Hit NameLength (aa)HSP LengthHSP ScoreHSP Significance
YHR135C (YCK1)53852921850.0
Scas_654.1752344717000.0
YNL154C (YCK2)54632716780.0
CAGL0G06138g53945016720.0
Kwal_33.1459650032716360.0
AFR040W54737116320.0
Scas_697.1252938816040.0
CAGL0J05940g48637315950.0
KLLA0D11044g53632716000.0
Scas_627.447533711761e-157
ADL053C47134011451e-153
YER123W (YCK3)52435511441e-152
Kwal_47.1731442135111231e-150
CAGL0K02299g53836211341e-150
KLLA0E13563g47334011241e-149
Sklu_2359.348835911241e-149
KLLA0D03168g5052938211e-103
AFL091W4782938121e-102
Kwal_56.240644752938101e-102
CAGL0H03553g4952938101e-102
Scas_720.244732918071e-102
Sklu_1892.34742938051e-101
YPL204W (HRR25)4942938001e-100
Scas_690.124882896893e-84
KLLA0C08525g15512221854e-14
AAR009W4532131772e-13
Scas_618.84272131762e-13
AER264C14832321756e-13
Kwal_26.735514462271747e-13
Kwal_23.632515422321702e-12
Sklu_2429.54322151637e-12
YJL095W (BCK1)14782731668e-12
Kwal_0.964272151583e-11
CAGL0L03520g14472291613e-11
YDR490C (PKH1)7662421542e-10
Scas_711.2515152841542e-10
Kwal_56.240593532321512e-10
YCR073C (SSK22)13312371533e-10
YFR014C (CMK1)4462161504e-10
KLLA0F14190g13382221514e-10
KLLA0E03487g6472301504e-10
YOR233W (KIN4)8002211505e-10
YPL203W (TPK2)3802321476e-10
AFL101C3672151477e-10
Sklu_2436.147841221471e-09
CAGL0F04741g4422111461e-09
KLLA0F13552g12672181471e-09
CAGL0K08514g14892511472e-09
AEL284C4792391452e-09
AFL090W3462281432e-09
Scas_660.209572271452e-09
YOL016C (CMK2)4472151433e-09
AFR092W14232221453e-09
Kwal_26.778812672181434e-09
YGL158W (RCK1)5122481424e-09
KLLA0D03190g3722281404e-09
Kwal_33.138463752281404e-09
KLLA0B02332g3612181405e-09
YPL141C8652661425e-09
Scas_720.9416832941426e-09
KLLA0F23155g4272151397e-09
YHR102W (KIC1)10802221417e-09
AFR335C10332321391e-08
Sklu_2437.1610712541391e-08
Scas_613.55172391371e-08
CAGL0L07326g5062391372e-08
KLLA0F16467g3401591352e-08
YOL100W (PKH2)10812391382e-08
Scas_502.211162491382e-08
Kwal_47.183076211231372e-08
CAGL0J03872g6612251362e-08
YPL153C (RAD53)8212381362e-08
Scas_673.20*7582231363e-08
Kwal_56.226939843031363e-08
Scas_660.286231591343e-08
YGR052W3692201334e-08
ABL034W14252201354e-08
AFL188C4722391344e-08
CAGL0M08910g6121591344e-08
Kwal_26.87098292241345e-08
YHR205W (SCH9)8241241345e-08
YDR477W (SNF1)6331591335e-08
CAGL0K10604g4462141335e-08
CAGL0K03399g7032301335e-08
YNR031C (SSK2)15792531346e-08
CAGL0G04609g9652421337e-08
Kwal_26.76356912271327e-08
Scas_689.25*4092131308e-08
AFR377C7262291328e-08
Kwal_47.182335981581318e-08
CAGL0K06479g9912441329e-08
Kwal_14.12734152811309e-08
YDR466W (PKH3)8981321311e-07
CAGL0M08404g4622281301e-07
CAGL0L11550g10722301311e-07
CAGL0G09020g3612291281e-07
CAGL0I07513g10762611301e-07
ADR058C2952061271e-07
KLLA0B12716g7162301301e-07
CAGL0F09075g7461241291e-07
YKL166C (TPK3)3982281281e-07
YJL164C (TPK1)3972331282e-07
Kwal_47.167617441241292e-07
AEL230W6081581292e-07
Scas_690.133542321272e-07
Sklu_2104.12992061262e-07
ABL028W7222281292e-07
YKL101W (HSL1)15182491292e-07
Sklu_2430.57332281282e-07
Kwal_26.87967962251282e-07
Scas_703.57491241282e-07
Scas_616.1014612521283e-07
KLLA0E21780g10162271273e-07
Kwal_55.215458652231273e-07
CAGL0I09504g5282231263e-07
ADL389W7111241264e-07
KLLA0B03586g7341241264e-07
Scas_700.546982281264e-07
Kwal_33.139846491821254e-07
CAGL0I05896g7781841255e-07
Kwal_27.119192092061205e-07
YPL209C (IPL1)3672091235e-07
CAGL0B04301g5421601246e-07
KLLA0A03806g6021581246e-07
CAGL0M02233g7672341247e-07
Scas_721.462962071218e-07
KLLA0E01584g4152431221e-06
KLLA0C12485g9252331231e-06
YBR028C5251471221e-06
YBR274W (CHK1)5271091221e-06
Sklu_1843.34861271211e-06
KLLA0B07205g4552281211e-06
Sklu_2232.23741591201e-06
Scas_580.610152221221e-06
CAGL0K07458g7041411211e-06
CAGL0M08316g9641931211e-06
ACL191C3651601192e-06
Kwal_14.115915211541212e-06
KLLA0F24618g5561351202e-06
CAGL0H07535g2982091182e-06
CAGL0K04301g3552371192e-06
YJL141C (YAK1)8071841202e-06
CAGL0C05005g10762171212e-06
Scas_717.696742281202e-06
Scas_721.1246842351202e-06
ADR204W3391581182e-06
ADL283W3061671172e-06
KLLA0F09020g9282011202e-06
Scas_651.183712281183e-06
CAGL0K12562g16821851193e-06
YOR061W (CKA2)3391531173e-06
CAGL0G02035g3391521173e-06
Scas_700.348642311193e-06
YHL007C (STE20)9392051193e-06
KLLA0B09790g2952071164e-06
ABR014W9712091184e-06
Scas_640.14*7282231184e-06
ACR249C6431861174e-06
ACR142W8372311184e-06
ABL011C7012351174e-06
Kwal_56.240913811171164e-06
AEL115C3861071164e-06
YKL171W9281661175e-06
CAGL0J03828g4672171156e-06
Kwal_23.35904992401156e-06
ACR218W15691541176e-06
KLLA0B13607g9892141166e-06
CAGL0J06072g7731521166e-06
Scas_201.1*2742041136e-06
KLLA0F11143g8132291167e-06
YKL126W (YPK1)6801241157e-06
KLLA0D08415g7741391158e-06
YMR104C (YPK2)6771231158e-06
Scas_707.315981541159e-06
YNL161W (CBK1)7561541141e-05
YOR231W (MKK1)5081321141e-05
Scas_683.123562251131e-05
Scas_675.25272171141e-05
YGL179C (TOS3)5602401131e-05
Sklu_2392.68081581131e-05
AFR035W7191541131e-05
CAGL0E05720g3582151121e-05
AEL083W5361351121e-05
YDL101C (DUN1)5132391121e-05
CAGL0H10318g3071591111e-05
CAGL0M10153g8671421132e-05
Kwal_33.145547141581122e-05
KLLA0E14828g3101881102e-05
KLLA0A05819g7041841122e-05
CAGL0B02739g6762351122e-05
YDL214C (PRR2)6991281112e-05
Scas_648.173401521102e-05
Kwal_55.217093401521102e-05
CAGL0M02519g7562371112e-05
Kwal_55.203267502401112e-05
ACR117W5241271102e-05
YDL159W (STE7)5151191103e-05
AEL120W7731821113e-05
Scas_698.373471541093e-05
Kwal_33.144347591381103e-05
CAGL0K02673g9151301103e-05
KLLA0E12177g4551641093e-05
Kwal_26.78619552121103e-05
ACR133C8512251104e-05
CAGL0M02299g8932241104e-05
Sklu_1995.27292411094e-05
YMR139W (RIM11)3701641084e-05
YPL140C (MKK2)5061271094e-05
YBR160W (CDC28)2982101074e-05
CAGL0F03245g10362501104e-05
Scas_667.184371701084e-05
Kwal_14.24974181231085e-05
YOR351C (MEK1)4972001085e-05
Scas_668.228932051085e-05
Scas_623.113781651075e-05
KLLA0D07304g4651271075e-05
Scas_654.127371541086e-05
ACL104C9472191086e-05
YFL033C (RIM15)17701781086e-05
KLLA0B13112g7302411076e-05
ACR119W9312221087e-05
Sklu_2366.54661081077e-05
ADL315C4342311068e-05
KLLA0D07810g7181511078e-05
KLLA0D07348g9092171078e-05
Scas_640.165051331069e-05
Kwal_23.64588681231079e-05
Kwal_14.14163651561059e-05
Sklu_2417.133631651059e-05
KLLA0F01276g5192151061e-04
Sklu_2186.45211651061e-04
ABL143C7252231061e-04
CAGL0L06820g3661641051e-04
YAR019C (CDC15)9742191061e-04
Scas_713.216411381051e-04
Scas_651.37931821051e-04
KLLA0F01507g4721201051e-04
Scas_689.229011661051e-04
Scas_593.14d4951541051e-04
Scas_627.73491101041e-04
CAGL0I03498g451941041e-04
KLLA0F20053g4442021041e-04
YPL031C (PHO85)3052121031e-04
Kwal_27.98044731751042e-04
ADR379C4922031042e-04
Scas_655.28001381042e-04
Sklu_2323.34001061032e-04
YLR113W (HOG1)4351611032e-04
YMR216C (SKY1)7421781042e-04
Kwal_0.1555872601032e-04
BLASTP 2.2.26 [Sep-21-2011]

Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, 
Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), 
"Gapped BLAST and PSI-BLAST: a new generation of protein database search
programs",  Nucleic Acids Res. 25:3389-3402.

Reference for compositional score matrix adjustment: Altschul, Stephen F., 
John C. Wootton, E. Michael Gertz, Richa Agarwala, Aleksandr Morgulis,
Alejandro A. Schaffer, and Yi-Kuo Yu (2005) "Protein database searches
using compositionally adjusted substitution matrices", FEBS J. 272:5101-5109.

Query= YHR135C
         (529 letters)

Database: blastdb 
           34,618 sequences; 16,596,109 total letters

Searching..................................................done

                                                                 Score    E
Sequences producing significant alignments:                      (bits) Value

