKYINESVNEFS 99
           Q   I Q P++Y  LED+ D++++      Y +FL    +    S+D  K  N ++ EFS
Sbjct: 293 QYKSIYQTPKDYVALEDQFDSLEVNKNSKTYLNFLNTIELLNGSSHDLSK--NHTLVEFS 350

>AFR342C [3534] [Homologous to ScYDR496C (PUF6) - SH]
           (1058347..1060296) [1950 bp, 649 aa]
          Length = 649

 Score = 29.3 bits (64), Expect = 4.6,   Method: Compositional matrix adjust.
 Identities = 25/87 (28%), Positives = 37/87 (42%), Gaps = 12/87 (13%)

Query: 60  EDKVDTIKLIYNHFLG-VTAIYENGSY----------DYPKYINES-VNEFSRSVASKLT 107
           E  V+   +I  + +G +TA  E GS           +Y K  NE  ++EF   V     
Sbjct: 277 EASVEKRNIIARNLIGTITASVEKGSTGFQILHAAMGEYIKICNEKEISEFIELVHEHFA 336

Query: 108 ELTHATSASEAQNILVAPGPIKEPKTL 134
           EL H    +E   +L+A    KE K +
Sbjct: 337 ELVHTPEGAEVACVLIARASAKERKAI 363

  Database: blastdb
    Posted date:  Apr 3, 2006  3:33 PM
  Number of letters in database: 16,596,109
  Number of sequences in database:  34,618
  
Lambda     K      H
   0.312    0.125    0.327 

Gapped
Lambda     K      H
   0.267   0.0410    0.140 

Matrix: BLOSUM62
Gap Penalties: Existence: 11, Extension: 1
Number of Sequences: 34618
Number of Hits to DB: 8,872,110
Number of extensions: 355814
Number of successful extensions: 1463
Number of sequences better than 10.0: 75
Number of HSP's gapped: 1434
Number of HSP's successfully gapped: 82
Length of query: 321
Length of database: 16,596,109
Length adjustment: 102
Effective length of query: 219
Effective length of database: 13,065,073
Effective search space: 2861250987
Effective search space used: 2861250987
Neighboring words threshold: 11
Window for multiple hits: 40
X1: 16 ( 7.2 bits)
X2: 38 (14.6 bits)
X3: 64 (24.7 bits)
S1: 42 (21.9 bits)
S2: 61 (28.1 bits)