YHR135C (YCK1) [2422] chr8 complement(372695..374311) Casein kin...   846   0.0  
Scas_654.17                                                           659   0.0  
YNL154C (YCK2) [4443] chr14 complement(343636..345276) Casein ki...   650   0.0  
CAGL0G06138g complement(585585..587204) similar to sp|P23291 Sac...   648   0.0  
Kwal_33.14596                                                         634   0.0  
AFR040W [3232] [Homologous to ScYHR135C (YCK1) - SH; ScYNL154C (...   633   0.0  
Scas_697.12                                                           622   0.0  
CAGL0J05940g 560563..562023 similar to sp|P23291 Saccharomyces c...   619   0.0  
KLLA0D11044g complement(942458..944068) gi|730472|sp|P40230|RAG8...   620   0.0  
Scas_627.4                                                            457   e-157
ADL053C [1688] [Homologous to ScYER123W (YCK3) - SH] (589602..59...   445   e-153
YER123W (YCK3) [1553] chr5 (404809..406383) Casein kinase I isof...   445   e-152
Kwal_47.17314                                                         437   e-150
CAGL0K02299g complement(205332..206948) similar to sp|P39962 Sac...   441   e-150
KLLA0E13563g 1193481..1194902 some similarities with sp|P39962 S...   437   e-149
Sklu_2359.3 YER123W, Contig c2359 7455-8921 reverse complement        437   e-149
KLLA0D03168g 265761..267278 some similarities with sp|P29295 Sac...   320   e-103
AFL091W [3102] [Homologous to ScYPL204W (HRR25) - SH] complement...   317   e-102
Kwal_56.24064                                                         316   e-102
CAGL0H03553g complement(328668..330155) highly similar to sp|P29...   316   e-102
Scas_720.24                                                           315   e-102
Sklu_1892.3 YPL204W, Contig c1892 5770-7194                           314   e-101
YPL204W (HRR25) [5244] chr16 (164275..165759) Casein kinase I (s...   312   e-100
Scas_690.12                                                           270   3e-84
KLLA0C08525g 744554..749209 similar to sp|P53599 Saccharomyces c...    76   4e-14
AAR009W [195] [Homologous to ScYOL016C (CMK2) - SH; ScYFR014C (C...    73   2e-13
Scas_618.8                                                             72   2e-13
AER264C [2766] [Homologous to ScYCR073C (SSK22) - SH; ScYNR031C ...    72   6e-13
Kwal_26.7355                                                           72   7e-13
Kwal_23.6325                                                           70   2e-12
Sklu_2429.5 YOL016C, Contig c2429 9000-10298 reverse complement        67   7e-12
YJL095W (BCK1) [2820] chr10 (247171..251607) Serine/threonine pr...    69   8e-12
Kwal_0.96                                                              65   3e-11
CAGL0L03520g complement(401103..405446) similar to sp|Q01389 Sac...    67   3e-11
YDR490C (PKH1) [1306] chr4 complement(1431956..1434256) Serine/t...    64   2e-10
Scas_711.25                                                            64   2e-10
Kwal_56.24059                                                          63   2e-10
YCR073C (SSK22) [598] chr3 complement(242584..246579) Map kinase...    64   3e-10
YFR014C (CMK1) [1695] chr6 complement(172529..173869) Calcium/ca...    62   4e-10
KLLA0F14190g 1311121..1315137 gi|3021329|emb|CAA06336.1 Kluyvero...    63   4e-10
KLLA0E03487g complement(323764..325707) similar to sgd|S0002874 ...    62   4e-10
YOR233W (KIN4) [5024] chr15 (775846..778248) Serine/threonine pr...    62   5e-10
YPL203W (TPK2) [5245] chr16 (166255..167397) Catalytic subunit o...    61   6e-10
AFL101C [3094] [Homologous to ScYPL209C (IPL1) - SH] (249144..25...    61   7e-10
Sklu_2436.14 YDR466W, Contig c2436 31299-33653                         61   1e-09
CAGL0F04741g 478256..479584 similar to sp|P22517 Saccharomyces c...    61   1e-09
KLLA0F13552g complement(1252906..1256709) gi|33386566|emb|CAD877...    61   1e-09
CAGL0K08514g complement(853314..857783) similar to sp|P34244 Sac...    61   2e-09
AEL284C [2221] [Homologous to ScYGR052W - SH] (106480..107919) [...    60   2e-09
AFL090W [3103] [Homologous to ScYPL203W (TPK2) - SH] complement(...    60   2e-09
Scas_660.20                                                            60   2e-09
YOL016C (CMK2) [4800] chr15 complement(294777..296120) Calcium/c...    60   3e-09
AFR092W [3284] [Homologous to ScYJL095W (BCK1) - SH] complement(...    60   3e-09
Kwal_26.7788                                                           60   4e-09
YGL158W (RCK1) [1831] chr7 (207036..208574) Serine/threonine pro...    59   4e-09
KLLA0D03190g 267933..269051 highly similar to sp|P06245 Saccharo...    59   4e-09
Kwal_33.13846                                                          59   4e-09
KLLA0B02332g complement(206863..207948) similar to sp|P38991 Sac...    59   5e-09
YPL141C (YPL141C) [5305] chr16 complement(283463..286060) Serine...    59   5e-09
Scas_720.94                                                            59   6e-09
KLLA0F23155g 2157146..2158429 similar to sp|P22517 Saccharomyces...    58   7e-09
YHR102W (KIC1) [2390] chr8 (316574..319816) Serine/threonine pro...    59   7e-09
AFR335C [3527] [Homologous to ScYOL100W (PKH2) - SH; ScYDR490C (...    58   1e-08
Sklu_2437.16 YOL100W, Contig c2437 35714-38929 reverse complement      58   1e-08
Scas_613.5                                                             57   1e-08
CAGL0L07326g 808532..810052 similar to sp|P39009 Saccharomyces c...    57   2e-08
KLLA0F16467g 1519800..1520822 highly similar to sp|P19454 Saccha...    57   2e-08
YOL100W (PKH2) [4721] chr15 (129236..132481) Serine/threonine pr...    58   2e-08
Scas_502.2                                                             58   2e-08
Kwal_47.18307                                                          57   2e-08
CAGL0J03872g 365869..367854 similar to sp|Q01919 Saccharomyces c...    57   2e-08
YPL153C (RAD53) [5294] chr16 complement(261726..264191) Serine/t...    57   2e-08
Scas_673.20*                                                           57   3e-08
Kwal_56.22693                                                          57   3e-08
Scas_660.28                                                            56   3e-08
YGR052W (YGR052W) [2015] chr7 (593598..594707) Serine/threonine ...    56   4e-08
ABL034W [558] [Homologous to ScYKL101W (HSL1) - SH] complement(3...    57   4e-08
AFL188C [3007] [Homologous to ScYDL101C (DUN1) - SH] (88793..902...    56   4e-08
CAGL0M08910g complement(887703..889541) highly similar to sp|Q00...    56   4e-08
Kwal_26.8709                                                           56   5e-08
YHR205W (SCH9) [2490] chr8 (509361..511835) Serine/threonine pro...    56   5e-08
YDR477W (SNF1) [1293] chr4 (1412361..1414262) Serine/threonine p...    56   5e-08
CAGL0K10604g complement(1029226..1030566) similar to sp|P27466 S...    56   5e-08
CAGL0K03399g complement(310487..312598) highly similar to sp|P12...    56   5e-08
YNR031C (SSK2) [4613] chr14 complement(680693..685432) MAP kinas...    56   6e-08
CAGL0G04609g complement(437162..440059) similar to sp|Q12236 Sac...    56   7e-08
Kwal_26.7635                                                           55   7e-08
Scas_689.25*                                                           55   8e-08
AFR377C [3569] [Homologous to ScYDR466W - SH] (1116595..1118775)...    55   8e-08
Kwal_47.18233                                                          55   8e-08
CAGL0K06479g 636296..639271 some similarities with tr|Q03306 Sac...    55   9e-08
Kwal_14.1273                                                           55   9e-08
YDR466W (PKH3) [1284] chr4 (1395109..1397805) Serine/threonine p...    55   1e-07
CAGL0M08404g complement(836791..838179) some similarities with s...    55   1e-07
CAGL0L11550g 1229719..1232937 similar to sp|P38692 Saccharomyces...    55   1e-07
CAGL0G09020g 860266..861351 highly similar to sp|P06245 Saccharo...    54   1e-07
CAGL0I07513g 721775..725005 similar to sp|Q12236 Saccharomyces c...    55   1e-07
ADR058C [1799] [Homologous to ScYBR160W (CDC28) - SH] (810941..8...    54   1e-07
KLLA0B12716g 1109939..1112089 similar to sp|P12688 Saccharomyces...    55   1e-07
CAGL0F09075g 894761..897001 similar to sp|P11792 Saccharomyces c...    54   1e-07
YKL166C (TPK3) [3104] chr11 complement(134514..135710) Catalytic...    54   1e-07
YJL164C (TPK1) [2757] chr10 complement(109959..111152) Catalytic...    54   2e-07
Kwal_47.16761                                                          54   2e-07
AEL230W [2276] [Homologous to ScYDR477W (SNF1) - SH] complement(...    54   2e-07
Scas_690.13                                                            54   2e-07
Sklu_2104.1 YBR160W, Contig c2104 694-1593                             53   2e-07
ABL028W [564] [Homologous to ScYKL126W (YPK1) - SH; ScYMR104C (Y...    54   2e-07
YKL101W (HSL1) [3161] chr11 (248566..253122) Serine/threonine pr...    54   2e-07
Sklu_2430.5 YKL126W, Contig c2430 8144-10345                           54   2e-07
Kwal_26.8796                                                           54   2e-07
Scas_703.5                                                             54   2e-07
Scas_616.10                                                            54   3e-07
KLLA0E21780g complement(1936438..1939488) similar to sp|P38692 S...    54   3e-07
Kwal_55.21545                                                          54   3e-07
CAGL0I09504g 909319..910905 similar to sp|P38147 Saccharomyces c...    53   3e-07
ADL389W [1352] [Homologous to ScYHR205W (SCH9) - SH] complement(...    53   4e-07
KLLA0B03586g complement(326871..329075) similar to sp|P11792 Sac...    53   4e-07
Scas_700.54                                                            53   4e-07
Kwal_33.13984                                                          53   4e-07
CAGL0I05896g 560169..562505 some similarities with sp|P14680 Sac...    53   5e-07
Kwal_27.11919                                                          51   5e-07
YPL209C (IPL1) [5240] chr16 complement(156489..157592) Serine/th...    52   5e-07
CAGL0B04301g 420544..422172 similar to sp|P38070 Saccharomyces c...    52   6e-07
KLLA0A03806g complement(338807..340615) gi|2181934|emb|CAA61235....    52   6e-07
CAGL0M02233g complement(267332..269635) highly similar to sp|P22...    52   7e-07
Scas_721.46                                                            51   8e-07
KLLA0E01584g 149713..150960 highly similar to sp|P39009 Saccharo...    52   1e-06
KLLA0C12485g 1060167..1062944 weakly similar to sp|Q12236 Saccha...    52   1e-06
YBR028C (YBR028C) [220] chr2 complement(294387..295964) Serine/t...    52   1e-06
YBR274W (CHK1) [453] chr2 (749551..751134) Checkpoint kinase, re...    52   1e-06
Sklu_1843.3 YOR231W, Contig c1843 2632-4092 reverse complement         51   1e-06
KLLA0B07205g complement(624606..625973) some similarities with s...    51   1e-06
Sklu_2232.2 YOR061W, Contig c2232 1216-2340 reverse complement         51   1e-06
Scas_580.6                                                             52   1e-06
CAGL0K07458g complement(736336..738450) similar to sp|P12688 Sac...    51   1e-06
CAGL0M08316g 829069..831963 weakly similar to sp|P36003 Saccharo...    51   1e-06
ACL191C [858] [Homologous to ScYGR040W (KSS1) - SH] (26475..2757...    50   2e-06
Kwal_14.1159                                                           51   2e-06
KLLA0F24618g complement(2288943..2290613) similar to sp|P38070 S...    51   2e-06
CAGL0H07535g 736241..737137 highly similar to sp|P00546 Saccharo...    50   2e-06
CAGL0K04301g 404419..405486 similar to sp|P53233 Saccharomyces c...    50   2e-06
YJL141C (YAK1) [2777] chr10 complement(147885..150308) Serine/th...    51   2e-06
CAGL0C05005g complement(467626..470856) similar to sp|P27636 Sac...    51   2e-06
Scas_717.69                                                            51   2e-06
Scas_721.124                                                           51   2e-06
ADR204W [1945] [Homologous to ScYOR061W (CKA2) - SH] complement(...    50   2e-06
ADL283W [1458] [Homologous to ScYDL108W (KIN28) - SH] complement...    50   2e-06
KLLA0F09020g 836287..839073 weakly similar to sp|P43565 Saccharo...    51   2e-06
Scas_651.18                                                            50   3e-06
CAGL0K12562g 1234866..1239914 similar to sp|P43565 Saccharomyces...    50   3e-06
YOR061W (CKA2) [4869] chr15 (441535..442554) Casein kinase II (P...    50   3e-06
CAGL0G02035g 179911..180930 highly similar to sp|P19454 Saccharo...    50   3e-06
Scas_700.34                                                            50   3e-06
YHL007C (STE20) [2279] chr8 complement(95113..97932) Serine/thre...    50   3e-06
KLLA0B09790g complement(855327..856214) highly similar to sp|P00...    49   4e-06
ABR014W [605] [Homologous to ScYHL007C (STE20) - SH] complement(...    50   4e-06
Scas_640.14*                                                           50   4e-06
ACR249C [1296] [Homologous to ScYJL141C (YAK1) - SH] (797020..79...    50   4e-06
ACR142W [1189] [Homologous to ScYPL153C (RAD53) - SH] complement...    50   4e-06
ABL011C [581] [Homologous to ScYLR362W (STE11) - SH] (378259..38...    50   4e-06
Kwal_56.24091                                                          49   4e-06
AEL115C [2391] [Homologous to ScYKL166C (TPK3) - SH; ScYJL164C (...    49   4e-06
YKL171W (YKL171W) [3100] chr11 (127480..130266) Serine/threonine...    50   5e-06
CAGL0J03828g 362722..364125 similar to sp|P32490 Saccharomyces c...    49   6e-06
Kwal_23.3590                                                           49   6e-06
ACR218W [1265] [Homologous to ScYFL033C (RIM15) - SH] complement...    50   6e-06
KLLA0B13607g 1191592..1194561 weakly similar to sp|Q03497 Saccha...    49   6e-06
CAGL0J06072g complement(572377..574698) similar to sp|P53894 Sac...    49   6e-06
Scas_201.1*                                                            48   6e-06
KLLA0F11143g complement(1026129..1028570) similar to sp|P22216 S...    49   7e-06
YKL126W (YPK1) [3140] chr11 (205353..207395) Serine/threonine pr...    49   7e-06
KLLA0D08415g 714473..716797 similar to sp|P22211 Saccharomyces c...    49   8e-06
YMR104C (YPK2) [4061] chr13 complement(473419..475452) Serine/th...    49   8e-06
Scas_707.3                                                             49   9e-06
YNL161W (CBK1) [4436] chr14 (332597..334867) Serine/threonine pr...    49   1e-05
YOR231W (MKK1) [5022] chr15 (772601..774127) Serine/threonine pr...    49   1e-05
Scas_683.12                                                            48   1e-05
Scas_675.2                                                             49   1e-05
YGL179C (TOS3) [1812] chr7 complement(163413..165095) Serine/thr...    48   1e-05
Sklu_2392.6 YNL161W, Contig c2392 12867-15293 reverse complement       48   1e-05
AFR035W [3227] [Homologous to ScYNL161W (CBK1) - SH] complement(...    48   1e-05
CAGL0E05720g 569028..570104 similar to sp|P38991 Saccharomyces c...    48   1e-05
AEL083W [2423] [Homologous to ScYBR028C - SH] complement(470964....    48   1e-05
YDL101C (DUN1) [768] chr4 complement(280307..281848) Protein kin...    48   1e-05
CAGL0H10318g complement(1006299..1007222) highly similar to sp|P...    47   1e-05
CAGL0M10153g complement(1010688..1013291) some similarities with...    48   2e-05
Kwal_33.14554                                                          48   2e-05
KLLA0E14828g complement(1323743..1324675) gi|27526973|emb|CAD369...    47   2e-05
KLLA0A05819g 541545..543659 similar to sp|P14680 Saccharomyces c...    48   2e-05
CAGL0B02739g complement(262590..264620) similar to sp|P23561 Sac...    48   2e-05
YDL214C (PRR2) [660] chr4 complement(74447..76546) Serine/threon...    47   2e-05
Scas_648.17                                                            47   2e-05
Kwal_55.21709                                                          47   2e-05
CAGL0M02519g complement(290723..292993) highly similar to tr|Q03...    47   2e-05
Kwal_55.20326                                                          47   2e-05
ACR117W [1164] [Homologous to ScYOR231W (MKK1) - SH; ScYPL140C (...    47   2e-05
YDL159W (STE7) [712] chr4 (172482..174029) Serine/threonine/tyro...    47   3e-05
AEL120W [2386] [Homologous to ScYKL171W - SH] complement(396394....    47   3e-05
Scas_698.37                                                            47   3e-05
Kwal_33.14434                                                          47   3e-05
CAGL0K02673g complement(240509..243256) similar to sp|Q03497 Sac...    47   3e-05
KLLA0E12177g 1080245..1081612 gi|4096112|gb|AAC99804.1 Kluyverom...    47   3e-05
Kwal_26.7861                                                           47   3e-05
ACR133C [1180] [Homologous to ScYPL150W - SH] (581468..584023) [...    47   4e-05
CAGL0M02299g 273725..276406 similar to tr|Q12152 Saccharomyces c...    47   4e-05
Sklu_1995.2 YLR362W, Contig c1995 1578-3767                            47   4e-05
YMR139W (RIM11) [4096] chr13 (546124..547236) Member of the GSK3...    46   4e-05
YPL140C (MKK2) [5306] chr16 complement(287513..289033) MAP kinas...    47   4e-05
YBR160W (CDC28) [345] chr2 (560034..560930) Cyclin-dependent pro...    46   4e-05
CAGL0F03245g complement(316924..320034) similar to sp|P32361 Sac...    47   4e-05
Scas_667.18                                                            46   4e-05
Kwal_14.2497                                                           46   5e-05
YOR351C (MEK1) [5128] chr15 complement(995013..996506) Serine/th...    46   5e-05
Scas_668.22                                                            46   5e-05
Scas_623.11                                                            46   5e-05
KLLA0D07304g 623352..624749 some similarities with sp|P32491 Sac...    46   5e-05
Scas_654.12                                                            46   6e-05
ACL104C [945] [Homologous to ScYHR102W (KIC1) - SH] (157357..160...    46   6e-05
YFL033C (RIM15) [1651] chr6 complement(69113..74425) Serine/thre...    46   6e-05
KLLA0B13112g complement(1146006..1148198) similar to sp|P23561 S...    46   6e-05
ACR119W [1166] [Homologous to ScYPL141C - SH; ScYOR233W (KIN4) -...    46   7e-05
Sklu_2366.5 YBR274W, Contig c2366 12866-14266 reverse complement       46   7e-05
ADL315C [1426] [Homologous to ScYPR054W (SMK1) - SH] (146098..14...    45   8e-05
KLLA0D07810g complement(669095..671251) gi|401646|sp|P31034|YL44...    46   8e-05
KLLA0D07348g 626999..629728 weakly similar to sgd|S0006062 Sacch...    46   8e-05
Scas_640.16                                                            45   9e-05
Kwal_23.6458                                                           46   9e-05
Kwal_14.1416                                                           45   9e-05
Sklu_2417.13 YMR139W, Contig c2417 24824-25915 reverse complement      45   9e-05
KLLA0F01276g complement(120001..121560) similar to sp|P38147 Sac...    45   1e-04
Sklu_2186.4 YHR030C, Contig c2186 5713-7278 reverse complement         45   1e-04
ABL143C [449] [Homologous to ScYNL183C (NPR1) - SH; ScYDL214C (P...    45   1e-04
CAGL0L06820g 767038..768138 highly similar to sp|P38615 Saccharo...    45   1e-04
YAR019C (CDC15) [74] chr1 complement(172211..175135) MAP kinase ...    45   1e-04
Scas_713.21                                                            45   1e-04
Scas_651.3                                                             45   1e-04
KLLA0F01507g 144356..145774 some similarities with sp|P47042 Sac...    45   1e-04
Scas_689.22                                                            45   1e-04
Scas_593.14d                                                           45   1e-04
Scas_627.7                                                             45   1e-04
CAGL0I03498g 297344..298699 similar to sp|P06784 Saccharomyces c...    45   1e-04
KLLA0F20053g 1867209..1868543 highly similar to sp|P32485 Saccha...    45   1e-04
YPL031C (PHO85) [5407] chr16 complement(492014..492914,493017..4...    44   1e-04
Kwal_27.9804                                                           45   2e-04
ADR379C [2120] [Homologous to ScYOR351C (MEK1) - SH] (1386601..1...    45   2e-04
Scas_655.2                                                             45   2e-04
Sklu_2323.3 YPL209C, Contig c2323 5241-6443                            44   2e-04
YLR113W (HOG1) [3526] chr12 (371621..372928) MAP kinase (MAPK), ...    44   2e-04
YMR216C (SKY1) [4172] chr13 complement(698810..701038) Serine/th...    45   2e-04
Kwal_0.155                                                             44   2e-04
CAGL0F00649g 71961..73505 similar to sp|P38623 Saccharomyces cer...    44   2e-04
YBR059C (AKL1) [250] chr2 complement(356821..360147) Serine/thre...    45   2e-04
Scas_713.38                                                            44   2e-04
Scas_477.5                                                             44   2e-04
Scas_705.23                                                            44   2e-04
Kwal_26.8703                                                           44   3e-04
YNL183C (NPR1) [4417] chr14 complement(293137..295509) Serine/th...    44   3e-04
AEL205W [2301] [Homologous to ScYNL298W (CLA4) - SH; ScYOL113W (...    44   3e-04
Sklu_1603.2 YPR054W, Contig c1603 1858-3324 reverse complement         44   3e-04
Scas_700.35                                                            44   3e-04
AEL185C [2321] [Homologous to ScYBR274W (CHK1) - SH] (291129..29...    44   3e-04
YPR111W (DBF20) [5532] chr16 (747302..748996) Cell cycle protein...    44   3e-04
KLLA0B11902g 1041657..1043144 gi|7385125|gb|AAF61706.1|AF226711_...    44   3e-04
KLLA0C04191g 384198..386591 weakly similar to sp|P27636 Saccharo...    44   3e-04
Scas_613.13*                                                           43   3e-04
CAGL0C03509g complement(350846..353533) similar to sp|P53739 Sac...    44   3e-04
KLLA0D13266g complement(1137750..1141208) similar to sp|P32361 S...    44   3e-04
AFR076W [3268] [Homologous to ScYJL106W (IME2) - SH] complement(...    44   4e-04
KLLA0F18612g 1711131..1713575 some similarities with sp|P38080 S...    44   4e-04
Sklu_2385.2 YLR113W, Contig c2385 3805-5109 reverse complement         43   4e-04
Scas_619.5*                                                            44   4e-04
YCR091W (KIN82) [614] chr3 (274400..276562) Serine/threonine pro...    44   4e-04
Scas_629.16                                                            44   4e-04
KLLA0C18568g 1639958..1642282 gi|6967028|emb|CAB72435.1 Kluyvero...    44   4e-04
Scas_693.17                                                            44   5e-04
CAGL0B01925g 176316..179150 similar to sp|P13185 Saccharomyces c...    43   5e-04
YNL020C (ARK1) [4567] chr14 complement(595621..597537) Serine/th...    43   5e-04
CAGL0K02167g complement(191468..194956) similar to sp|P38990 Sac...    43   5e-04
Scas_711.15                                                            43   5e-04
Kwal_14.1249                                                           43   5e-04
YLR362W (STE11) [3744] chr12 (849865..852018) MAP kinase kinase ...    43   6e-04
KLLA0A02717g 245082..246380 some similarities with sp|P53233 Sac...    43   6e-04
CAGL0L12474g complement(1345044..1345952) highly similar to sp|P...    42   6e-04
KLLA0D11990g join(complement(1023928..1023944), gi|2499590|sp|Q9...    42   6e-04
Scas_713.7                                                             43   6e-04
Scas_635.1                                                             42   6e-04
Scas_671.16                                                            43   7e-04
Sklu_2361.3 YPL150W, Contig c2361 3677-6331                            43   7e-04
CAGL0B04147g 402798..404498 highly similar to sp|P22204 Saccharo...    43   7e-04
Scas_716.33                                                            43   7e-04
KLLA0A02497g 218592..219680 highly similar to sp|P14681 Saccharo...    42   7e-04
Kwal_23.5290                                                           43   7e-04
ACR196C [1243] [Homologous to ScYDL159W (STE7) - SH] (692321..69...    42   8e-04
Kwal_55.22001                                                          42   8e-04
Scas_720.103                                                           42   8e-04
YDL108W (KIN28) [761] chr4 (267698..267725,267807..268699) Cycli...    42   8e-04
CAGL0E01683g complement(166584..167711) highly similar to sp|P21...    42   8e-04
AEL173W [2333] [Homologous to ScYJL057C (IKS1) - SH] complement(...    42   8e-04
YNL298W (CLA4) [4314] chr14 (68913..71441) Serine/threonine prot...    42   9e-04
YGR092W (DBF2) [2052] chr7 (668191..669909) Serine/threonine pro...    42   0.001
YNR047W (YNR047W) [4630] chr14 (708522..711203) Serine/threonine...    42   0.001
Kwal_23.5668                                                           42   0.001
CAGL0M03729g complement(420316..422901) similar to sp|P48562 Sac...    42   0.001
KLLA0F12188g 1122745..1124385 similar to sp|P38623 Saccharomyces...    42   0.001
AER232C [2734] [Homologous to ScYHR030C - SH; ScYKL161C (SLT2) -...    42   0.001
KLLA0A07403g 661261..663900 similar to sp|P48562 Saccharomyces c...    42   0.001
CAGL0J11308g 1097845..1100031 similar to sp|P22211 Saccharomyces...    42   0.001
AER223C [2725] [Homologous to ScYAR019C (CDC15) - SH] (1044971.....    42   0.001
ADR167W [1909] [Homologous to ScYNR047W - SH; ScYCR091W (KIN82) ...    42   0.001
Kwal_56.22788                                                          42   0.001
ADR033W [1774] [Homologous to ScYGR092W (DBF2) - SH; ScYPR111W (...    42   0.001
CAGL0K01815g 162144..163658 similar to sp|P06243 Saccharomyces c...    42   0.001
Sklu_2255.4 YGR040W, Contig c2255 6834-7940 reverse complement         41   0.001
Kwal_26.7276                                                           42   0.001
AEL179W [2327] [Homologous to NOHBY] complement(302948..303817) ...    41   0.001
Sklu_2354.4 YNL307C, Contig c2354 4429-5520 reverse complement         41   0.001
KLLA0E07414g complement(672690..673787) highly similar to sp|P21...    41   0.001
Kwal_56.24584                                                          41   0.002
AFR696C [3889] [Homologous to ScYDR507C (GIN4) - SH; ScYCL024W (...    42   0.002
CAGL0H10208g complement(996853..999936) similar to sp|P38080 Sac...    42   0.002
KLLA0C17160g 1498959..1501454 similar to sp|P53104 Saccharomyces...    42   0.002
Scas_544.6                                                             41   0.002
Scas_718.72                                                            41   0.002
Scas_661.27                                                            42   0.002
AGL242C [4070] [Homologous to ScYPL031C (PHO85) - SH] (246896..2...    41   0.002
Sklu_2226.7 YIL095W, Contig c2226 8986-11373                           41   0.002
YGR040W (KSS1) [2006] chr7 (575400..576506) Serine/threonine pro...    41   0.002
AFR205C [3397] [Homologous to ScYKL139W (CTK1) - SH] (805583..80...    41   0.002
Kwal_17.2687                                                           41   0.002
CAGL0J04972g 472984..474003 some similarities with tr|Q12100 Sac...    40   0.002
CAGL0K05709g complement(555903..559214) similar to sp|Q12263 Sac...    41   0.002
KLLA0F02838g 264329..266596 some similarities with sp|P32581 Sac...    41   0.002
Kwal_27.11542                                                          41   0.003
Kwal_56.22476                                                          41   0.003
Kwal_47.17868                                                          40   0.003
YGL180W (ATG1) [1811] chr7 (160069..162762) Serine/threonine pro...    41   0.003
Scas_707.36                                                            41   0.003
YKL048C (ELM1) [3211] chr11 complement(346859..348781) Serine/th...    40   0.003
KLLA0F23507g complement(2198603..2200066) similar to sp|P24719 S...    40   0.003
CAGL0D02244g complement(229504..230967) similar to sp|P24719 Sac...    40   0.003
CAGL0K11275g 1093797..1095374 similar to tr|Q03785 Saccharomyces...    40   0.003
Scas_649.30                                                            40   0.003
Sklu_2442.21 YLR248W, Contig c2442 39541-41052 reverse complement      40   0.003
Scas_721.132                                                           40   0.003
YPL150W (YPL150W) [5297] chr16 (268187..270892) Serine/threonine...    40   0.004
Kwal_27.10945                                                          40   0.004
Sklu_2401.9 YGR092W, Contig c2401 17788-19521                          40   0.004
CAGL0M11748g 1167306..1168649 highly similar to sp|P32485 Saccha...    40   0.004
KLLA0A06776g 612115..614517 some similarities with sp|P36003 Sac...    40   0.004
YDR122W (KIN1) [969] chr4 (694694..697888) Serine/threonine prot...    40   0.004
ADR253W [1994] [Homologous to ScYMR139W (RIM11) - SH; ScYDL079C ...    40   0.004
ADL168C [1573] [Homologous to ScYNL307C (MCK1) - SH; ScYOL128C -...    40   0.004
YBL016W (FUS3) [179] chr2 (192416..193477) Serine/threonine prot...    40   0.005
Scas_568.9*                                                            39   0.005
YLL019C (KNS1) [3399] chr12 complement(105685..107898) Serine/th...    40   0.005
Scas_598.6                                                             40   0.005
AGR048C [4358] [Homologous to ScYLR113W (HOG1) - SH] (807470..80...    40   0.005
Kwal_55.21900                                                          40   0.005
KLLA0F11319g 1042436..1044967 similar to sgd|S0006071 Saccharomy...    40   0.005
Kwal_33.14192                                                          40   0.006
CAGL0J00539g 47095..48561 highly similar to sp|Q00772 Saccharomy...    40   0.006
ADR293C [2034] [Homologous to ScYHR079C (IRE1) - SH] (1207023..1...    40   0.006
YOL128C (YGK3) [4695] chr15 complement(78351..79478) Member of t...    39   0.006
KLLA0F22297g complement(2083448..2085547) some similarities with...    40   0.006
Scas_602.11                                                            40   0.007
KLLA0C16577g complement(1451181..1452695) some similarities with...    39   0.007
YDL079C (MRK1) [789] chr4 complement(312951..314044,314337..3147...    39   0.007
Scas_653.25                                                            39   0.007
YJL106W (IME2) [2809] chr10 (221307..223244) Serine/threonine pr...    39   0.007
AGR334W [4645] [Homologous to ScYMR291W - SH] complement(1354612...    39   0.007
Scas_707.34                                                            39   0.008
KLLA0F17006g complement(1561859..1563106) gi|3127831|emb|CAA6115...    39   0.008
Sklu_2277.8 YOR267C, Contig c2277 9591-11441 reverse complement        39   0.008
AGR058W [4368] [Homologous to ScYLR096W (KIN2) - SH; ScYDR122W (...    39   0.008
Kwal_26.9032                                                           39   0.008
Kwal_27.11777                                                          39   0.009
KLLA0E06413g complement(577669..581154) gi|22858696|gb|AAN05732....    39   0.009
ACL006W [1043] [Homologous to ScYMR001C (CDC5) - SH] complement(...    39   0.010
Scas_703.47                                                            39   0.010
YOL113W (SKM1) [4709] chr15 (104325..106292) Serine/threonine pr...    39   0.011
YDL017W (CDC7) [843] chr4 (424206..425729) Protein kinase that a...    39   0.011
Scas_493.2                                                             39   0.011
Sklu_1886.2 YDL025C, Contig c1886 2790-4733                            39   0.011
KLLA0C01650g 128119..131457 similar to sp|Q12263 Saccharomyces c...    39   0.012
CAGL0H01199g 110610..115556 highly similar to sp|P15442 Saccharo...    39   0.012
AFR724C [3917] [Homologous to ScYDR523C (SPS1) - SH] (1769897..1...    39   0.012
Sklu_1477.2 YKL116C, Contig c1477 684-2414 reverse complement          39   0.012
CAGL0C02893g complement(286017..287966) similar to tr|Q08732 Sac...    39   0.013
Kwal_56.23717                                                          39   0.013
CAGL0L06006g complement(670707..673535) similar to sp|P53104 Sac...    39   0.013
Kwal_56.23841                                                          38   0.013
Kwal_33.13112                                                          39   0.014
CAGL0F03905g complement(377962..380088) similar to sp|Q03656 Sac...    39   0.014
CAGL0K04169g 383738..384934 similar to sp|P14681 Saccharomyces c...    38   0.014
AAL083W [104] [Homologous to ScYDR283C (GCN2) - SH] complement(1...    39   0.014
Scas_336.1                                                             38   0.014
KLLA0E10527g 929989..931104 similar to sp|P16892 Saccharomyces c...    38   0.014
ACL054W [995] [Homologous to ScYGL180W (APG1) - SH] complement(2...    39   0.014
CAGL0G04455g 426386..428641 similar to sp|P32581 Saccharomyces c...    39   0.015
YIL095W (PRK1) [2580] chr9 (183934..186366) Serine/threonine pro...    39   0.015
Scas_715.34                                                            39   0.016
Sklu_2419.9 YMR001C, Contig c2419 14049-16136                          38   0.016
KLLA0C03938g complement(358851..360632) some similarities with s...    38   0.017
Sklu_1851.1 YJL106W, Contig c1851 2732-4783 reverse complement         38   0.017
CAGL0J03432g 327428..329296 similar to sp|P53974 Saccharomyces c...    38   0.017
KLLA0E17127g complement(1515721..1518279) similar to sp|P38691 S...    38   0.017
Scas_584.8                                                             38   0.018
Scas_688.14                                                            38   0.018
KLLA0D14905g 1256065..1257768 gi|28565036|gb|AAO32601.1 Kluyvero...    38   0.018
Kwal_23.3992                                                           38   0.019
Kwal_27.10581                                                          38   0.019
YHR030C (SLT2) [2317] chr8 complement(168882..170336) Serine/thr...    38   0.019
Scas_689.24                                                            38   0.019
Kwal_27.9763                                                           38   0.020
Sklu_2211.5 YBL105C, Contig c2211 10237-13764                          38   0.020
YCL024W (KCC4) [520] chr3 (79161..82274) Serine/threonine protei...    38   0.020
KLLA0C03828g 349187..351568 similar to sp|P54199 Saccharomyces c...    38   0.022
KLLA0C00979g 73295..74746 similar to sp|P08458 Saccharomyces cer...    38   0.023
YGR188C (BUB1) [2139] chr7 complement(872047..875112) Serine/thr...    38   0.023
KLLA0E11979g complement(1060048..1061892) some similarities with...    38   0.024
Scas_568.13                                                            37   0.024
Kwal_47.17252                                                          38   0.024
YOR267C (HRK1) [5054] chr15 complement(822585..824864) Serine/th...    38   0.025
Scas_548.6                                                             38   0.025
Kwal_27.11803                                                          37   0.025
Kwal_27.12559                                                          37   0.026
Scas_584.11                                                            38   0.026
Scas_685.24                                                            37   0.026
CAGL0K11990g complement(1155395..1158370) some similarities with...    38   0.027
KLLA0C10802g complement(926916..931934) similar to sp|P15442 Sac...    38   0.027
Kwal_33.14167                                                          38   0.028
AAL029W [158] [Homologous to ScYLR248W (RCK2) - SH; ScYGL158W (R...    37   0.028
AFR019W [3211] [Homologous to ScYBL016W (FUS3) - SH] complement(...    37   0.029
YDR507C (GIN4) [1321] chr4 complement(1462346..1465774) Serine/t...    38   0.029
KLLA0C06138g 540409..542535 similar to sp|P32562 Saccharomyces c...    37   0.029
CAGL0K01661g complement(146952..148400) some similarities with t...    37   0.030
KLLA0D12100g complement(1031728..1033161) some similarities with...    37   0.032
ABL055C [537] [Homologous to ScYKL116C (PRR1) - SH] (295497..297...    37   0.033
YDR283C (GCN2) [1112] chr4 complement(1025062..1030041) Serine/t...    37   0.034
YBL105C (PKC1) [98] chr2 complement(14241..17696) Protein kinase...    37   0.034
Scas_677.18                                                            37   0.035
KLLA0F19536g 1808263..1811577 similar to sp|P13186 Saccharomyces...    37   0.037
AER216C [2718] [Homologous to ScYDL017W (CDC7) - SH] (1032840..1...    37   0.038
CAGL0K11550g 1118142..1119758 similar to sp|P28708 Saccharomyces...    37   0.041
Kwal_47.17345                                                          37   0.042
Scas_678.24                                                            37   0.042
YFL029C (CAK1) [1654] chr6 complement(78053..79159) Cdk-activati...    37   0.043
KLLA0F22605g complement(2109034..2111913) similar to sp|P41695 S...    37   0.044
AFR150C [3342] [Homologous to ScYFL029C (CAK1) - SH] (707306..70...    37   0.045
Scas_721.61                                                            37   0.045
KLLA0C04345g 397899..399326 similar to sp|P06243 Saccharomyces c...    37   0.045
KLLA0B11946g complement(1048033..1049352) similar to sp|P41808 S...    37   0.050
ABR177C [770] [Homologous to ScYPR161C (SGV1) - SH] (735828..738...    37   0.057
KLLA0A06820g complement(615686..618004) some similarities with s...    37   0.058
CAGL0M09361g complement(928484..931918) highly similar to sp|P24...    37   0.059
CAGL0D06600g 626571..628748 similar to tr|Q12399 Saccharomyces c...    36   0.065
YHR082C (KSP1) [2372] chr8 complement(268460..271549) Serine/thr...    36   0.065
CAGL0M11396g 1120559..1124137 similar to sp|P13186 Saccharomyces...    37   0.065
Kwal_23.5576                                                           36   0.068
Scas_683.6                                                             36   0.071
KLLA0D09328g complement(788565..791705) some similarities with s...    36   0.073
Kwal_23.4276                                                           36   0.075
Kwal_55.20221                                                          36   0.076
Scas_695.33                                                            36   0.079
CAGL0G03047g 282299..283918 highly similar to sp|P22204 Saccharo...    36   0.081
Kwal_27.10004                                                          36   0.083
Kwal_23.3471                                                           35   0.084
CAGL0M08360g complement(833220..835520) some similarities with s...    36   0.087
Kwal_26.7682                                                           36   0.087
Kwal_55.20189                                                          36   0.088
Sklu_1752.2 YBR059C, Contig c1752 577-3153 reverse complement          36   0.090
Kwal_33.13222                                                          34   0.090
CAGL0M13541g 1332296..1334164 similar to sp|Q03533 Saccharomyces...    36   0.091
YPR161C (SGV1) [5576] chr16 complement(864443..866416) Serine/th...    36   0.095
Kwal_47.17263                                                          36   0.098
Scas_564.7                                                             36   0.10 
Sklu_1870.5 YFL029C, Contig c1870 6101-7144                            35   0.11 
ADR300C [2042] [Homologous to ScYHR082C (KSP1) - SH] (1222346..1...    36   0.11 
Kwal_26.7154                                                           36   0.11 
ADL043C [1698] [Homologous to ScYLL019C (KNS1) - SH] (612091..61...    35   0.11 
YNL307C (MCK1) [4306] chr14 complement(56446..57573) Member of t...    35   0.11 
Scas_573.10                                                            35   0.12 
AGR027C [4337] [Homologous to ScYBR059C (AKL1) - SH] (763309..76...    35   0.12 
Sklu_1987.1 YBL016W, Contig c1987 623-1996                             35   0.13 
Scas_653.33                                                            35   0.13 
CAGL0F03707g complement(359839..361665) similar to sp|Q08732 Sac...    35   0.13 
YDL025C (YDL025C) [836] chr4 complement(405341..407203) Serine/t...    35   0.14 
YLR096W (KIN2) [3511] chr12 (332591..336034) Serine/threonine pr...    35   0.14 
Scas_710.28                                                            35   0.14 
YHR079C (IRE1) [2368] chr8 complement(258245..261592) Protein ki...    35   0.14 
ADR174C [1916] [Homologous to ScYOR267C - SH] (1008798..1010813)...    35   0.14 
KLLA0F01408g 135424..136302 weakly similar to sgd|S0002183 Sacch...    35   0.14 
KLLA0C14278g 1240990..1242615 similar to sp|P28708 Saccharomyces...    35   0.15 
ACR191C [1238] [Homologous to ScYBL105C (PKC1) - SH] (680398..68...    35   0.16 
YDL028C (MPS1) [834] chr4 complement(400994..403288) Multi-funct...    35   0.16 
CAGL0H01837g complement(176352..178736) tr|Q9C1R8 Candida glabra...    35   0.20 
CAGL0J05082g 481179..483140 similar to sp|P47042 Saccharomyces c...    35   0.20 
AER348C [2849] [Homologous to ScYMR216C (SKY1) - SH] (1275897..1...    35   0.21 
CAGL0I08349g complement(813728..815731) similar to sp|P23293 Sac...    34   0.24 
YDR247W (VHS1) [1081] chr4 (956005..957390) Serine/threonine pro...    34   0.25 

>YHR135C (YCK1) [2422] chr8 complement(372695..374311) Casein kinase
           I isoform [1617 bp, 538 aa]
          Length = 538

 Score =  846 bits (2185), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 425/529 (80%), Positives = 425/529 (80%)

Query: 1   MSMPIASTTLAVNNLTNINGNANFNVQANKQLHHQAVDSPXXXXXXXXXXXXXXXXXXXX 60
           MSMPIASTTLAVNNLTNINGNANFNVQANKQLHHQAVDSP                    
Sbjct: 1   MSMPIASTTLAVNNLTNINGNANFNVQANKQLHHQAVDSPARSSMTATTAANSNSNSSRD 60

Query: 61  XXXIVGLHYKIGKKIGEGSFGVLFEGTNMINGVPVAIKFEPRKTEAPQLRDEYKTYKILN 120
              IVGLHYKIGKKIGEGSFGVLFEGTNMINGVPVAIKFEPRKTEAPQLRDEYKTYKILN
Sbjct: 61  DSTIVGLHYKIGKKIGEGSFGVLFEGTNMINGVPVAIKFEPRKTEAPQLRDEYKTYKILN 120

Query: 121 GTPNIPYAYYFGQEGLHNILVIDLLGPSLEDLFDWCGRKFSVKTVVQVAVQMITLIEDLH 180
           GTPNIPYAYYFGQEGLHNILVIDLLGPSLEDLFDWCGRKFSVKTVVQVAVQMITLIEDLH
Sbjct: 121 GTPNIPYAYYFGQEGLHNILVIDLLGPSLEDLFDWCGRKFSVKTVVQVAVQMITLIEDLH 180

Query: 181 AHDLIYRDIKPDNFLIGRPGQPDANNIHLIDFGMAKQYRDPKTKQHIPYREKKSLSGTAR 240
           AHDLIYRDIKPDNFLIGRPGQPDANNIHLIDFGMAKQYRDPKTKQHIPYREKKSLSGTAR
Sbjct: 181 AHDLIYRDIKPDNFLIGRPGQPDANNIHLIDFGMAKQYRDPKTKQHIPYREKKSLSGTAR 240

Query: 241 YMSINTHLGREQSRRDDMEALGHVFFYFLRGHLPWQGLKAPNNKQKYEKIGEKKRSTNVY 300
           YMSINTHLGREQSRRDDMEALGHVFFYFLRGHLPWQGLKAPNNKQKYEKIGEKKRSTNVY
Sbjct: 241 YMSINTHLGREQSRRDDMEALGHVFFYFLRGHLPWQGLKAPNNKQKYEKIGEKKRSTNVY 300

Query: 301 DLAQGLPVQFGRYLEIVRSLSFEECPDYEGYRKLLLSVLDDLGETADGQYDWMKLNDGRG 360
           DLAQGLPVQFGRYLEIVRSLSFEECPDYEGYRKLLLSVLDDLGETADGQYDWMKLNDGRG
Sbjct: 301 DLAQGLPVQFGRYLEIVRSLSFEECPDYEGYRKLLLSVLDDLGETADGQYDWMKLNDGRG 360

Query: 361 WDLNINKKPNLHGYGHPNPPNEKSRKHRNKXXXXXXXXXXXXXXXXXXXXYAQKTEADMR 420
           WDLNINKKPNLHGYGHPNPPNEKSRKHRNK                    YAQKTEADMR
Sbjct: 361 WDLNINKKPNLHGYGHPNPPNEKSRKHRNKQLQMQQLQMQQLQQQQQQQQYAQKTEADMR 420

Query: 421 NSQYKPKLDPTSYEAYXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXRXX 480
           NSQYKPKLDPTSYEAY                                         R  
Sbjct: 421 NSQYKPKLDPTSYEAYQHQTQQKYLQEQQKRQQQQKLQEQQLQEQQLQQQQQQQQQLRAT 480

Query: 481 XXXXXXXXXXXXXXXXXXRYQPQQQPSAALRTPEQHPNDDNSSLAASHK 529
                             RYQPQQQPSAALRTPEQHPNDDNSSLAASHK
Sbjct: 481 GQPPSQPQAQTQSQQFGARYQPQQQPSAALRTPEQHPNDDNSSLAASHK 529

>Scas_654.17
          Length = 523

 Score =  659 bits (1700), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 327/447 (73%), Positives = 351/447 (78%), Gaps = 21/447 (4%)

Query: 6   ASTTLAVNNLTNINGNANFNVQANKQLHHQAVDSPXXXXXXXXXXXXXXXXXXXXXXXIV 65
           A+T +A++NLTN     N  +Q+   L     + P                       IV
Sbjct: 10  ANTAMAIHNLTNT---TNTPMQSASNLRLLNGNLPMTPANQTPASTASPPTSMRDDSTIV 66

Query: 66  GLHYKIGKKIGEGSFGVLFEGTNMINGVPVAIKFEPRKTEAPQLRDEYKTYKILNGTPNI 125
           GLHYKIGKKIGEGSFGVLFEGTNMING+PVAIKFEPRKTEAPQL+DEY+TYKIL GTP +
Sbjct: 67  GLHYKIGKKIGEGSFGVLFEGTNMINGLPVAIKFEPRKTEAPQLKDEYRTYKILTGTPGV 126

Query: 126 PYAYYFGQEGLHNILVIDLLGPSLEDLFDWCGRKFSVKTVVQVAVQMITLIEDLHAHDLI 185
           P AYYFGQEGLHNILVIDLLGPSLEDLFDWC RKFSVKTVVQVAVQMITLIEDLHAHDLI
Sbjct: 127 PQAYYFGQEGLHNILVIDLLGPSLEDLFDWCNRKFSVKTVVQVAVQMITLIEDLHAHDLI 186

Query: 186 YRDIKPDNFLIGRPGQPDANNIHLIDFGMAKQYRDPKTKQHIPYREKKSLSGTARYMSIN 245
           YRDIKPDNFL+GRPG  DAN IHLIDFGMAKQYRDPKTKQHIPYREKKSLSGTARYMSIN
Sbjct: 187 YRDIKPDNFLVGRPGHEDANKIHLIDFGMAKQYRDPKTKQHIPYREKKSLSGTARYMSIN 246

Query: 246 THLGREQSRRDDMEALGHVFFYFLRGHLPWQGLKAPNNKQKYEKIGEKKRSTNVYDLAQG 305
           THLGREQSRRDDMEALGHVFFYFLRG LPWQGLKAPNNKQKYEKIGEKKR+TNVYDLAQG
Sbjct: 247 THLGREQSRRDDMEALGHVFFYFLRGQLPWQGLKAPNNKQKYEKIGEKKRTTNVYDLAQG 306

Query: 306 LPVQFGRYLEIVRSLSFEECPDYEGYRKLLLSVLDDLGETADGQYDWMKLNDGRGWDLNI 365
           LP+QFGRYLEIVR+LSFEE PDYEGYR LLLS LDDLG++ADG+YDWMKLN GRGWDL I
Sbjct: 307 LPIQFGRYLEIVRNLSFEETPDYEGYRMLLLSALDDLGQSADGEYDWMKLNGGRGWDLAI 366

Query: 366 NKKPNLHGYGHPNPPNEKSRKHRNKXXXXXXXXXXXXXXXXXXXXYA------------- 412
           NKKPNLHGYGHPNPPNEKS++HRNK                    +              
Sbjct: 367 NKKPNLHGYGHPNPPNEKSKRHRNKLNAAGVAGGNPQQRQTNSPLHTAHHTPQPPQLQPL 426

Query: 413 ---QKTEADMRNSQYKPKLDPTSYEAY 436
              Q TE DM+  Q + +LDPTSYEAY
Sbjct: 427 QQNQHTENDMQ--QNEAQLDPTSYEAY 451

>YNL154C (YCK2) [4443] chr14 complement(343636..345276) Casein
           kinase I isoform [1641 bp, 546 aa]
          Length = 546

 Score =  650 bits (1678), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 305/327 (93%), Positives = 317/327 (96%)

Query: 64  IVGLHYKIGKKIGEGSFGVLFEGTNMINGVPVAIKFEPRKTEAPQLRDEYKTYKILNGTP 123
           IVGLHYKIGKKIGEGSFGVLFEGTNMING+PVAIKFEPRKTEAPQL+DEY+TYKIL GTP
Sbjct: 71  IVGLHYKIGKKIGEGSFGVLFEGTNMINGLPVAIKFEPRKTEAPQLKDEYRTYKILAGTP 130

Query: 124 NIPYAYYFGQEGLHNILVIDLLGPSLEDLFDWCGRKFSVKTVVQVAVQMITLIEDLHAHD 183
            IP  YYFGQEGLHNILVIDLLGPSLEDLFDWCGR+FSVKTVVQVAVQMITLIEDLHAHD
Sbjct: 131 GIPQEYYFGQEGLHNILVIDLLGPSLEDLFDWCGRRFSVKTVVQVAVQMITLIEDLHAHD 190

Query: 184 LIYRDIKPDNFLIGRPGQPDANNIHLIDFGMAKQYRDPKTKQHIPYREKKSLSGTARYMS 243
           LIYRDIKPDNFLIGRPGQPDAN +HLIDFGMAKQYRDPKTKQHIPYREKKSLSGTARYMS
Sbjct: 191 LIYRDIKPDNFLIGRPGQPDANKVHLIDFGMAKQYRDPKTKQHIPYREKKSLSGTARYMS 250

Query: 244 INTHLGREQSRRDDMEALGHVFFYFLRGHLPWQGLKAPNNKQKYEKIGEKKRSTNVYDLA 303
           INTHLGREQSRRDDMEA+GHVFFYFLRG LPWQGLKAPNNKQKYEKIGEKKR TNVYDLA
Sbjct: 251 INTHLGREQSRRDDMEAMGHVFFYFLRGQLPWQGLKAPNNKQKYEKIGEKKRLTNVYDLA 310

Query: 304 QGLPVQFGRYLEIVRSLSFEECPDYEGYRKLLLSVLDDLGETADGQYDWMKLNDGRGWDL 363
           QGLP+QFGRYLEIVR+LSFEE PDYEGYR LLLSVLDDLGETADGQYDWMKLN GRGWDL
Sbjct: 311 QGLPIQFGRYLEIVRNLSFEETPDYEGYRMLLLSVLDDLGETADGQYDWMKLNGGRGWDL 370

Query: 364 NINKKPNLHGYGHPNPPNEKSRKHRNK 390
           +INKKPNLHGYGHPNPPNEKS++HR+K
Sbjct: 371 SINKKPNLHGYGHPNPPNEKSKRHRSK 397

>CAGL0G06138g complement(585585..587204) similar to sp|P23291
           Saccharomyces cerevisiae YHR135c YCK1, start by
           similarity
          Length = 539

 Score =  648 bits (1672), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 326/450 (72%), Positives = 352/450 (78%), Gaps = 36/450 (8%)

Query: 2   SMPIASTTLAVNNLTN-----INGNANFNVQANKQLHHQAVDSPXXXXXXXXXXXXXXXX 56
           ++  A+T +AVNNLTN     +N NA +N   + +                         
Sbjct: 9   AVTAANTAMAVNNLTNGGYPAMNANAPYNGTPSNR--------------------SSSNM 48

Query: 57  XXXXXXXIVGLHYKIGKKIGEGSFGVLFEGTNMINGVPVAIKFEPRKTEAPQLRDEYKTY 116
                  IVGLHYKIGKKIGEGSFGVLFEGTNMING+PVAIKFEPRKTEAPQL+DEY+TY
Sbjct: 49  TSRDDSTIVGLHYKIGKKIGEGSFGVLFEGTNMINGMPVAIKFEPRKTEAPQLKDEYRTY 108

Query: 117 KILNGTPNIPYAYYFGQEGLHNILVIDLLGPSLEDLFDWCGRKFSVKTVVQVAVQMITLI 176
           KI+ GTPN+P AYYFGQEGLHNILVIDLLGPSLEDLFDWCGRKFSVKTVVQVAVQMITLI
Sbjct: 109 KIMAGTPNVPQAYYFGQEGLHNILVIDLLGPSLEDLFDWCGRKFSVKTVVQVAVQMITLI 168

Query: 177 EDLHAHDLIYRDIKPDNFLIGRPGQPDANNIHLIDFGMAKQYRDPKTKQHIPYREKKSLS 236
           EDLHAHDLIYRDIKPDNFLIGRPGQPD N IHLIDFGMAKQYRDPKTKQHIPYRE+KSLS
Sbjct: 169 EDLHAHDLIYRDIKPDNFLIGRPGQPDENKIHLIDFGMAKQYRDPKTKQHIPYRERKSLS 228

Query: 237 GTARYMSINTHLGREQSRRDDMEALGHVFFYFLRGHLPWQGLKAPNNKQKYEKIGEKKRS 296
           GTARYMSINTHLGREQSRRDDMEALGHVFFYFLRG LPWQGLKAPNNKQKYEKIGEKKR+
Sbjct: 229 GTARYMSINTHLGREQSRRDDMEALGHVFFYFLRGQLPWQGLKAPNNKQKYEKIGEKKRT 288

Query: 297 TNVYDLAQGLPVQFGRYLEIVRSLSFEECPDYEGYRKLLLSVLDDLGETADGQYDWMKLN 356
           TNVYDL+ G PVQFGRYLEIVRSLSFEE PDY+GYRKLLLSVLDD+ ++ADG YDWMKLN
Sbjct: 289 TNVYDLSNGYPVQFGRYLEIVRSLSFEETPDYQGYRKLLLSVLDDMNDSADGTYDWMKLN 348

Query: 357 DGRGWDLNINKKPNLHGYGHPNPPNEKSRKHRNKXXXXXXXXXXXXXXXXXXXXYAQKTE 416
            GRGWDL INKKPNLHGYGHPNPPN+K R+H+NK                    +  + +
Sbjct: 349 GGRGWDLTINKKPNLHGYGHPNPPNDK-RRHKNKMTNPLQQLAGQQQGQYPDQTHHNQIQ 407

Query: 417 ---------ADMRNS-QYKPKLDPTSYEAY 436
                    AD  N  Q K  LDPTSYEAY
Sbjct: 408 SHQAGIGGNADNANQMQNKRNLDPTSYEAY 437

>Kwal_33.14596
          Length = 500

 Score =  634 bits (1636), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 296/327 (90%), Positives = 311/327 (95%)

Query: 64  IVGLHYKIGKKIGEGSFGVLFEGTNMINGVPVAIKFEPRKTEAPQLRDEYKTYKILNGTP 123
           IVGLHY+IGKKIGEGSFGVLFEGTNMINGVPVAIKFEPRK+EAPQL+DEY+TYKIL GT 
Sbjct: 27  IVGLHYRIGKKIGEGSFGVLFEGTNMINGVPVAIKFEPRKSEAPQLKDEYRTYKILAGTA 86

Query: 124 NIPYAYYFGQEGLHNILVIDLLGPSLEDLFDWCGRKFSVKTVVQVAVQMITLIEDLHAHD 183
            IP AYYFGQEGLHNILVIDLLGPSLEDLFDWCGR+FSVKTVVQVAVQMITLIEDLH HD
Sbjct: 87  GIPQAYYFGQEGLHNILVIDLLGPSLEDLFDWCGRRFSVKTVVQVAVQMITLIEDLHTHD 146

Query: 184 LIYRDIKPDNFLIGRPGQPDANNIHLIDFGMAKQYRDPKTKQHIPYREKKSLSGTARYMS 243
           LIYRDIKPDNFLIGRPG PD N +HLIDFGMAKQYRDPKTKQHIPYREKKSLSGTARYMS
Sbjct: 147 LIYRDIKPDNFLIGRPGTPDENKVHLIDFGMAKQYRDPKTKQHIPYREKKSLSGTARYMS 206

Query: 244 INTHLGREQSRRDDMEALGHVFFYFLRGHLPWQGLKAPNNKQKYEKIGEKKRSTNVYDLA 303
           INTHLGREQSRRDDMEALGHVFFYFLRG LPWQGLKAPNNKQKYEKIGEKKR TNVYDLA
Sbjct: 207 INTHLGREQSRRDDMEALGHVFFYFLRGQLPWQGLKAPNNKQKYEKIGEKKRVTNVYDLA 266

Query: 304 QGLPVQFGRYLEIVRSLSFEECPDYEGYRKLLLSVLDDLGETADGQYDWMKLNDGRGWDL 363
           QGLPVQFGRYLE+VRSL+FEE PDYEGYRKL LS+LDD+   ADG+YDWMKLN GRGWDL
Sbjct: 267 QGLPVQFGRYLEVVRSLAFEETPDYEGYRKLFLSILDDMDNQADGEYDWMKLNGGRGWDL 326

Query: 364 NINKKPNLHGYGHPNPPNEKSRKHRNK 390
           NINKKPNLHGYGHPNPPN+K+R+HR+K
Sbjct: 327 NINKKPNLHGYGHPNPPNDKNRRHRSK 353

>AFR040W [3232] [Homologous to ScYHR135C (YCK1) - SH; ScYNL154C
           (YCK2) - SH] complement(505602..507245) [1644 bp, 547
           aa]
          Length = 547

 Score =  633 bits (1632), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 305/371 (82%), Positives = 321/371 (86%), Gaps = 9/371 (2%)

Query: 64  IVGLHYKIGKKIGEGSFGVLFEGTNMINGVPVAIKFEPRKTEAPQLRDEYKTYKILNGTP 123
           IVGLH+KIGKKIGEGSFGVLFEGTNMINGVPVAIKFEPRKTEAPQL+DEY+TYKIL GT 
Sbjct: 64  IVGLHFKIGKKIGEGSFGVLFEGTNMINGVPVAIKFEPRKTEAPQLKDEYRTYKILAGTS 123

Query: 124 NIPYAYYFGQEGLHNILVIDLLGPSLEDLFDWCGRKFSVKTVVQVAVQMITLIEDLHAHD 183
            +P AYYFGQEGLHNILVIDLLGPSLEDLFDWCGR+FSVKTVVQVAVQMITLIEDLHAHD
Sbjct: 124 GVPQAYYFGQEGLHNILVIDLLGPSLEDLFDWCGRRFSVKTVVQVAVQMITLIEDLHAHD 183

Query: 184 LIYRDIKPDNFLIGRPGQPDANNIHLIDFGMAKQYRDPKTKQHIPYREKKSLSGTARYMS 243
           LIYRDIKPDNFLIGRP QPDAN +HLIDFGMAK YRDPKTKQHIPYREKKSLSGTARYMS
Sbjct: 184 LIYRDIKPDNFLIGRPDQPDANKVHLIDFGMAKLYRDPKTKQHIPYREKKSLSGTARYMS 243

Query: 244 INTHLGREQSRRDDMEALGHVFFYFLRGHLPWQGLKAPNNKQKYEKIGEKKRSTNVYDLA 303
           INTHLGREQSRRDDMEALGHVFFYFLRG LPWQGLKAPNNKQKYEKIGEKKRSTNVYDL+
Sbjct: 244 INTHLGREQSRRDDMEALGHVFFYFLRGQLPWQGLKAPNNKQKYEKIGEKKRSTNVYDLS 303

Query: 304 QGLPVQFGRYLEIVRSLSFEECPDYEGYRKLLLSVLDDLGETADGQYDWMKLNDGRGWDL 363
           QGLPVQFGRYLEIVR+L FEE PDY+GYRKLLLS L++LG   DG+YDWMKLN GRGWDL
Sbjct: 304 QGLPVQFGRYLEIVRNLGFEETPDYDGYRKLLLSTLEELGLEYDGEYDWMKLNGGRGWDL 363

Query: 364 NINKKPNLHGYGHPNPPNEKSRKHRNKXXXXXXXXXXXXXXXXXXXXYAQKTEADMRNSQ 423
            INKKPNLHGYGHPNPPNEK R+HR+K                      Q         Q
Sbjct: 364 TINKKPNLHGYGHPNPPNEKGRRHRSKYPQPSAPQQMSS---------PQDPRYGSSQLQ 414

Query: 424 YKPKLDPTSYE 434
            + +LDPTSYE
Sbjct: 415 LQQRLDPTSYE 425

>Scas_697.12
          Length = 529

 Score =  622 bits (1604), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 309/388 (79%), Positives = 329/388 (84%), Gaps = 21/388 (5%)

Query: 1   MSMPIASTTLAVNNLTNINGNANFNVQANKQLHHQAVDSPXXXXXXXXXXXXXXXXXXXX 60
           MS     T +AVNNLTNI    + + Q  ++      D                      
Sbjct: 1   MSRVQGPTPMAVNNLTNIPAPTSLSQQQQQRPSTSTHDD--------------------- 39

Query: 61  XXXIVGLHYKIGKKIGEGSFGVLFEGTNMINGVPVAIKFEPRKTEAPQLRDEYKTYKILN 120
              IVGLHY+IGKKIGEGSFGVLFEG NMING PVAIKFEPRKTEAPQL+DEY+TYKIL 
Sbjct: 40  NSTIVGLHYRIGKKIGEGSFGVLFEGINMINGTPVAIKFEPRKTEAPQLKDEYRTYKILA 99

Query: 121 GTPNIPYAYYFGQEGLHNILVIDLLGPSLEDLFDWCGRKFSVKTVVQVAVQMITLIEDLH 180
           GTPNIP AYYFGQEGLHNILVIDLLGPSLEDLFDWC R+FSVKTVVQVAVQMITLIEDLH
Sbjct: 100 GTPNIPLAYYFGQEGLHNILVIDLLGPSLEDLFDWCNRRFSVKTVVQVAVQMITLIEDLH 159

Query: 181 AHDLIYRDIKPDNFLIGRPGQPDANNIHLIDFGMAKQYRDPKTKQHIPYREKKSLSGTAR 240
           A+DLIYRDIKPDNFLIGRPGQPD N IHLIDFGMAKQYRDPKTKQHIPYREKKSLSGTAR
Sbjct: 160 ANDLIYRDIKPDNFLIGRPGQPDENFIHLIDFGMAKQYRDPKTKQHIPYREKKSLSGTAR 219

Query: 241 YMSINTHLGREQSRRDDMEALGHVFFYFLRGHLPWQGLKAPNNKQKYEKIGEKKRSTNVY 300
           YMSINTHLGREQSRRDDMEALGHVFFYFLRG LPWQGLKAPNNKQKYE+IGEKKR+TNVY
Sbjct: 220 YMSINTHLGREQSRRDDMEALGHVFFYFLRGQLPWQGLKAPNNKQKYERIGEKKRTTNVY 279

Query: 301 DLAQGLPVQFGRYLEIVRSLSFEECPDYEGYRKLLLSVLDDLGETADGQYDWMKLNDGRG 360
           DLAQGLPVQF RYLE+VR+LSFEE PDY GYR+LLLS LDDLG++ADG+YDWMKLN G+G
Sbjct: 280 DLAQGLPVQFARYLEVVRNLSFEETPDYRGYRELLLSSLDDLGQSADGEYDWMKLNGGKG 339

Query: 361 WDLNINKKPNLHGYGHPNPPNEKSRKHR 388
           WDLNINKKPNLHGYGHP PPNEKSR+HR
Sbjct: 340 WDLNINKKPNLHGYGHPTPPNEKSRRHR 367

>CAGL0J05940g 560563..562023 similar to sp|P23291 Saccharomyces
           cerevisiae YHR135c YCK1 or sp|P23292 Saccharomyces
           cerevisiae YNL154c YCK2, hypothetical start
          Length = 486

 Score =  619 bits (1595), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 296/373 (79%), Positives = 318/373 (85%), Gaps = 23/373 (6%)

Query: 64  IVGLHYKIGKKIGEGSFGVLFEGTNMINGVPVAIKFEPRKTEAPQLRDEYKTYKILNGTP 123
           I GLHY+IGKKIGEGSFGVLFEGTN+ING+PVA+KFEPRKTEAPQL+DEY+TYKIL GTP
Sbjct: 36  IAGLHYQIGKKIGEGSFGVLFEGTNIINGMPVAVKFEPRKTEAPQLKDEYRTYKILAGTP 95

Query: 124 NIPYAYYFGQEGLHNILVIDLLGPSLEDLFDWCGRKFSVKTVVQVAVQMITLIEDLHAHD 183
            +P AYYFGQEGLHNILV+DLLGPSLEDLFDWCGR+FS KTVVQVAVQMITLIEDLHAHD
Sbjct: 96  GVPQAYYFGQEGLHNILVMDLLGPSLEDLFDWCGRQFSPKTVVQVAVQMITLIEDLHAHD 155

Query: 184 LIYRDIKPDNFLIGRPGQPDANNIHLIDFGMAKQYRDPKTKQHIPYREKKSLSGTARYMS 243
           LIYRDIKPDNFL+GRPGQPD NNIHLIDFGMAKQYRDPKTKQHIPYREKKSLSGTARYMS
Sbjct: 156 LIYRDIKPDNFLVGRPGQPDENNIHLIDFGMAKQYRDPKTKQHIPYREKKSLSGTARYMS 215

Query: 244 INTHLGREQSRRDDMEALGHVFFYFLRGHLPWQGLKAPNNKQKYEKIGEKKRSTNVYDLA 303
           INTHLGREQSRRDDMEALGHVFFYFLRG LPWQGLKAPNNKQKYE+IGEKKR+T+VYDLA
Sbjct: 216 INTHLGREQSRRDDMEALGHVFFYFLRGQLPWQGLKAPNNKQKYERIGEKKRTTDVYDLA 275

Query: 304 QGLPVQFGRYLEIVRSLSFEECPDYEGYRKLLLSVLDDLGETADGQYDWMKLNDGRGWDL 363
            G PVQF RYLEIVR+L F+E PDYEGYRKLL S LDD+GET DG+YDWM+LN GRGWDL
Sbjct: 276 NGYPVQFARYLEIVRNLGFDETPDYEGYRKLLASALDDIGETMDGKYDWMELNGGRGWDL 335

Query: 364 NINKKPNLHGYGHPNPPNEKSRKHRNKXXXXXXXXXXXXXXXXXXXXYAQKTEADMRNSQ 423
            INKKPNLHGYGHPNPP +KS ++RN                            +  N  
Sbjct: 336 TINKKPNLHGYGHPNPPGDKSHRNRNAAKG-----------------------GNHANDA 372

Query: 424 YKPKLDPTSYEAY 436
               LDPTSYEAY
Sbjct: 373 NHGGLDPTSYEAY 385

>KLLA0D11044g complement(942458..944068)
           gi|730472|sp|P40230|RAG8_KLULA Kluyveromyces lactis
           CASEIN KINASE I HOMOLOG RAG8, start by similarity
          Length = 536

 Score =  620 bits (1600), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 290/327 (88%), Positives = 307/327 (93%)

Query: 64  IVGLHYKIGKKIGEGSFGVLFEGTNMINGVPVAIKFEPRKTEAPQLRDEYKTYKILNGTP 123
           IVGLHYKIGKKIGEGSFGVLFEG NMIN VPVAIKFEPRKT+APQL+DEY+TYKIL+G+ 
Sbjct: 72  IVGLHYKIGKKIGEGSFGVLFEGVNMINNVPVAIKFEPRKTDAPQLKDEYRTYKILSGSE 131

Query: 124 NIPYAYYFGQEGLHNILVIDLLGPSLEDLFDWCGRKFSVKTVVQVAVQMITLIEDLHAHD 183
            IP AYYFGQEGLHNILVIDLLGPSLEDLFDWCGR+FS+KTVV VA+QMITLIE+LH HD
Sbjct: 132 GIPQAYYFGQEGLHNILVIDLLGPSLEDLFDWCGRRFSIKTVVHVAIQMITLIEELHDHD 191

Query: 184 LIYRDIKPDNFLIGRPGQPDANNIHLIDFGMAKQYRDPKTKQHIPYREKKSLSGTARYMS 243
           LIYRDIKPDNFLIGRP QPDAN +HLIDFGMAK YRDPKTKQHIPYREKKSLSGTARYMS
Sbjct: 192 LIYRDIKPDNFLIGRPNQPDANMVHLIDFGMAKLYRDPKTKQHIPYREKKSLSGTARYMS 251

Query: 244 INTHLGREQSRRDDMEALGHVFFYFLRGHLPWQGLKAPNNKQKYEKIGEKKRSTNVYDLA 303
           INTHLGREQSRRDDMEALGHVFFYFLRG LPWQGLKA NNK KYEKIGEKKRSTNVYDL+
Sbjct: 252 INTHLGREQSRRDDMEALGHVFFYFLRGQLPWQGLKAANNKLKYEKIGEKKRSTNVYDLS 311

Query: 304 QGLPVQFGRYLEIVRSLSFEECPDYEGYRKLLLSVLDDLGETADGQYDWMKLNDGRGWDL 363
           QGLPVQFGRYLEIVR+L FEE PDYEGYRKLLLSVLD+LG+  DG+YDWMKLN GRGWDL
Sbjct: 312 QGLPVQFGRYLEIVRNLGFEETPDYEGYRKLLLSVLDELGQKLDGEYDWMKLNGGRGWDL 371

Query: 364 NINKKPNLHGYGHPNPPNEKSRKHRNK 390
            INKKPNLHGYGHP PPNEKS++HRNK
Sbjct: 372 AINKKPNLHGYGHPTPPNEKSKRHRNK 398

>Scas_627.4
          Length = 475

 Score =  457 bits (1176), Expect = e-157,   Method: Compositional matrix adjust.
 Identities = 216/337 (64%), Positives = 257/337 (76%), Gaps = 18/337 (5%)

Query: 64  IVGLHYKIGKKIGEGSFGVLFEGTNMINGV---PVAIKFEPRKTEAPQLRDEYKTYKILN 120
           IVG+HY +G KIGEGSFGV+FEG N++      PVAIKFEPR ++APQLRDE+++YKILN
Sbjct: 10  IVGIHYAVGPKIGEGSFGVIFEGENLLKDASNEPVAIKFEPRHSDAPQLRDEFRSYKILN 69

Query: 121 GTPNIPYAYYFGQEGLHNILVIDLLGPSLEDLFDWCGRKFSVKTVVQVAVQMITLIEDLH 180
               IP+ YYFGQEG+HNIL+IDLLGPSLEDLF+WCGR+FS+KT   +A QMI  I+D+H
Sbjct: 70  NCTGIPHVYYFGQEGMHNILIIDLLGPSLEDLFEWCGRRFSIKTTCMIAKQMIRRIKDIH 129

Query: 181 AHDLIYRDIKPDNFLIGR-------------PGQPDANNIHLIDFGMAKQYRDPKTKQHI 227
            HDLIYRDIKPDNFLI +                 D N I+L+DFGMAKQ+RDP++KQHI
Sbjct: 130 NHDLIYRDIKPDNFLISQYQRIGSNEKCINSNAHADPNLIYLVDFGMAKQFRDPRSKQHI 189

Query: 228 PYREKKSLSGTARYMSINTHLGREQSRRDDMEALGHVFFYFLRGHLPWQGLKAPNNKQKY 287
           PYRE+KSLSGTARYMSINTH GREQSRRDD+E+LGHVFFYFLRG LPWQGLKA NNK KY
Sbjct: 190 PYRERKSLSGTARYMSINTHFGREQSRRDDLESLGHVFFYFLRGSLPWQGLKAANNKLKY 249

Query: 288 EKIGEKKRSTNVYDLAQG--LPVQFGRYLEIVRSLSFEECPDYEGYRKLLLSVLDDLGET 345
           EKIG  K+  N  DL     +P QF  YL+  RSL FE+ PDY+    L+   L++L   
Sbjct: 250 EKIGLTKQKLNPDDLLMNNHIPKQFATYLKYARSLKFEQDPDYDYLVSLMDDTLNELNLV 309

Query: 346 ADGQYDWMKLNDGRGWDLNINKKPNLHGYGHPNPPNE 382
            DG YDWM LNDG+GWD+ INK+ NLHGYG+PNP N+
Sbjct: 310 DDGHYDWMDLNDGKGWDIKINKRTNLHGYGNPNPRNQ 346

>ADL053C [1688] [Homologous to ScYER123W (YCK3) - SH]
           (589602..591017) [1416 bp, 471 aa]
          Length = 471

 Score =  445 bits (1145), Expect = e-153,   Method: Compositional matrix adjust.
 Identities = 213/340 (62%), Positives = 256/340 (75%), Gaps = 22/340 (6%)

Query: 64  IVGLHYKIGKKIGEGSFGVLFEGTNMING-----VPVAIKFEPRKTEAPQLRDEYKTYKI 118
           +VG+HY +G KIGEGSFG++FEG NM+ G      PVAIKFEPR+++APQLRDE++ Y+I
Sbjct: 9   VVGIHYAVGPKIGEGSFGIIFEGENMMEGGDAGRRPVAIKFEPRRSDAPQLRDEFRAYRI 68

Query: 119 LNGTPNIPYAYYFGQEGLHNILVIDLLGPSLEDLFDWCGRKFSVKTVVQVAVQMITLIED 178
           LNG   IP AYYFGQEG+HNIL+IDLLGPSLEDLF+WCGR+FSVKT   +A QMI  +  
Sbjct: 69  LNGVRGIPRAYYFGQEGVHNILIIDLLGPSLEDLFEWCGRRFSVKTTCMLAKQMIERVRA 128

Query: 179 LHAHDLIYRDIKPDNFLIGR----------------PGQPDANNIHLIDFGMAKQYRDPK 222
           +H  DLIYRDIKPDNFLI                      DAN I+++DFGMAKQYRDPK
Sbjct: 129 IHGRDLIYRDIKPDNFLISEFQREVAAGEVVRGCAATAGGDANLIYVVDFGMAKQYRDPK 188

Query: 223 TKQHIPYREKKSLSGTARYMSINTHLGREQSRRDDMEALGHVFFYFLRGHLPWQGLKAPN 282
           TKQHIPYRE+KSLSGTARYMSINTH GREQSRRDD+E+LGHVFFYFLRG LPWQGLKAPN
Sbjct: 189 TKQHIPYRERKSLSGTARYMSINTHFGREQSRRDDLESLGHVFFYFLRGSLPWQGLKAPN 248

Query: 283 NKQKYEKIGEKKRSTNVYDL-AQGLPVQFGRYLEIVRSLSFEECPDYEGYRKLLLSVLDD 341
           NK KYEKIG  K+     +L ++ +PVQF  YL+  RSL F+E PDY+    L+ SV+ D
Sbjct: 249 NKAKYEKIGLTKQKLKPEELISENIPVQFAEYLKYCRSLRFDEEPDYDYLISLMDSVMHD 308

Query: 342 LGETADGQYDWMKLNDGRGWDLNINKKPNLHGYGHPNPPN 381
           L    +  YDWM LN+  GW++ +NK+ NLHGYG+P+P N
Sbjct: 309 LNIEDNQHYDWMDLNNHTGWNIAVNKRANLHGYGNPHPRN 348

>YER123W (YCK3) [1553] chr5 (404809..406383) Casein kinase I
           isoform, plasma membrane-bound [1575 bp, 524 aa]
          Length = 524

 Score =  445 bits (1144), Expect = e-152,   Method: Compositional matrix adjust.
 Identities = 217/355 (61%), Positives = 256/355 (72%), Gaps = 43/355 (12%)

Query: 64  IVGLHYKIGKKIGEGSFGVLFEGTNMINGV-----------------PVAIKFEPRKTEA 106
           IVG+HY +G KIGEGSFGV+FEG N+++                   PVAIKFEPR ++A
Sbjct: 9   IVGIHYAVGPKIGEGSFGVIFEGENILHSCQAQTGSKRDSSIIMANEPVAIKFEPRHSDA 68

Query: 107 PQLRDEYKTYKILNGTPNIPYAYYFGQEGLHNILVIDLLGPSLEDLFDWCGRKFSVKTVV 166
           PQLRDE++ Y+ILNG   IP+AYYFGQEG+HNIL+IDLLGPSLEDLF+WCGRKFSVKT  
Sbjct: 69  PQLRDEFRAYRILNGCVGIPHAYYFGQEGMHNILIIDLLGPSLEDLFEWCGRKFSVKTTC 128

Query: 167 QVAVQMITLIEDLHAHDLIYRDIKPDNFLIGR----------------PGQPDANNIHLI 210
            VA QMI  +  +H HDLIYRDIKPDNFLI +                    D N I+++
Sbjct: 129 MVAKQMIDRVRAIHDHDLIYRDIKPDNFLISQYQRISPEGKVIKSCASSSNNDPNLIYMV 188

Query: 211 DFGMAKQYRDPKTKQHIPYREKKSLSGTARYMSINTHLGREQSRRDDMEALGHVFFYFLR 270
           DFGMAKQYRDP+TKQHIPYRE+KSLSGTARYMSINTH GREQSRRDD+E+LGHVFFYFLR
Sbjct: 189 DFGMAKQYRDPRTKQHIPYRERKSLSGTARYMSINTHFGREQSRRDDLESLGHVFFYFLR 248

Query: 271 GHLPWQGLKAPNNKQKYEKIGEKKRSTNVYDLA--QGLPVQFGRYLEIVRSLSFEECPDY 328
           G LPWQGLKAPNNK KYEKIG  K+  N  DL     +P QF  YL+  RSL F+E PDY
Sbjct: 249 GSLPWQGLKAPNNKLKYEKIGMTKQKLNPDDLLLNNAIPYQFATYLKYARSLKFDEDPDY 308

Query: 329 EGYRKLLLSVLDDLGE----TADGQYDWMKLNDGRGWDLNINKKPNLHGYGHPNP 379
           +     L+S++DD         DG YDWM LN G+GW++ IN++ NLHGYG+PNP
Sbjct: 309 D----YLISLMDDALRLNDLKDDGHYDWMDLNGGKGWNIKINRRANLHGYGNPNP 359

>Kwal_47.17314
          Length = 421

 Score =  437 bits (1123), Expect = e-150,   Method: Compositional matrix adjust.
 Identities = 209/351 (59%), Positives = 253/351 (72%), Gaps = 25/351 (7%)

Query: 64  IVGLHYKIGKKIGEGSFGVLFEGTNMIN--GVPVAIKFEPRKTEAPQLRDEYKTYKILNG 121
           IVG+HY +G KIGEGSFGV+FEG N++N    PVAIKFEPR+TEAPQLRDE++ YKILNG
Sbjct: 8   IVGIHYAVGPKIGEGSFGVIFEGENVLNNSSSPVAIKFEPRRTEAPQLRDEFRAYKILNG 67

Query: 122 TPNIPYAYYFGQEGLHNILVIDLLGPSLEDLFDWCGRKFSVKTVVQVAVQMITLIEDLHA 181
              IP A+YFGQEG+HN+L+IDLLGPSLEDLF+WCGR+FSVKT   +A QMI  ++ +H 
Sbjct: 68  LEGIPKAFYFGQEGMHNVLIIDLLGPSLEDLFEWCGRRFSVKTTCLLAKQMIRRVQSIHQ 127

Query: 182 HDLIYRDIKPDNFLIGR----------------PGQPDANNIHLIDFGMAKQYRDPKTKQ 225
            DLIYRDIKPDNFLI                      + N ++++DFGMAKQYRDPKTKQ
Sbjct: 128 RDLIYRDIKPDNFLIAEYQRELPNGQLVKNCATSAHGNPNLVYVVDFGMAKQYRDPKTKQ 187

Query: 226 HIPYREKKSLSGTARYMSINTHLGREQSRRDDMEALGHVFFYFLRGHLPWQGLKAPNNKQ 285
           HIPY+E+KSLSGTARYMSINTH GREQSRRDD+E+LGHVFFYFLRG LPWQGLK  N K 
Sbjct: 188 HIPYKERKSLSGTARYMSINTHFGREQSRRDDLESLGHVFFYFLRGFLPWQGLKVANTKL 247

Query: 286 KYEKIGEKKRSTNVYDLAQ-GLPVQFGRYLEIVRSLSFEECPDYEGYRKLLLSVLDDLGE 344
           KYEKIG  K+     DL +  +P QF  YL   RSL FEE PDY+    L+   L + G 
Sbjct: 248 KYEKIGLTKQKVRPEDLLERNIPTQFATYLTYCRSLRFEEEPDYDFLVSLMTQALQERGY 307

Query: 345 TADGQYDWMKLNDGRGWDLNINKKPNLHGYGHPNPPNEKS------RKHRN 389
             D  YDW+ LN G+GW++ +N++ NLHGYG+P P   ++      R HR+
Sbjct: 308 EEDDHYDWLDLNQGQGWNIFVNRRANLHGYGNPTPKTSQAARKSAPRAHRD 358

>CAGL0K02299g complement(205332..206948) similar to sp|P39962
           Saccharomyces cerevisiae YER123w Casein kinase I,
           hypothetical start
          Length = 538

 Score =  441 bits (1134), Expect = e-150,   Method: Compositional matrix adjust.
 Identities = 213/362 (58%), Positives = 255/362 (70%), Gaps = 46/362 (12%)

Query: 64  IVGLHYKIGKKIGEGSFGVLFEGTNMIN---------------------------GVPVA 96
           +VG+HY +G KIGEGSFGV+FEG N++N                           G PVA
Sbjct: 17  VVGMHYAVGPKIGEGSFGVIFEGQNILNSSDGRQGHGSGSGSAHGSGNGNGNSLAGFPVA 76

Query: 97  IKFEPRKTEAPQLRDEYKTYKILNGTPNIPYAYYFGQEGLHNILVIDLLGPSLEDLFDWC 156
           IKFEPR ++APQLRDE++ Y+ILNG+  IP+AYYFGQEG+HN+L+IDLLGPSLEDLF+WC
Sbjct: 77  IKFEPRHSDAPQLRDEFRAYRILNGSKGIPHAYYFGQEGMHNVLIIDLLGPSLEDLFEWC 136

Query: 157 GRKFSVKTVVQVAVQMITLIEDLHAHDLIYRDIKPDNFLIGRPGQPDANN---------- 206
           GRKFS+KT   +A QMI  +  +H HDLIYRDIKPDNFLI    +   NN          
Sbjct: 137 GRKFSIKTTCMLAKQMIERVRIIHDHDLIYRDIKPDNFLISEFQKASNNNGECVKYCAQS 196

Query: 207 -------IHLIDFGMAKQYRDPKTKQHIPYREKKSLSGTARYMSINTHLGREQSRRDDME 259
                  I+++DFGMAKQYRDP+TKQHIPYRE+KSLSGTARYMSINTH GREQSRRDD+E
Sbjct: 197 AGGDPNLIYMVDFGMAKQYRDPRTKQHIPYRERKSLSGTARYMSINTHFGREQSRRDDLE 256

Query: 260 ALGHVFFYFLRGHLPWQGLKAPNNKQKYEKIGEKKRSTNVYD--LAQGLPVQFGRYLEIV 317
           +LGHVFFYFLRG LPWQGLKAPNNK KYEKIG  K+  N  +  L+  +P QF  YL+  
Sbjct: 257 SLGHVFFYFLRGSLPWQGLKAPNNKLKYEKIGLTKQKLNPDELLLSNQIPSQFATYLKYT 316

Query: 318 RSLSFEECPDYEGYRKLLLSVLDDLGETADGQYDWMKLNDGRGWDLNINKKPNLHGYGHP 377
           RSL F+E PDY+    L+  VL   G   DG YDWM LN+G GWD+ +NK+ NLHGYG+ 
Sbjct: 317 RSLKFDEDPDYDYLISLMDGVLLSKGYKDDGHYDWMDLNNGAGWDIRVNKRANLHGYGNA 376

Query: 378 NP 379
            P
Sbjct: 377 QP 378

>KLLA0E13563g 1193481..1194902 some similarities with sp|P39962
           Saccharomyces cerevisiae YER123w YCK3 casein kinase,
           isoform 3, hypothetical start
          Length = 473

 Score =  437 bits (1124), Expect = e-149,   Method: Compositional matrix adjust.
 Identities = 208/340 (61%), Positives = 251/340 (73%), Gaps = 20/340 (5%)

Query: 64  IVGLHYKIGKKIGEGSFGVLFEGTNMINGV---PVAIKFEPRKTEAPQLRDEYKTYKILN 120
           +VG+HY +G KIGEGSFG++FEG N++NG    PVAIKFEPR++++PQLRDE++ Y+ILN
Sbjct: 9   VVGIHYAVGPKIGEGSFGIIFEGENILNGGSKNPVAIKFEPRRSDSPQLRDEFRAYRILN 68

Query: 121 GTPNIPYAYYFGQEGLHNILVIDLLGPSLEDLFDWCGRKFSVKTVVQVAVQMITLIEDLH 180
               IP+AYYF QEG+HNIL+IDLLGPSLEDLF+WC RKFSVKT   +A QMI  +  +H
Sbjct: 69  DVRGIPHAYYFSQEGIHNILIIDLLGPSLEDLFEWCSRKFSVKTTAMLAKQMIDRVRSIH 128

Query: 181 AHDLIYRDIKPDNFLIGR----------------PGQPDANNIHLIDFGMAKQYRDPKTK 224
            HDLIYRDIKPDNFLI                      DAN I+++DFGMAKQ+RDP TK
Sbjct: 129 EHDLIYRDIKPDNFLISEFQRELSDGSVVKSCATSSGGDANLIYVVDFGMAKQFRDPNTK 188

Query: 225 QHIPYREKKSLSGTARYMSINTHLGREQSRRDDMEALGHVFFYFLRGHLPWQGLKAPNNK 284
           QHIPYRE+KSLSGTARYMSINTH GREQSRRDD+E+LGHVFFYFLRG LPWQGLKA NNK
Sbjct: 189 QHIPYRERKSLSGTARYMSINTHFGREQSRRDDLESLGHVFFYFLRGSLPWQGLKALNNK 248

Query: 285 QKYEKIGEKKRSTNVYDLAQ-GLPVQFGRYLEIVRSLSFEECPDYEGYRKLLLSVLDDLG 343
            KYEKIG  K+     DL    +P QF  YL   RSL F++ PDY+    L+  ++ + G
Sbjct: 249 AKYEKIGLTKQRLKPTDLLTPEIPKQFAEYLSYCRSLRFDQDPDYDYLISLMTQIMQENG 308

Query: 344 ETADGQYDWMKLNDGRGWDLNINKKPNLHGYGHPNPPNEK 383
              DG YDWM LN G+GW++ +NK+ NLHGYG+P P N K
Sbjct: 309 YEEDGHYDWMDLNGGQGWNIKVNKRVNLHGYGNPTPRNTK 348

>Sklu_2359.3 YER123W, Contig c2359 7455-8921 reverse complement
          Length = 488

 Score =  437 bits (1124), Expect = e-149,   Method: Compositional matrix adjust.
 Identities = 213/359 (59%), Positives = 260/359 (72%), Gaps = 37/359 (10%)

Query: 64  IVGLHYKIGKKIGEGSFGVLFEGTNMINGV--------------------PVAIKFEPRK 103
           +VG+HY +G KIGEGSFGV+FEG N++N                      PVAIKFEPR+
Sbjct: 9   VVGIHYAVGPKIGEGSFGVIFEGENILNSNNNNSSNNSSSASTGTANPVDPVAIKFEPRR 68

Query: 104 TEAPQLRDEYKTYKILNGTPNIPYAYYFGQEGLHNILVIDLLGPSLEDLFDWCGRKFSVK 163
           ++APQLRDE++ Y+ILNG   IP+AYYFGQEG+HN+L+IDLLGPSLEDLF+WCG +FSVK
Sbjct: 69  SDAPQLRDEFRAYRILNGITGIPHAYYFGQEGMHNVLIIDLLGPSLEDLFEWCGHRFSVK 128

Query: 164 TVVQVAVQMITLIEDLHAHDLIYRDIKPDNFLIGR------PGQ----------PDANNI 207
           T   VA QMI  +  +H  DLIYRDIKPDNFLI         GQ           D N I
Sbjct: 129 TTCMVAKQMIDRVRSIHQRDLIYRDIKPDNFLISEYQRELPTGQILRSCSSSSNGDPNLI 188

Query: 208 HLIDFGMAKQYRDPKTKQHIPYREKKSLSGTARYMSINTHLGREQSRRDDMEALGHVFFY 267
           +++DFGMAKQYRDPKTKQHIPYRE+KSLSGTARYMSINTH GREQSRRDD+E+LGHVFFY
Sbjct: 189 YVVDFGMAKQYRDPKTKQHIPYRERKSLSGTARYMSINTHFGREQSRRDDLESLGHVFFY 248

Query: 268 FLRGHLPWQGLKAPNNKQKYEKIG-EKKRSTNVYDLAQGLPVQFGRYLEIVRSLSFEECP 326
           FLRG LPWQGLKAPNNK KYEKIG  K+R +    L+ G+P QF  YL+  R+L F+E P
Sbjct: 249 FLRGSLPWQGLKAPNNKLKYEKIGTTKQRLSPEKLLSDGIPEQFATYLKYCRNLKFDEDP 308

Query: 327 DYEGYRKLLLSVLDDLGETADGQYDWMKLNDGRGWDLNINKKPNLHGYGHPNPPNEKSR 385
           DY+    L+   L+  G   DG YDWM LN G+GW++ +N++ NLHGYG+P P ++K++
Sbjct: 309 DYDYLISLMDEALNTSGSVEDGHYDWMDLNQGQGWNIRVNRRANLHGYGNPTPRDQKAK 367

>KLLA0D03168g 265761..267278 some similarities with sp|P29295
           Saccharomyces cerevisiae YPL204w HRR25 casein kinase I,
           ser/thr/tyr protein kinase, hypothetical start
          Length = 505

 Score =  320 bits (821), Expect = e-103,   Method: Compositional matrix adjust.
 Identities = 155/293 (52%), Positives = 207/293 (70%), Gaps = 6/293 (2%)

Query: 65  VGLHYKIGKKIGEGSFGVLFEGTNMINGVPVAIKFEPRKTEAPQLRDEYKTYKILNGTPN 124
           VG  ++IG+KIG GSFG ++ GTN+I+G  VAIK EP +T+ PQL  E + YK L+G   
Sbjct: 5   VGRKFRIGRKIGSGSFGDIYHGTNLISGEEVAIKLEPIRTKHPQLDYESRVYKYLSGGIG 64

Query: 125 IPYAYYFGQEGLHNILVIDLLGPSLEDLFDWCGRKFSVKTVVQVAVQMITLIEDLHAHDL 184
           IP+  +FG+EG +N +VIDLLGPSLEDLF++C RKFS KTV+ +A+QMI  I+ +H    
Sbjct: 65  IPFIRWFGKEGEYNAMVIDLLGPSLEDLFNYCHRKFSFKTVIMLALQMICRIQYIHGRSF 124

Query: 185 IYRDIKPDNFL--IGRPGQPDANNIHLIDFGMAKQYRDPKTKQHIPYREKKSLSGTARYM 242
           I+RDIKPDNFL  +GR G    + +H+IDFG++K+YRD ++  HIPYRE K+L+GTARY 
Sbjct: 125 IHRDIKPDNFLMGVGRRG----STVHVIDFGLSKKYRDFRSHNHIPYRENKNLTGTARYA 180

Query: 243 SINTHLGREQSRRDDMEALGHVFFYFLRGHLPWQGLKAPNNKQKYEKIGEKKRSTNVYDL 302
           S+NTHLG EQSRRDD+E+LG+V  YF +G LPWQGL+A   +QKY++I EKK    V  L
Sbjct: 181 SVNTHLGIEQSRRDDLESLGYVLIYFCKGSLPWQGLRATTKRQKYDRIMEKKLCITVEQL 240

Query: 303 AQGLPVQFGRYLEIVRSLSFEECPDYEGYRKLLLSVLDDLGETADGQYDWMKL 355
            QGLP++F  Y+   R+L F+E PDY    +L   +   L    D  +DW  L
Sbjct: 241 CQGLPMEFVEYMRYCRNLRFDERPDYMYLARLFKDLFIKLEYHNDHLFDWTML 293

>AFL091W [3102] [Homologous to ScYPL204W (HRR25) - SH]
           complement(272431..273867) [1437 bp, 478 aa]
          Length = 478

 Score =  317 bits (812), Expect = e-102,   Method: Compositional matrix adjust.
 Identities = 154/293 (52%), Positives = 208/293 (70%), Gaps = 6/293 (2%)

Query: 65  VGLHYKIGKKIGEGSFGVLFEGTNMINGVPVAIKFEPRKTEAPQLRDEYKTYKILNGTPN 124
           VG  ++IG+KIG GSFG ++ GTN+I+G  VAIK EP +T+ PQL  E + YK L+G   
Sbjct: 5   VGRKFRIGRKIGSGSFGDIYHGTNLISGEEVAIKLEPIRTKHPQLDYESRVYKYLSGGIG 64

Query: 125 IPYAYYFGQEGLHNILVIDLLGPSLEDLFDWCGRKFSVKTVVQVAVQMITLIEDLHAHDL 184
           IP+  +FG+EG +N +VIDLLGPSLEDLF++C RKFS+KTV+ +A+QMI  I+ +H    
Sbjct: 65  IPFIRWFGREGDYNAMVIDLLGPSLEDLFNYCHRKFSLKTVMMLALQMICRIQYIHGRSF 124

Query: 185 IYRDIKPDNFL--IGRPGQPDANNIHLIDFGMAKQYRDPKTKQHIPYREKKSLSGTARYM 242
           I+RDIKPDNFL  +GR G    + +H+IDFG++K++RD +T  HIPYRE K+L+GTARY 
Sbjct: 125 IHRDIKPDNFLMGVGRRG----STVHVIDFGLSKKFRDFRTHNHIPYRENKNLTGTARYA 180

Query: 243 SINTHLGREQSRRDDMEALGHVFFYFLRGHLPWQGLKAPNNKQKYEKIGEKKRSTNVYDL 302
           S+NTHLG EQSRRDD+E+LG+V  YF +G LPWQGL+A   +QKY++I EKK   +V  L
Sbjct: 181 SVNTHLGIEQSRRDDLESLGYVLIYFCKGSLPWQGLRATTKRQKYDRIMEKKLCISVEQL 240

Query: 303 AQGLPVQFGRYLEIVRSLSFEECPDYEGYRKLLLSVLDDLGETADGQYDWMKL 355
             GLP++F  Y+   R+L F+E PDY    +L   +   L    D  +DW  L
Sbjct: 241 CVGLPIEFVEYMRYCRNLRFDERPDYMYVARLFKDLSIKLEYHNDHLFDWTML 293

>Kwal_56.24064
          Length = 475

 Score =  316 bits (810), Expect = e-102,   Method: Compositional matrix adjust.
 Identities = 156/293 (53%), Positives = 204/293 (69%), Gaps = 6/293 (2%)

Query: 65  VGLHYKIGKKIGEGSFGVLFEGTNMINGVPVAIKFEPRKTEAPQLRDEYKTYKILNGTPN 124
           VG  Y+IG+KIG GSFG ++ GTN+I+G  VAIK E  ++  PQL  E + YK L+G   
Sbjct: 5   VGRKYRIGRKIGSGSFGDIYHGTNLISGEEVAIKLESIRSRHPQLDYESRVYKYLSGGIG 64

Query: 125 IPYAYYFGQEGLHNILVIDLLGPSLEDLFDWCGRKFSVKTVVQVAVQMITLIEDLHAHDL 184
           IP+  +FG+EG +N +VIDLLGPSLEDLF++C RKFS KTV+ +A+QMI  I+ +H    
Sbjct: 65  IPFIRWFGREGEYNAMVIDLLGPSLEDLFNYCHRKFSFKTVIMLALQMICRIQYIHGRSF 124

Query: 185 IYRDIKPDNFL--IGRPGQPDANNIHLIDFGMAKQYRDPKTKQHIPYREKKSLSGTARYM 242
           I+RDIKPDNFL  +GR G    + +H+IDFG++K+YRD  T  HIPYRE K+L+GTARY 
Sbjct: 125 IHRDIKPDNFLMGVGRRG----STVHVIDFGLSKKYRDFSTHHHIPYRENKNLTGTARYA 180

Query: 243 SINTHLGREQSRRDDMEALGHVFFYFLRGHLPWQGLKAPNNKQKYEKIGEKKRSTNVYDL 302
           S+NTHLG EQSRRDD+E+LG+V  YF +G LPWQGLKA   +QKY++I EKK   NV  L
Sbjct: 181 SVNTHLGIEQSRRDDLESLGYVLIYFCKGSLPWQGLKATTKRQKYDRIMEKKLCINVEQL 240

Query: 303 AQGLPVQFGRYLEIVRSLSFEECPDYEGYRKLLLSVLDDLGETADGQYDWMKL 355
             GLP++F  Y+   R+L F+E PDY    +L   +   L    D  +DW  L
Sbjct: 241 CAGLPMEFVEYMRYCRNLRFDERPDYLYLARLFKDLGIKLDYHNDHLFDWTML 293

>CAGL0H03553g complement(328668..330155) highly similar to sp|P29295
           Saccharomyces cerevisiae YPL204w HRR25, start by
           similarity
          Length = 495

 Score =  316 bits (810), Expect = e-102,   Method: Compositional matrix adjust.
 Identities = 154/293 (52%), Positives = 205/293 (69%), Gaps = 6/293 (2%)

Query: 65  VGLHYKIGKKIGEGSFGVLFEGTNMINGVPVAIKFEPRKTEAPQLRDEYKTYKILNGTPN 124
           VG  ++IG+KIG GSFG ++ GTN+I+G  VAIK E  ++  PQL  E + YK L+G   
Sbjct: 5   VGRKFRIGRKIGSGSFGDIYHGTNLISGEEVAIKLESIRSRHPQLDYESRVYKYLSGGVG 64

Query: 125 IPYAYYFGQEGLHNILVIDLLGPSLEDLFDWCGRKFSVKTVVQVAVQMITLIEDLHAHDL 184
           IP+  +FG+EG +N +VIDLLGPSLEDLF++C RKFS KTV+ +A+QMI  ++ +H    
Sbjct: 65  IPFIRWFGREGEYNAMVIDLLGPSLEDLFNYCHRKFSFKTVIMLALQMICRVQYIHGRSF 124

Query: 185 IYRDIKPDNFL--IGRPGQPDANNIHLIDFGMAKQYRDPKTKQHIPYREKKSLSGTARYM 242
           I+RDIKPDNFL  +GR G    + +H+IDFG++K+YRD  T +HIPYRE KSL+GTARY 
Sbjct: 125 IHRDIKPDNFLMGVGRRG----STVHVIDFGLSKKYRDFNTHRHIPYRENKSLTGTARYA 180

Query: 243 SINTHLGREQSRRDDMEALGHVFFYFLRGHLPWQGLKAPNNKQKYEKIGEKKRSTNVYDL 302
           S+NTHLG EQSRRDD+E+LG++  YF +G LPWQGLKA   KQKY++I EKK   +V  L
Sbjct: 181 SVNTHLGIEQSRRDDLESLGYMLIYFCKGSLPWQGLKATTKKQKYDRILEKKLCISVETL 240

Query: 303 AQGLPVQFGRYLEIVRSLSFEECPDYEGYRKLLLSVLDDLGETADGQYDWMKL 355
             GLP++F  Y+   R+L F+E PDY    +L   +   L    D  +DW  L
Sbjct: 241 CAGLPLEFSEYMNYCRNLKFDERPDYLYLARLFKDLSIKLEYHNDHLFDWTML 293

>Scas_720.24
          Length = 473

 Score =  315 bits (807), Expect = e-102,   Method: Compositional matrix adjust.
 Identities = 151/291 (51%), Positives = 204/291 (70%), Gaps = 2/291 (0%)

Query: 65  VGLHYKIGKKIGEGSFGVLFEGTNMINGVPVAIKFEPRKTEAPQLRDEYKTYKILNGTPN 124
           VG  ++IG+KIG GSFG ++ GTN+I+G  VAIK E  ++  PQL  E + YK L+G   
Sbjct: 5   VGRKFRIGRKIGSGSFGDIYHGTNLISGEEVAIKLESIRSRHPQLDYESRVYKYLSGGVG 64

Query: 125 IPYAYYFGQEGLHNILVIDLLGPSLEDLFDWCGRKFSVKTVVQVAVQMITLIEDLHAHDL 184
           IP+  +FG+EG +N +VIDLLGPSLEDLF++C RKF+ KTV+ +A+QMI  ++ +H    
Sbjct: 65  IPFIRWFGREGEYNAMVIDLLGPSLEDLFNYCHRKFTFKTVIMLALQMICRVQYIHGRSF 124

Query: 185 IYRDIKPDNFLIGRPGQPDANNIHLIDFGMAKQYRDPKTKQHIPYREKKSLSGTARYMSI 244
           I+RDIKPDNFL+G   +   + +H+IDFG++K+YRD  T +HIPYRE KSL+GTARY S+
Sbjct: 125 IHRDIKPDNFLMGTGRR--GSTVHVIDFGLSKKYRDFNTHRHIPYRENKSLTGTARYASV 182

Query: 245 NTHLGREQSRRDDMEALGHVFFYFLRGHLPWQGLKAPNNKQKYEKIGEKKRSTNVYDLAQ 304
           NTHLG EQSRRDD+E+LG++  YF +G LPWQGLKA   KQKY++I EKK   +V  L  
Sbjct: 183 NTHLGIEQSRRDDLESLGYMLVYFCKGSLPWQGLKATTKKQKYDRILEKKLCISVETLCA 242

Query: 305 GLPVQFGRYLEIVRSLSFEECPDYEGYRKLLLSVLDDLGETADGQYDWMKL 355
           GLP++F  Y+   R+L F+E PDY    +L   +   L    D  +DW  L
Sbjct: 243 GLPIEFADYMNYCRNLKFDERPDYLYLARLFKDLSIKLEYHNDHLFDWTML 293

>Sklu_1892.3 YPL204W, Contig c1892 5770-7194
          Length = 474

 Score =  314 bits (805), Expect = e-101,   Method: Compositional matrix adjust.
 Identities = 154/293 (52%), Positives = 204/293 (69%), Gaps = 6/293 (2%)

Query: 65  VGLHYKIGKKIGEGSFGVLFEGTNMINGVPVAIKFEPRKTEAPQLRDEYKTYKILNGTPN 124
           VG  ++IG+KIG GSFG ++ GTN+I+G  VAIK E  ++  PQL  E + YK L+G   
Sbjct: 5   VGRKFRIGRKIGSGSFGDIYHGTNLISGEEVAIKLESIRSRHPQLDYESRVYKYLSGGIG 64

Query: 125 IPYAYYFGQEGLHNILVIDLLGPSLEDLFDWCGRKFSVKTVVQVAVQMITLIEDLHAHDL 184
           IP+  +FG+EG +N +VIDLLGPSLEDLF++C RKFS KTV+ +A+QMI  I+ +H    
Sbjct: 65  IPFIRWFGREGEYNAMVIDLLGPSLEDLFNYCHRKFSFKTVIMLALQMICRIQYIHGRSF 124

Query: 185 IYRDIKPDNFL--IGRPGQPDANNIHLIDFGMAKQYRDPKTKQHIPYREKKSLSGTARYM 242
           I+RDIKPDNFL  +GR G    + +H+IDFG++K+YRD  T  HIPYRE K+L+GTARY 
Sbjct: 125 IHRDIKPDNFLMGVGRRG----STVHVIDFGLSKKYRDFSTHHHIPYRENKNLTGTARYA 180

Query: 243 SINTHLGREQSRRDDMEALGHVFFYFLRGHLPWQGLKAPNNKQKYEKIGEKKRSTNVYDL 302
           S+NTHLG EQSRRDD+E+LG+V  YF +G LPWQGLKA   +QKY++I EKK   +V  L
Sbjct: 181 SLNTHLGIEQSRRDDLESLGYVLIYFCKGSLPWQGLKATTKRQKYDRIMEKKLCISVEQL 240

Query: 303 AQGLPVQFGRYLEIVRSLSFEECPDYEGYRKLLLSVLDDLGETADGQYDWMKL 355
             GLP++F  Y+   R+L F+E PDY    +L   +   L    D  +DW  L
Sbjct: 241 CAGLPMEFVEYMRYCRNLRFDERPDYLYLARLFKDLSIKLEYHNDHLFDWTML 293

>YPL204W (HRR25) [5244] chr16 (164275..165759) Casein kinase I
           (serine/threonine/tyrosine protein kinase) involved in
           DNA repair and meiosis [1485 bp, 494 aa]
          Length = 494

 Score =  312 bits (800), Expect = e-100,   Method: Compositional matrix adjust.
 Identities = 152/293 (51%), Positives = 205/293 (69%), Gaps = 6/293 (2%)

Query: 65  VGLHYKIGKKIGEGSFGVLFEGTNMINGVPVAIKFEPRKTEAPQLRDEYKTYKILNGTPN 124
           VG  ++IG+KIG GSFG ++ GTN+I+G  VAIK E  ++  PQL  E + Y+ L+G   
Sbjct: 5   VGRKFRIGRKIGSGSFGDIYHGTNLISGEEVAIKLESIRSRHPQLDYESRVYRYLSGGVG 64

Query: 125 IPYAYYFGQEGLHNILVIDLLGPSLEDLFDWCGRKFSVKTVVQVAVQMITLIEDLHAHDL 184
           IP+  +FG+EG +N +VIDLLGPSLEDLF++C R+FS KTV+ +A+QM   I+ +H    
Sbjct: 65  IPFIRWFGREGEYNAMVIDLLGPSLEDLFNYCHRRFSFKTVIMLALQMFCRIQYIHGRSF 124

Query: 185 IYRDIKPDNFL--IGRPGQPDANNIHLIDFGMAKQYRDPKTKQHIPYREKKSLSGTARYM 242
           I+RDIKPDNFL  +GR G    + +H+IDFG++K+YRD  T +HIPYRE KSL+GTARY 
Sbjct: 125 IHRDIKPDNFLMGVGRRG----STVHVIDFGLSKKYRDFNTHRHIPYRENKSLTGTARYA 180

Query: 243 SINTHLGREQSRRDDMEALGHVFFYFLRGHLPWQGLKAPNNKQKYEKIGEKKRSTNVYDL 302
           S+NTHLG EQSRRDD+E+LG+V  YF +G LPWQGLKA   KQKY++I EKK + +V  L
Sbjct: 181 SVNTHLGIEQSRRDDLESLGYVLIYFCKGSLPWQGLKATTKKQKYDRIMEKKLNVSVETL 240

Query: 303 AQGLPVQFGRYLEIVRSLSFEECPDYEGYRKLLLSVLDDLGETADGQYDWMKL 355
             GLP++F  Y+   ++L F+E PDY    +L   +   L    D  +DW  L
Sbjct: 241 CSGLPLEFQEYMAYCKNLKFDEKPDYLFLARLFKDLSIKLEYHNDHLFDWTML 293

>Scas_690.12
          Length = 488

 Score =  270 bits (689), Expect = 3e-84,   Method: Compositional matrix adjust.
 Identities = 134/289 (46%), Positives = 192/289 (66%), Gaps = 3/289 (1%)

Query: 65  VGLHYKIGKKIGEGSFGVLFEGTNMINGVPVAIKFEPRKTEAPQLRDEYKTYKIL-NGTP 123
           VG  Y++G++IG GSFG ++ G ++I+G  +AIK E  +T  PQL  E + Y  + +G+ 
Sbjct: 5   VGKRYRVGRRIGGGSFGEIYHGIDLISGEEIAIKLESSETRHPQLEYESRVYNFVSDGSM 64

Query: 124 NIPYAYYFGQEGLHNILVIDLLGPSLEDLFDWCGRKFSVKTVVQVAVQMITLIEDLHAHD 183
            IP    F +   ++ LV+DLLGPSLEDLF++C R FS KT+  +A QMI  +  +H   
Sbjct: 65  GIPNIRMFERGFGYSALVMDLLGPSLEDLFNYCHRSFSYKTIFMLAWQMIARVAYVHGKS 124

Query: 184 LIYRDIKPDNFLIGRPGQPDANNIHLIDFGMAKQYRDPKTKQHIPYREKKSLSGTARYMS 243
            ++RDIKP+NFL+G   +  AN ++LIDFG++K+YRD  + +H P +  KSL GTARY S
Sbjct: 125 FLHRDIKPENFLLGTGRR--ANIVNLIDFGLSKKYRDFNSHRHNPRKTHKSLVGTARYAS 182

Query: 244 INTHLGREQSRRDDMEALGHVFFYFLRGHLPWQGLKAPNNKQKYEKIGEKKRSTNVYDLA 303
           +NTH G EQSRRDD+E+LG+V  YF +GHLPWQGL+A   KQKY++I ++K       L 
Sbjct: 183 VNTHFGIEQSRRDDLESLGYVLVYFAKGHLPWQGLRATTKKQKYDRILQRKLCITTDILC 242

Query: 304 QGLPVQFGRYLEIVRSLSFEECPDYEGYRKLLLSVLDDLGETADGQYDW 352
           +GLP QF  Y+  VRSL +++ PDY    +L  ++ + L  T D  +DW
Sbjct: 243 EGLPSQFVAYMGYVRSLQYDQRPDYVYLEQLFKNLSEQLNYTNDYLFDW 291

>KLLA0C08525g 744554..749209 similar to sp|P53599 Saccharomyces
            cerevisiae YNR031c SSK2 MAP kinase kinase kinase of the
            high osmolarity signal transduction pathway, start by
            similarity
          Length = 1551

 Score = 75.9 bits (185), Expect = 4e-14,   Method: Compositional matrix adjust.
 Identities = 71/222 (31%), Positives = 105/222 (47%), Gaps = 29/222 (13%)

Query: 75   IGEGSFGVLFEGTNMINGVPVAIK------FEPRKTEAPQLRDEYKTYKILNGTPNIPYA 128
            IG GSFG ++   N+  G  +A+K       +  K   P L++E +  +ILN  PNI   
Sbjct: 1265 IGSGSFGTVYSAVNLDTGDILAVKEIKIQDAKSMKQIFPSLKEEMRVMEILNH-PNI--V 1321

Query: 129  YYFGQEGLH----NILVIDLLGPSLEDLFDWCGRKFSVKTVVQV-AVQMITLIEDLHAHD 183
             Y+G E +H    NI +    G SL  L +  GR    + V QV  +Q++  +  LH   
Sbjct: 1322 QYYGVE-VHRDKVNIFMEFCEGSSLASLLE-HGR-IEDEMVTQVYTLQLLEGLACLHQSG 1378

Query: 184  LIYRDIKPDNFLIGRPGQPDANNIHLIDFGMAKQYRDPKTKQHIPYREKKS-----LSGT 238
            +++RDIKP+N L+ R G      I  +DFG AK      +K+       KS     + GT
Sbjct: 1379 VVHRDIKPENILLDRNGV-----IKYVDFGAAKLIAKNGSKRISLDANNKSTGGKDMIGT 1433

Query: 239  ARYMSINTHLGREQSR--RDDMEALGHVFFYFLRGHLPWQGL 278
              YM+  T  G+   +   DD+ +LG V    + G  PW  L
Sbjct: 1434 PMYMAPETVTGQGHGKFGSDDIWSLGCVVLEMVTGRRPWANL 1475

>AAR009W [195] [Homologous to ScYOL016C (CMK2) - SH; ScYFR014C
           (CMK1) - SH] complement(358947..360308) [1362 bp, 453
           aa]
          Length = 453

 Score = 72.8 bits (177), Expect = 2e-13,   Method: Compositional matrix adjust.
 Identities = 57/213 (26%), Positives = 103/213 (48%), Gaps = 18/213 (8%)

Query: 69  YKIGKKIGEGSFGVLFEGTNMINGVPVAIKFEPRKT----EAPQLRDEYKTYKILNGTPN 124
           Y  GK +G G+FGV+ +  N      VAIK   ++     E   L DE    + L+    
Sbjct: 56  YIFGKTLGAGAFGVVRQARNSKQNQNVAIKILLKRALKGNELQMLYDELSILQKLDHPNI 115

Query: 125 IPYAYYFGQEGLHNILVIDLLGPSLEDLFDWCGRK--FSVKTVVQVAVQMITLIEDLHAH 182
           + +  +F  E      ++  L    E LFD   +K  F+    V++ VQM+T +E +H+ 
Sbjct: 116 VKFKDWF--ESREKFYIVTQLATGGE-LFDRILKKGKFTETDAVKIVVQMLTAVEYMHSQ 172

Query: 183 DLIYRDIKPDNFLIGRPGQPDANNIHLIDFGMAKQYRDPKTKQHIPYREKKSLSGTARYM 242
           ++++RD+KP+N L   P   D + + + DFG+AKQ     ++  + +R     +G+  Y+
Sbjct: 173 NVVHRDLKPENVLYLDPS--DESQLVISDFGIAKQL---SSESQLIHRA----AGSMGYV 223

Query: 243 SINTHLGREQSRRDDMEALGHVFFYFLRGHLPW 275
           +          +  D+ +LG + +  L G+ P+
Sbjct: 224 APEVLTTSGHGKPCDIWSLGVITYTLLCGYSPF 256

>Scas_618.8
          Length = 427

 Score = 72.4 bits (176), Expect = 2e-13,   Method: Compositional matrix adjust.
 Identities = 58/213 (27%), Positives = 106/213 (49%), Gaps = 22/213 (10%)

Query: 69  YKIGKKIGEGSFGVLFEGTNMINGVPVAIK------FEPRKTEAPQLRDEYKTYKILNGT 122
           Y+ GK +G GSFGV+ E T   N   VAIK       E  + +   L DE    K L+  
Sbjct: 27  YEFGKTLGAGSFGVVREATKKSNNEEVAIKILLKKALEGNQVQLQMLYDELTILKKLHHP 86

Query: 123 PNIPYAYYFGQEGLHNILVIDLLGPSLEDLFDWCGRK--FSVKTVVQVAVQMITLIEDLH 180
             + +  +F  E    I ++  L    E LFD   +K  FS    V++ +Q+++ +E +H
Sbjct: 87  NIVEFKNWF--ETDDKIYIVTQLATGGE-LFDRIIKKGRFSEDDAVKILIQILSAVEYIH 143

Query: 181 AHDLIYRDIKPDNFLIGRPGQPDANNIHLIDFGMAKQYRDPKTKQHIPYREKKSLSGTA- 239
           + D+++RD+KP+N L     + + + + + DFG+AK+    K  + + ++   SL   A 
Sbjct: 144 SRDIVHRDLKPENLL--YLTEKEDSELVIADFGIAKEL---KKGEQLIFKAAGSLGYVAP 198

Query: 240 RYMSINTHLGREQSRRDDMEALGHVFFYFLRGH 272
             ++++ H      +  D+ ++G + +  L G+
Sbjct: 199 EVLTVDGH-----GKPCDIWSIGVITYTLLSGY 226

>AER264C [2766] [Homologous to ScYCR073C (SSK22) - SH; ScYNR031C
            (SSK2) - SH] (1120017..1124468) [4452 bp, 1483 aa]
          Length = 1483

 Score = 72.0 bits (175), Expect = 6e-13,   Method: Compositional matrix adjust.
 Identities = 74/232 (31%), Positives = 107/232 (46%), Gaps = 32/232 (13%)

Query: 65   VGLHYKIGKKIGEGSFGVLFEGTNMINGVPVA---IKFEPRKTEA---PQLRDEYKTYKI 118
            V + ++    IG GSFG ++   N+  G  +A   IKF  RKT     P +RDE    ++
Sbjct: 1187 VSIKWQKRSFIGGGSFGSVYSAVNLDTGDILAVKEIKFNDRKTIKQVFPSIRDEMTVLEM 1246

Query: 119  LNGTPNIPYAYYFGQEGLH----NILVIDLLGPSLEDLFDWCGRKFSVKTVVQV-AVQMI 173
            LN  PN+    Y+G E +H    NI +    G SL  L      +   + V QV ++QM+
Sbjct: 1247 LNH-PNV--VQYYGVE-VHRDRVNIFMEYCEGGSLASLL--AHGRIEDEMVTQVYSLQML 1300

Query: 174  TLIEDLHAHDLIYRDIKPDNFLIGRPGQPDANNIHLIDFGMAKQYRDPKTK-----QHIP 228
              +  LH   + +RDIKP+N L+   G      I  +DFG AK      +K     QH+ 
Sbjct: 1301 EGLAYLHESGVDHRDIKPENILLDFNGI-----IKYVDFGAAKVLASNGSKKLNLEQHM- 1354

Query: 229  YREKKSLSGTARYMSINTHLGREQSR--RDDMEALGHVFFYFLRGHLPWQGL 278
              E + + GT  YMS     G    +   DD+ +LG V    + G  PW  L
Sbjct: 1355 --EGEKMIGTPMYMSPEAISGTGYGKFGSDDIWSLGCVILEMVTGRRPWANL 1404

>Kwal_26.7355
          Length = 1446

 Score = 71.6 bits (174), Expect = 7e-13,   Method: Compositional matrix adjust.
 Identities = 62/227 (27%), Positives = 107/227 (47%), Gaps = 37/227 (16%)

Query: 72   GKKIGEGSFGVLFEGTNMINGVPVAIKFEPRKTEAPQ--------------LRDEYKTYK 117
            G+ IG+GSFG +F G N+  G  +A+K    + E P+              LR E  T K
Sbjct: 1149 GEMIGKGSFGSVFLGLNVTTGEMIAVK----QVEVPRYGSQDETTLSVLEALRSEVATLK 1204

Query: 118  ILNGTPNIPYAYYFGQEGLHNILVIDLLGPSLEDLFDWCGRKFSVKTVVQVAVQMITLIE 177
             L+ T  + Y  +  +  ++++ +  + G S+  L    G KF    +  +AVQ++  + 
Sbjct: 1205 DLDHTNIVQYLGFENKNYVYSLFLEYVAGGSVGSLIRLYG-KFDENLIRFLAVQVLRGLS 1263

Query: 178  DLHAHDLIYRDIKPDNFLIGRPGQPDANNIHLI-DFGMAKQYRDPKTKQHIPYREKKSLS 236
             LH+  +++RD+K DN L+      D + I  I DFG++K+  +  +   +  R      
Sbjct: 1264 YLHSKKILHRDMKADNLLL------DVDGICKISDFGISKKSNNIYSNSDMTMR------ 1311

Query: 237  GTARYMS---INTHLGREQSRRDDMEALGHVFFYFLRGHLPWQGLKA 280
            GT  +M+   ++T  G   S + D+ +LG V      G  PW  L+ 
Sbjct: 1312 GTVFWMAPEMVDTKQG--YSAKVDIWSLGCVVLEMFAGKRPWSNLEV 1356

>Kwal_23.6325
          Length = 1542

 Score = 70.1 bits (170), Expect = 2e-12,   Method: Compositional matrix adjust.
 Identities = 69/232 (29%), Positives = 111/232 (47%), Gaps = 29/232 (12%)

Query: 65   VGLHYKIGKKIGEGSFGVLFEGTNMINGVPVA---IKFEPRKTEA---PQLRDEYKTYKI 118
            V + ++  + +G G+FG +F   N+  G  +A   IK + RK+     P +++E    ++
Sbjct: 1245 VSIRWQKRQFVGGGAFGTVFSAVNLDTGEILAVKEIKIQDRKSMKQVFPAIKEEMSVLEM 1304

Query: 119  LNGTPNIPYAYYFGQEGLH----NILVIDLLGPSLEDLFDWCGRKFSVKTVVQV-AVQMI 173
            LN  PN+    Y+G E +H    N+ +    G SL  L +  GR    + V Q+ A+QM+
Sbjct: 1305 LNH-PNV--VQYYGVE-VHRDKVNLFMEYCEGGSLAQLLEH-GR-IEDEMVTQIYALQML 1358

Query: 174  TLIEDLHAHDLIYRDIKPDNFLIGRPGQPDANNIHLIDFGMAKQYRDPKTKQHIPYREKK 233
              +  LH   +++RDIKP+N L+   G      I  +DFG A+      TK      E K
Sbjct: 1359 EGLAYLHQSSVVHRDIKPENILLDFNGV-----IKYVDFGAARSLAANGTKAPNVGAEGK 1413

Query: 234  -----SLSGTARYMSINTHLGREQSR--RDDMEALGHVFFYFLRGHLPWQGL 278
                 S+ GT  YMS  +  G ++ +    D+ +LG V    + G  PW  L
Sbjct: 1414 ADGVNSMMGTPMYMSPESITGAKKGKFGSGDIWSLGCVILEMVTGRRPWFNL 1465

>Sklu_2429.5 YOL016C, Contig c2429 9000-10298 reverse complement
          Length = 432

 Score = 67.4 bits (163), Expect = 7e-12,   Method: Compositional matrix adjust.
 Identities = 55/215 (25%), Positives = 101/215 (46%), Gaps = 20/215 (9%)

Query: 69  YKIGKKIGEGSFGVLFEGTNMINGVPVAIKFEPRK------TEAPQLRDEYKTYKILNGT 122
           Y  GK +G GSFGV+ +   +  G  VA+K   +K       +   L DE    + LN  
Sbjct: 46  YIFGKTLGAGSFGVVRQARKISTGDNVAVKILLKKALKGNDVQLQMLYDELMILQKLNHP 105

Query: 123 PNIPYAYYFGQEGLHNILVIDLLGPSLEDLFDWCGRK--FSVKTVVQVAVQMITLIEDLH 180
             + +  +F  E      ++  L    E LFD   +K  F+    V++ VQ++  +E LH
Sbjct: 106 NIVKFKDWF--ESKEKFYIVTQLATGGE-LFDRILQKGKFTEVDAVKIVVQILKAVEYLH 162

Query: 181 AHDLIYRDIKPDNFLIGRPGQPDANNIHLIDFGMAKQYRDPKTKQHIPYREKKSLSGTAR 240
           + ++++RD+KP+N L     + D + + L DFG+AK+ ++     H         +G+  
Sbjct: 163 SRNIVHRDLKPENLLY--LDKSDNSQLVLGDFGIAKELKNDGDLIH-------KAAGSMG 213

Query: 241 YMSINTHLGREQSRRDDMEALGHVFFYFLRGHLPW 275
           Y++          +  D+ ++G + +  L G+ P+
Sbjct: 214 YVAPEVLTSNGHGKPCDIWSIGVITYTLLCGYSPF 248

>YJL095W (BCK1) [2820] chr10 (247171..251607) Serine/threonine protein
            kinase of the MEKK family involved in the cell wall
            integrity (low-osmolarity) and nutrient sensing pathways
            [4437 bp, 1478 aa]
          Length = 1478

 Score = 68.6 bits (166), Expect = 8e-12,   Method: Compositional matrix adjust.
 Identities = 65/273 (23%), Positives = 123/273 (45%), Gaps = 39/273 (14%)

Query: 72   GKKIGEGSFGVLFEGTNMINGVPVAIKFEPRKTEAPQ--------------LRDEYKTYK 117
            G+ IG+GSFG ++   N+  G  +A+K    + E P+              LR E  T K
Sbjct: 1178 GEMIGKGSFGAVYLCLNVTTGEMMAVK----QVEVPKYSSQNEAILSTVEALRSEVSTLK 1233

Query: 118  ILNGTPNIPYAYYFGQEGLHNILVIDLLGPSLEDLFDWCGRKFSVKTVVQVAVQMITLIE 177
             L+    + Y  +  +  ++++ +  + G S+  L    GR F    +  +  Q++  + 
Sbjct: 1234 DLDHLNIVQYLGFENKNNIYSLFLEYVAGGSVGSLIRMYGR-FDEPLIKHLTTQVLKGLA 1292

Query: 178  DLHAHDLIYRDIKPDNFLIGRPGQPDANNIHLIDFGMAKQYRDPKTKQHIPYREKKSLSG 237
             LH+  +++RD+K DN L+ + G        + DFG++++ +D  +   +  R      G
Sbjct: 1293 YLHSKGILHRDMKADNLLLDQDGI-----CKISDFGISRKSKDIYSNSDMTMR------G 1341

Query: 238  TARYMS---INTHLGREQSRRDDMEALGHVFFYFLRGHLPWQGLKAPNNKQKYEKIGEKK 294
            T  +M+   ++T  G   S + D+ +LG +      G  PW  L+         KIG+ K
Sbjct: 1342 TVFWMAPEMVDTKQG--YSAKVDIWSLGCIVLEMFAGKRPWSNLEV---VAAMFKIGKSK 1396

Query: 295  RSTNVYDLAQGLPVQFGR-YLEIVRSLSFEECP 326
             +  + +    L  Q GR +L+    ++ E+ P
Sbjct: 1397 SAPPIPEDTLPLISQIGRNFLDACFEINPEKRP 1429

>Kwal_0.96
          Length = 427

 Score = 65.5 bits (158), Expect = 3e-11,   Method: Compositional matrix adjust.
 Identities = 56/215 (26%), Positives = 101/215 (46%), Gaps = 20/215 (9%)

Query: 69  YKIGKKIGEGSFGVLFEGTNMINGVPVAIKFEPRK------TEAPQLRDEYKTYKILNGT 122
           Y  GK +G GSFGV+ +   + +G  VAIK   +K       E   L DE    + L+  
Sbjct: 46  YIFGKTLGAGSFGVVRQARQVSSGENVAIKILLKKALKGKDVELQMLYDELSILQKLDHP 105

Query: 123 PNIPYAYYFGQEGLHNILVIDLLGPSLEDLFDWCGR--KFSVKTVVQVAVQMITLIEDLH 180
             + +  +F  E      ++  L    E LFD   +  KF+ +  V++  Q++  +E LH
Sbjct: 106 NIVKFKDWF--ESKDKFYIVTQLATGGE-LFDRILKQGKFTEEDAVRIVYQILKAVEYLH 162

Query: 181 AHDLIYRDIKPDNFLIGRPGQPDANNIHLIDFGMAKQYRDPKTKQHIPYREKKSLSGTAR 240
           + ++++RD+KP+N L     +   + + L DFG+AK+ ++     H         +G+  
Sbjct: 163 SRNIVHRDLKPENLLY--LTEAADSQLVLGDFGIAKELKNDDELIH-------KAAGSMG 213

Query: 241 YMSINTHLGREQSRRDDMEALGHVFFYFLRGHLPW 275
           Y++          +  D+ +LG V +  L G+ P+
Sbjct: 214 YVAPEVVTTSGHGKPCDIWSLGVVTYTLLCGYSPF 248

>CAGL0L03520g complement(401103..405446) similar to sp|Q01389
            Saccharomyces cerevisiae YJL095w BCK1, start by
            similarity
          Length = 1447

 Score = 66.6 bits (161), Expect = 3e-11,   Method: Compositional matrix adjust.
 Identities = 60/229 (26%), Positives = 104/229 (45%), Gaps = 41/229 (17%)

Query: 72   GKKIGEGSFGVLFEGTNMINGVPVAIKFEPRKTEAPQ--------------LRDEYKTYK 117
            G+ IG+GSFG ++   N+  G  +A+K    + E P+              L+ E  T K
Sbjct: 1154 GEMIGKGSFGAVYLSLNITTGEMMAVK----QVEVPKYGTQNELVKDMVEALKSEVATLK 1209

Query: 118  ILNGTPNIPYAYYFGQEGLHNILVIDL---LGPSLEDLFDWCGRKFSVKTVVQVAVQMIT 174
             L+   ++    Y G E   NI  + L    G S+  L    GR F  K +  +  Q+++
Sbjct: 1210 DLD---HLNIVQYLGSEIRGNIYSLFLEYVAGGSVGSLIRLYGR-FDEKLIRHLNTQVLS 1265

Query: 175  LIEDLHAHDLIYRDIKPDNFLIGRPGQPDANNIHLIDFGMAKQYRDPKTKQHIPYREKKS 234
             ++ LH+  +++RD+K DN L+   G        + DFG++K+ ++  +   +  R    
Sbjct: 1266 GLKYLHSKGILHRDMKADNLLLDEDGI-----CKISDFGISKKSKNIYSNSDMTMR---- 1316

Query: 235  LSGTARYMS---INTHLGREQSRRDDMEALGHVFFYFLRGHLPWQGLKA 280
              GT  +M+   ++T  G   S + D+ +LG V      G  PW  L+ 
Sbjct: 1317 --GTVFWMAPEMVDTKQG--YSAKVDIWSLGCVVLEMFAGKRPWSNLEV 1361

>YDR490C (PKH1) [1306] chr4 complement(1431956..1434256)
           Serine/threonine protein kinase, functions similarly to
           mammalian 3-phosphoinositide-dependent protein kinase,
           phosphorylates and activates Ypk1p, required for
           endocytosis [2301 bp, 766 aa]
          Length = 766

 Score = 63.9 bits (154), Expect = 2e-10,   Method: Compositional matrix adjust.
 Identities = 67/242 (27%), Positives = 106/242 (43%), Gaps = 37/242 (15%)

Query: 69  YKIGKKIGEGSFGVLFEGTNMINGVPVAIKFEPRKTEAPQLRDEYKTY-----KILNGTP 123
           +K G+++G+GS+  +   T   +G   A+K   ++    Q + +Y T      + LNGT 
Sbjct: 125 FKFGEQLGDGSYSSVVLATARDSGKKYAVKVLSKEYLIRQKKVKYVTVEKLALQKLNGTK 184

Query: 124 NIPYAYYFGQEGLHNILVI------DLLG--PSLEDLFDWCGRKFSVKTVVQVAVQMITL 175
            I   ++  Q+      ++      D LG       L + C R +        A Q+I  
Sbjct: 185 GIFKLFFTFQDEASLYFLLEYAPHGDFLGLIKKYGSLNETCARYY--------ASQIIDA 236

Query: 176 IEDLHAHDLIYRDIKPDNFLIGRPGQPDAN-NIHLIDFGMAKQY-RDPK-TKQHIP---- 228
           ++ LH   +I+RDIKP+N L+      D N  + L DFG AK    +P  T    P    
Sbjct: 237 VDSLHNIGIIHRDIKPENILL------DKNMKVKLTDFGTAKILPEEPSNTADGKPYFDL 290

Query: 229 YREKKSLSGTARYMSINTHLGREQSRRDDMEALGHVFFYFLRGHLPWQGLKAPNNKQKYE 288
           Y + KS  GTA Y+S           R D+ A G + +  L G  P+   KA N    ++
Sbjct: 291 YAKSKSFVGTAEYVSPELLNDNYTDSRCDIWAFGCILYQMLAGKPPF---KAANEYLTFQ 347

Query: 289 KI 290
           K+
Sbjct: 348 KV 349

>Scas_711.25
          Length = 1515

 Score = 63.9 bits (154), Expect = 2e-10,   Method: Compositional matrix adjust.
 Identities = 69/284 (24%), Positives = 124/284 (43%), Gaps = 43/284 (15%)

Query: 72   GKKIGEGSFGVLFEGTNMINGVPVAIKFEPRKTEAPQ--------------LRDEYKTYK 117
            G+ IG+GSFG ++   N+  G  +A+K    + E P+              LR E  T K
Sbjct: 1217 GEMIGKGSFGAVYLCLNVTTGEMMAVK----QVEVPKYSSQDEAIISTVEALRSEVSTLK 1272

Query: 118  ILNGTPNIPYAYYFGQEGLHNILVIDLLGPSLEDLFDWCGRKFSVKTVVQVAVQMITLIE 177
             L+    + Y  +  ++ ++++ +  + G S+  L    GR F    +  +  Q++  + 
Sbjct: 1273 DLDHLNIVQYLGFENKDNIYSLFLEYVAGGSVGSLIRMYGR-FDEPLIRHLNTQVLRGLA 1331

Query: 178  DLHAHDLIYRDIKPDNFLIGRPGQPDANNIHLIDFGMAKQYRDPKTKQHIPYREKKSLSG 237
             LH+  +++RD+K DN L+ + G        + DFG++++ +D  +   +  R      G
Sbjct: 1332 YLHSRGILHRDMKADNLLLDQDGV-----CKISDFGISRKSKDIYSNSDMTMR------G 1380

Query: 238  TARYMS---INTHLGREQSRRDDMEALGHVFFYFLRGHLPWQGLKAPNNKQKYEKIGEKK 294
            T  +M+   ++T  G   S + D+ +LG +      G  PW   +         KIG+ K
Sbjct: 1381 TVFWMAPEMVDTKQG--YSAKVDIWSLGCIVLEMFAGKRPWSNYEV---VAAMFKIGKSK 1435

Query: 295  RSTNVYDLAQGLPVQFGR-YLEIVRSLSFEECPDYEGYRKLLLS 337
             +  +      L  Q GR +L+      FE  PD       LLS
Sbjct: 1436 SAPPIPPDTLPLISQNGRDFLDAC----FEIDPDNRPTADNLLS 1475

>Kwal_56.24059
          Length = 353

 Score = 62.8 bits (151), Expect = 2e-10,   Method: Compositional matrix adjust.
 Identities = 64/232 (27%), Positives = 108/232 (46%), Gaps = 26/232 (11%)

Query: 69  YKIGKKIGEGSFGVLFEGTNMINGVPVAIKFEP-----RKTEAPQLRDEYKTYKILNGTP 123
           ++I + +G GSFG +    ++ NG   AIK        R  +     DE +  K+++  P
Sbjct: 43  FQILRTLGTGSFGRVHLVRSVHNGRYYAIKVLKKEQVIRMKQIEHTNDERRMLKLVDH-P 101

Query: 124 NIPYAYYFGQEGLHNILVIDLL-GPSLEDLFDWCGRKFSVKTVVQVAVQMITLIEDLHAH 182
            +   +   Q+  +  +V+D + G  L  L     ++F        A ++I  +E LH+H
Sbjct: 102 FLIRMWGTFQDSRNLFMVMDYIEGGELFSLLR-KSQRFPNPVAKFYAAEVILALEYLHSH 160

Query: 183 DLIYRDIKPDNFLIGRPGQPDANNIHLIDFGMAKQYRDPKTKQHIPYREKKSLSGTARYM 242
           D+IYRD+KP+N L+ R G     +I + DFG AK+  D  T          +L GT  Y+
Sbjct: 161 DIIYRDLKPENILLDRNG-----HIKITDFGFAKEV-DTVT---------WTLCGTPDYI 205

Query: 243 SINTHLGREQSRRDDMEALGHVFFYFLRGHLPWQGLKAPNNKQKYEKIGEKK 294
           +      +  ++  D  +LG + F  L G+ P+         + YEKI + K
Sbjct: 206 APEVIATKPYNKSVDWWSLGILIFEMLAGYTPFYD---ATPMKTYEKILQGK 254

>YCR073C (SSK22) [598] chr3 complement(242584..246579) Map kinase
            kinase kinase (MAPKKK) with strong similarity to Ssk2p,
            participates in the high-osmolarity signal transduction
            pathway [3996 bp, 1331 aa]
          Length = 1331

 Score = 63.5 bits (153), Expect = 3e-10,   Method: Compositional matrix adjust.
 Identities = 67/237 (28%), Positives = 104/237 (43%), Gaps = 34/237 (14%)

Query: 65   VGLHYKIGKKIGEGSFGVLFEGTNMINGVPVAIK------FEPRKTEAPQLRDEYKTYKI 118
            V + ++    IG G+FG ++   N+ NG  +A+K          K   P +++E    ++
Sbjct: 1030 VSMRWQKRSFIGGGTFGQVYSAINLENGEILAVKEIKIHDTTTMKKIFPLIKEEMTVLEM 1089

Query: 119  LNGTPNIPYAYYFGQEGLH----NILVIDLLGPSLEDLFDWCGRKFSVKTVVQV-AVQMI 173
            LN  PNI    Y+G E +H    NI +    G SL  L D  GR    + V QV   +++
Sbjct: 1090 LNH-PNI--VQYYGVE-VHRDKVNIFMEYCEGGSLASLLD-HGR-IEDEMVTQVYTFELL 1143

Query: 174  TLIEDLHAHDLIYRDIKPDNFLIGRPGQPDANNIHLIDFGMAKQYRDPKTKQ-------- 225
              +  LH   +++RDIKP+N L+   G      I  +DFG A+     +T+         
Sbjct: 1144 EGLAYLHQSGVVHRDIKPENILLDFNGI-----IKYVDFGTARTVVGSRTRTVRNAAVQD 1198

Query: 226  -HIPYREKKSLSGTARYMSINTHLGREQSRR---DDMEALGHVFFYFLRGHLPWQGL 278
              +  +    + GT  YM+  T  G     +   DD+ ALG V      G  PW  L
Sbjct: 1199 FGVETKSLNEMMGTPMYMAPETISGSAVKGKLGADDVWALGCVVLEMATGRRPWSNL 1255

>YFR014C (CMK1) [1695] chr6 complement(172529..173869)
           Calcium/calmodulin-dependent serine/threonine protein
           kinase (CaM kinase) type I [1341 bp, 446 aa]
          Length = 446

 Score = 62.4 bits (150), Expect = 4e-10,   Method: Compositional matrix adjust.
 Identities = 55/216 (25%), Positives = 105/216 (48%), Gaps = 18/216 (8%)

Query: 69  YKIGKKIGEGSFGVLFEGTNMINGVPVAIKFEPRKT---EAPQLRDEYKTYKILNGT--P 123
           Y  GK +G G+FGV+ +  N   G  VA+K   +K       QL   Y    IL     P
Sbjct: 37  YVFGKTLGAGTFGVVRQAKNTETGEDVAVKILIKKALKGNKVQLEALYDELDILQRLHHP 96

Query: 124 NIPYAYYFGQEGLHNILVIDLLGPSLEDLFDWCGRK--FSVKTVVQVAVQMITLIEDLHA 181
           NI  A+    E      +I  L    E LFD   +K  F+ +  V++ V++++ ++ +H+
Sbjct: 97  NI-VAFKDWFESKDKFYIITQLAKGGE-LFDRILKKGKFTEEDAVRILVEILSAVKYMHS 154

Query: 182 HDLIYRDIKPDNFLIGRPGQPDANNIHLIDFGMAKQYRDPKTKQHIPYREKKSLSGTARY 241
            ++++RD+KP+N L     + D + + + DFG+AK+    K+ + + Y+     +G+  Y
Sbjct: 155 QNIVHRDLKPENLLY--IDKSDESPLVVADFGIAKRL---KSDEELLYKP----AGSLGY 205

Query: 242 MSINTHLGREQSRRDDMEALGHVFFYFLRGHLPWQG 277
           ++          +  D+ ++G + +  L G+  ++ 
Sbjct: 206 VAPEVLTQDGHGKPCDIWSIGVITYTLLCGYSAFRA 241

>KLLA0F14190g 1311121..1315137 gi|3021329|emb|CAA06336.1 Kluyveromyces
            lactis MAP kinase kinase kinase, start by similarity
          Length = 1338

 Score = 62.8 bits (151), Expect = 4e-10,   Method: Compositional matrix adjust.
 Identities = 54/222 (24%), Positives = 101/222 (45%), Gaps = 27/222 (12%)

Query: 72   GKKIGEGSFGVLFEGTNMINGVPVAIK------FEPRKTEA----PQLRDEYKTYKILNG 121
            G+ IG+GSFG ++   N+  G  +A+K      F  +   A      L+ E  T K LN 
Sbjct: 1041 GEIIGKGSFGAVYLALNVTTGEMLAVKQVTVPEFSSQDESAISMVEALKSEVSTLKDLNH 1100

Query: 122  TPNIPYAYYFGQEGLHNILVIDLLGPSLEDLFDWCGRKFSVKTVVQVAVQMITLIEDLHA 181
               + Y  +  + G++++ +  + G S+  L    GR F  + +  +  Q++  +  LH+
Sbjct: 1101 VNIVQYLGFEEKNGIYSLFLEYVAGGSVGSLIRMYGR-FDDQLIRHLTKQVLEGLAYLHS 1159

Query: 182  HDLIYRDIKPDNFLIGRPGQPDANNIHLIDFGMAKQYRDPKTKQHIPYREKKSLSGTARY 241
              +++RD+K DN L+   G        + DFG++++        +I      ++ GT  +
Sbjct: 1160 KGILHRDMKADNLLLDNDGV-----CKISDFGISRK------SNNIYSNSDMTMRGTVFW 1208

Query: 242  MS---INTHLGREQSRRDDMEALGHVFFYFLRGHLPWQGLKA 280
            M+   ++T  G   S + D+ +LG V      G  PW   + 
Sbjct: 1209 MAPEMVDTAHG--YSAKVDIWSLGCVVLEMFAGKRPWSNFEV 1248

>KLLA0E03487g complement(323764..325707) similar to sgd|S0002874
           Saccharomyces cerevisiae YDR466w, start by similarity
          Length = 647

 Score = 62.4 bits (150), Expect = 4e-10,   Method: Compositional matrix adjust.
 Identities = 57/230 (24%), Positives = 99/230 (43%), Gaps = 22/230 (9%)

Query: 69  YKIGKKIGEGSFGVLFEGTNMINGVPVAIKFEPRKTEAPQLRDEYKTYK--ILN-----G 121
           +   +++G GS+  +++  +   G   AIK   +K    + + +Y T +   LN      
Sbjct: 10  FSFKERLGHGSYSTVYKAVDRSTGQLFAIKVCSKKHIISENKVKYVTIEKNTLNLLAHGN 69

Query: 122 TPNIPYAYYFGQEGLHNILVIDLL-GPSLEDLFDWCGRKFSVKTVVQVAVQMITLIEDLH 180
            P I   YY   +  +   V+D   G  L  L    GR F+         Q+I  +E +H
Sbjct: 70  HPGIIKLYYTFHDSENLYFVLDFAPGGELLQLLQTQGR-FNEAWTKHFMCQLIDALEYIH 128

Query: 181 AHDLIYRDIKPDNFLIGRPGQPDANNIHLIDFGMAKQYRDPKTKQHIPYREKKSLSGTAR 240
              +++RD+KP+N L+   G+     + + DFG+A                  S  GTA 
Sbjct: 129 GCKVVHRDLKPENLLLSSEGK-----LMITDFGVASNLAATDN-----LSSTSSFVGTAE 178

Query: 241 YMSINTHLGREQSRRDDMEALGHVFFYFLRGHLPWQGLKAPNNKQKYEKI 290
           Y+S    L  + +   D+ A+G + + F +G  P++G    N    +EKI
Sbjct: 179 YVSPELLLQNKSNFCSDIWAVGCMLYQFTQGTPPFRG---ENELAAFEKI 225

>YOR233W (KIN4) [5024] chr15 (775846..778248) Serine/threonine
           protein kinase related to Kin1p and Kin2p, catalytic
           domain is highly related to Snf1p [2403 bp, 800 aa]
          Length = 800

 Score = 62.4 bits (150), Expect = 5e-10,   Method: Compositional matrix adjust.
 Identities = 56/221 (25%), Positives = 101/221 (45%), Gaps = 28/221 (12%)

Query: 69  YKIGKKIGEGSFGVLFEG---TNMINGVP--VAIKFEPRKTEAPQLRDEYKTYKILNGT- 122
           Y IG  +GEG FG +  G    +  N VP  VAIK   R T       E K Y+ +N   
Sbjct: 46  YIIGSTLGEGEFGKVKLGWTKASSSNEVPKQVAIKLIRRDTIKKDADKEIKIYREINALK 105

Query: 123 ----PNIPYAYYFGQEGLHNILVIDLLGPSLEDLFDWCGRKFSVK--TVVQVAVQMITLI 176
               PNI Y     Q   +  +V++ +  S  + + +  RK  +K  +  ++  Q+I+ +
Sbjct: 106 HLTHPNIIYLEEVLQNSKYIGIVLEFV--SGGEFYKYIQRKRRLKESSACRLFAQLISGV 163

Query: 177 EDLHAHDLIYRDIKPDNFLIGRPGQPDANNIHLIDFGMAKQYRDPKTKQHIPYREKKSLS 236
             +H   L++RD+K +N L+ +       N+ + DFG   ++ +            K+  
Sbjct: 164 NYMHYKGLVHRDLKLENLLLDK-----HENLVITDFGFVNEFFEDNELM-------KTSC 211

Query: 237 GTARYMSINTHLGRE--QSRRDDMEALGHVFFYFLRGHLPW 275
           G+  Y +    +  +  ++R+ D+ + G + +  L G+LPW
Sbjct: 212 GSPCYAAPELVVSTKAYEARKADVWSCGVILYAMLAGYLPW 252

>YPL203W (TPK2) [5245] chr16 (166255..167397) Catalytic subunit of
           cAMP-dependent protein kinase 2, protein kinase A or PKA
           [1143 bp, 380 aa]
          Length = 380

 Score = 61.2 bits (147), Expect = 6e-10,   Method: Compositional matrix adjust.
 Identities = 61/232 (26%), Positives = 109/232 (46%), Gaps = 26/232 (11%)

Query: 69  YKIGKKIGEGSFGVLFEGTNMINGVPVAIKFEPRKT-----EAPQLRDEYKTYKILNGTP 123
           ++I + +G GSFG +    ++ NG   AIK   ++      +     DE +  K++   P
Sbjct: 70  FQIMRTLGTGSFGRVHLVRSVHNGRYYAIKVLKKQQVVKMKQVEHTNDERRMLKLVEH-P 128

Query: 124 NIPYAYYFGQEGLHNILVIDLL-GPSLEDLFDWCGRKFSVKTVVQVAVQMITLIEDLHAH 182
            +   +   Q+  +  +V+D + G  L  L     ++F        A ++I  +E LHAH
Sbjct: 129 FLIRMWGTFQDARNIFMVMDYIEGGELFSLLR-KSQRFPNPVAKFYAAEVILALEYLHAH 187

Query: 183 DLIYRDIKPDNFLIGRPGQPDANNIHLIDFGMAKQYRDPKTKQHIPYREKKSLSGTARYM 242
           ++IYRD+KP+N L+ R G     +I + DFG AK+       Q + +    +L GT  Y+
Sbjct: 188 NIIYRDLKPENILLDRNG-----HIKITDFGFAKEV------QTVTW----TLCGTPDYI 232

Query: 243 SINTHLGREQSRRDDMEALGHVFFYFLRGHLPWQGLKAPNNKQKYEKIGEKK 294
           +      +  ++  D  +LG + +  L G+ P+         + YEKI + K
Sbjct: 233 APEVITTKPYNKSVDWWSLGVLIYEMLAGYTPFYD---TTPMKTYEKILQGK 281

>AFL101C [3094] [Homologous to ScYPL209C (IPL1) - SH]
           (249144..250247) [1104 bp, 367 aa]
          Length = 367

 Score = 61.2 bits (147), Expect = 7e-10,   Method: Compositional matrix adjust.
 Identities = 62/215 (28%), Positives = 99/215 (46%), Gaps = 23/215 (10%)

Query: 69  YKIGKKIGEGSFGVLFEGTNMINGVPVAIKFEPRK-----TEAPQLRDEYKTYKILNGTP 123
           ++IGK +G+G FG ++   ++ +G   A+K   +K         Q R E +    L   P
Sbjct: 109 FEIGKVLGKGKFGRVYCVRHIESGFVCALKAMEKKDIIQYNIEKQFRREVEIQSSLR-HP 167

Query: 124 NIPYAY-YFGQEGLHNILVIDLLGPSLEDLFDWCGRKFSVKTVVQVAV-QMITLIEDLHA 181
           N+   Y YF  E    +L+  L+   L       GR      V    V QM   ++ +H 
Sbjct: 168 NLTQLYGYFHDEKRVYLLMEYLVNGELYKHLK--GRSHFNDVVASYYVYQMADALDYMHE 225

Query: 182 HDLIYRDIKPDNFLIGRPGQPDANNIHLIDFGMAKQYRDPKTKQHIPYREKKSLSGTARY 241
            ++++RDIKP+N +IG       N I L DFG +     PK  +      +K+L GT  Y
Sbjct: 226 RNILHRDIKPENIIIGF-----NNTIKLTDFGWS--VITPKGSK------RKTLCGTVDY 272

Query: 242 MSINTHLGREQSRRDDMEALGHVFFYFLRGHLPWQ 276
           +S      RE + + D+ ALG + +  L G  P++
Sbjct: 273 LSPELIRSREYNEKVDVWALGVLTYELLVGSPPFE 307

>Sklu_2436.14 YDR466W, Contig c2436 31299-33653
          Length = 784

 Score = 61.2 bits (147), Expect = 1e-09,   Method: Compositional matrix adjust.
 Identities = 37/122 (30%), Positives = 63/122 (51%), Gaps = 9/122 (7%)

Query: 170 VQMITLIEDLHAHDLIYRDIKPDNFLIGRPGQPDANNIHLIDFGMAKQYRDPKTKQHIPY 229
            Q++ ++E +H+  +I+RD+KP+N L+ + G+     + + DFG A       T      
Sbjct: 124 CQLVDVVEYIHSKGVIHRDLKPENVLLSKDGR-----LMVTDFGAASVVTTDGTSSDNSV 178

Query: 230 REK-KSLSGTARYMSINTHLGREQSRRDDMEALGHVFFYFLRGHLPWQGLKAPNNKQKYE 288
            E+  S  GTA Y+S    L  +     D+ ALG + + F++G  P++G    N  Q +E
Sbjct: 179 SERAASFVGTAEYVSPELLLNNQCFFSSDIWALGCILYQFMQGSPPFRG---ENELQTFE 235

Query: 289 KI 290
           KI
Sbjct: 236 KI 237

>CAGL0F04741g 478256..479584 similar to sp|P22517 Saccharomyces
           cerevisiae YOL016c CMK2 Ca2+/calmodulin-dependent
           ser/thr protein kinase, type II, hypothetical start
          Length = 442

 Score = 60.8 bits (146), Expect = 1e-09,   Method: Compositional matrix adjust.
 Identities = 50/211 (23%), Positives = 100/211 (47%), Gaps = 16/211 (7%)

Query: 68  HYKIGKKIGEGSFGVLFEGTNMINGVPVAIKFEPRK------TEAPQLRDEYKTYKILNG 121
           +Y  GK +G G+FGV+ +         VA+K   +K       +   L DE    ++L  
Sbjct: 44  NYVFGKTLGAGTFGVVRQARYSPTNEDVAVKILLKKALKGNDVQLQMLYDELSILQMLKH 103

Query: 122 TPNIPYAYYFGQEGLHNILVIDLLGPSLEDLFDWCGRKFSVKTVVQVAVQMITLIEDLHA 181
              + +  +F  +    I+    +G  L D     G KF+ +  V + +Q+++ ++ +H+
Sbjct: 104 PNIVEFKDWFESKDKFYIVTQLAVGGELFDRILAKG-KFTERDAVSITMQILSAVDYMHS 162

Query: 182 HDLIYRDIKPDNFLIGRPGQPDANNIHLIDFGMAKQYRDPKTKQHIPYREKKSLSGTARY 241
            ++++RD+KP+N L     + D + + + DFG+AKQ +D      + ++   SL   A  
Sbjct: 163 KNVVHRDLKPENVLY--IDKSDDSQLVIADFGIAKQLQD---NDDLIFKAAGSLGYVAPE 217

Query: 242 MSINTHLGREQSRRDDMEALGHVFFYFLRGH 272
           +  N   G+      D+ ++G + +  L G+
Sbjct: 218 VLTNNGHGKPC----DIWSIGVIVYTLLCGY 244

>KLLA0F13552g complement(1252906..1256709)
           gi|33386566|emb|CAD87727.1 Kluyveromyces lactis protein
           kinase, start by similarity
          Length = 1267

 Score = 61.2 bits (147), Expect = 1e-09,   Method: Compositional matrix adjust.
 Identities = 56/218 (25%), Positives = 99/218 (45%), Gaps = 26/218 (11%)

Query: 69  YKIGKKIGEGSFGVLFEGTNMINGVPVAIKFEPRK-TEAPQLRD-------EYKTYKILN 120
           +K+GK +G+GS G +    NM  G   AIK  P+K  ++ Q++        E    K+++
Sbjct: 73  WKLGKTLGKGSSGRVRLAKNMETGKLSAIKIVPKKFVKSNQIKQLPYGIEREIIIMKLIS 132

Query: 121 GTPNIPYAYYFGQEGLHNILVIDLLGPSLEDLFDWCGRKFSV--KTVVQVAVQMITLIED 178
             PN+   Y   +      LV++ +     +LFD+   K  +     +    Q++  +  
Sbjct: 133 H-PNVMGLYEVWENKSELYLVLEYVEGG--ELFDYLVSKGKLPESEAIHYFKQIVQAVAY 189

Query: 179 LHAHDLIYRDIKPDNFLIGRPGQPDANNIHLIDFGMAKQYRDPKTKQHIPYREKKSLSGT 238
            H  ++ +RD+KP+N L+ +  +    +I + DFGMA      K  +        +  G+
Sbjct: 190 CHGFNICHRDLKPENLLLDKKKR----SIKIADFGMAALETSDKLLE--------TSCGS 237

Query: 239 ARYMSINTHLGRE-QSRRDDMEALGHVFFYFLRGHLPW 275
             Y S    LGR+      D+ + G + F  L GHLP+
Sbjct: 238 PHYASPEIVLGRKYHGSPSDVWSCGIILFALLTGHLPF 275

>CAGL0K08514g complement(853314..857783) similar to sp|P34244
           Saccharomyces cerevisiae YKL101w
           serine/threonine-protein kinase, hypothetical start
          Length = 1489

 Score = 61.2 bits (147), Expect = 2e-09,   Method: Compositional matrix adjust.
 Identities = 62/251 (24%), Positives = 106/251 (42%), Gaps = 60/251 (23%)

Query: 69  YKIGKKIGEGSFGVLFEGTNMINGVPVAIKFEPRKTEAPQLRDE-YKTY----------- 116
           +K+GK +G+GS G +    N+ NG   AIK  P++T   ++RD+  KT            
Sbjct: 93  WKLGKTLGKGSSGRVRLAKNIENGTLAAIKIVPKRTYNRRMRDQKMKTAGGVSSGTDSKD 152

Query: 117 ------KILNGTPNIPYAYYFGQEGLHNILVIDLLG-PSLE------------------- 150
                  I NGT +    Y   +E    I+++ L+  P++                    
Sbjct: 153 SSNREDPIKNGTDSALNPYGIERE----IVIMKLISHPNVMGLLEVWENKSELYLVLEYV 208

Query: 151 ---DLFDWCGRK--FSVKTVVQVAVQMITLIEDLHAHDLIYRDIKPDNFLIGRPGQPDAN 205
              +LFD+   K   S    V    Q+I  +   H+ ++ +RD+KP+N L+ +  +    
Sbjct: 209 DGGELFDYLVSKGKLSEPEAVHYFTQIIQGVSYCHSFNICHRDLKPENLLLDKKNKV--- 265

Query: 206 NIHLIDFGMAKQYRDPKTKQHIPYREKKSLSGTARYMSINTHLGRE-QSRRDDMEALGHV 264
            I + DFGMA           +P +  ++  G+  Y S    +G+       D+ + G +
Sbjct: 266 -IKIADFGMA--------ALELPNKLLETSCGSPHYASPEIVMGKPYHGGPSDVWSCGII 316

Query: 265 FFYFLRGHLPW 275
            F  L GHLP+
Sbjct: 317 LFALLTGHLPF 327

>AEL284C [2221] [Homologous to ScYGR052W - SH] (106480..107919)
           [1440 bp, 479 aa]
          Length = 479

 Score = 60.5 bits (145), Expect = 2e-09,   Method: Compositional matrix adjust.
 Identities = 57/239 (23%), Positives = 104/239 (43%), Gaps = 36/239 (15%)

Query: 69  YKIGKKIGEGSFGVLFEGTNMINGVPVAIKFEPRKTEAPQ--------LRDEYKTYKILN 120
           YK+G+ I  GSF V+    +   G  VA+K+  +  + P+        + +EY   + L 
Sbjct: 7   YKVGRLIQSGSFSVVHHAQDCQTGQDVALKYVRKPHDNPEQLQKVAALVHNEYAILRRLG 66

Query: 121 GTPNIPYAYYFGQEGLHNILVIDLLGPSLEDLFDWCGRKFSVKTVVQV-----AVQMITL 175
              NI     F ++    + V++    +  DL+D+  +    +  +++       Q+ + 
Sbjct: 67  THRNICQLLDFYEDADTYVFVLEYC--AYGDLYDFI-KAIRERPTMRINFHSFLFQLCSA 123

Query: 176 IEDLHAHDLIYRDIKPDNFLIGRPGQPDANNIHLIDFGMAKQYRDPKTKQHIPYREKKSL 235
           I   H+ D+ +RDIKP+N L+   GQ     + L DFG+++          I    K   
Sbjct: 124 ISYCHSKDVSHRDIKPENVLMDDRGQ-----VKLTDFGLSQ----------IGSVSKDYC 168

Query: 236 SGTARYMSINTHLGRE--QSRRDDMEALGHVFFYFLRGHLPWQGLK--APNNKQKYEKI 290
            GT +Y++  T L RE   +   D  +LG   F  + G  P++     AP     +++ 
Sbjct: 169 IGTEKYLAPETFL-REYHNTFATDYWSLGITIFCLMFGSCPFESASSDAPKRSANFQRF 226

>AFL090W [3103] [Homologous to ScYPL203W (TPK2) - SH]
           complement(274336..275376) [1041 bp, 346 aa]
          Length = 346

 Score = 59.7 bits (143), Expect = 2e-09,   Method: Compositional matrix adjust.
 Identities = 62/228 (27%), Positives = 105/228 (46%), Gaps = 26/228 (11%)

Query: 69  YKIGKKIGEGSFGVLFEGTNMINGVPVAIKFEP-----RKTEAPQLRDEYKTYKILNGTP 123
           ++I + +G GSFG +    ++ NG   AIK        R  +     DE +  K++   P
Sbjct: 36  FQIMRTLGTGSFGRVHLVRSIHNGRYYAIKVLKKQQVIRMKQIEHTNDERRMLKVVEH-P 94

Query: 124 NIPYAYYFGQEGLHNILVIDLL-GPSLEDLFDWCGRKFSVKTVVQVAVQMITLIEDLHAH 182
            +   +   Q+  +  +V+D + G  L  L     ++F        A ++   +E LHAH
Sbjct: 95  FLIRMWGTFQDARNLFIVMDYIEGGELFSLLR-KSQRFPNPVAKFYAAEVTLALEYLHAH 153

Query: 183 DLIYRDIKPDNFLIGRPGQPDANNIHLIDFGMAKQYRDPKTKQHIPYREKKSLSGTARYM 242
           ++IYRD+KP+N L+ R G     +I + DFG AK+  D  T          +L GT  Y+
Sbjct: 154 NIIYRDLKPENILLDRNG-----HIKITDFGFAKEV-DTVT---------WTLCGTPDYI 198

Query: 243 SINTHLGREQSRRDDMEALGHVFFYFLRGHLPWQGLKAPNNKQKYEKI 290
           +      +  ++  D  +LG + F  L G+ P+  +      + YEKI
Sbjct: 199 APEVITTKPYNKSIDWWSLGILIFEMLAGYTPFYDV---TPIKTYEKI 243

>Scas_660.20
          Length = 957

 Score = 60.5 bits (145), Expect = 2e-09,   Method: Compositional matrix adjust.
 Identities = 60/227 (26%), Positives = 102/227 (44%), Gaps = 21/227 (9%)

Query: 73  KKIGEGSFGVLFEG-----TNMINGVPVAIKFEP-RKTEAPQLRDEYKTYKILNGT--PN 124
           +++G GS+  +++      T  I  + V  K    ++++   +  E  T  +L     P 
Sbjct: 15  EELGHGSYSTVYKAIDKRNTKRIFAIKVCSKAHIIKESKVKYVTIEKNTLNLLAKAHHPG 74

Query: 125 IPYAYYFGQEGLHNILVIDLL-GPSLEDLFDWCGRKFSVKTVVQVAVQMITLIEDLHAHD 183
           I   YY   +  +   V+D L G  L  L     + FS        VQ++  +E +H+  
Sbjct: 75  IVKLYYTFHDEENLYYVLDYLPGGELLSLLHKM-KTFSEVWSKHFTVQLVDTLEFIHSQG 133

Query: 184 LIYRDIKPDNFLIGRPGQPDANNIHLIDFGMAKQYRDPKTKQHIPYREKKSLSGTARYMS 243
           +I+RD+KP+N L+ R G+     + + DFG A          +   +   S  GTA Y+S
Sbjct: 134 VIHRDLKPENVLLDRDGK-----LMITDFGAAYTTTAGNNDAN---KSSSSFVGTAEYVS 185

Query: 244 INTHLGREQSRRDDMEALGHVFFYFLRGHLPWQGLKAPNNKQKYEKI 290
               L  + S   D+ ALG + F F+ G  P++G    N  + +EKI
Sbjct: 186 PELLLHNQCSFSSDVWALGCMIFQFVTGSPPFRG---ENELKTFEKI 229

>YOL016C (CMK2) [4800] chr15 complement(294777..296120)
           Calcium/calmodulin-dependent serine/threonine protein
           kinase (CaM kinase) type II [1344 bp, 447 aa]
          Length = 447

 Score = 59.7 bits (143), Expect = 3e-09,   Method: Compositional matrix adjust.
 Identities = 57/215 (26%), Positives = 105/215 (48%), Gaps = 18/215 (8%)

Query: 68  HYKIGKKIGEGSFGVLFEGTNMINGVPVAIKFEPRKT---EAPQLRDEYKTYKILNGT-- 122
           +Y  G+ +G GSFGV+ +   +     VAIK   +K       QL+  Y+   IL     
Sbjct: 46  NYIFGRTLGAGSFGVVRQARKLSTNEDVAIKILLKKALQGNNVQLQMLYEELSILQKLSH 105

Query: 123 PNI-PYAYYFGQEGLHNILVIDLLGPSLEDLFDWCGRKFSVKTVVQVAVQMITLIEDLHA 181
           PNI  +  +F  +    I+     G  L D     G KF+    V++ VQ++  +E +H+
Sbjct: 106 PNIVSFKDWFESKDKFYIVTQLATGGELFDRILSRG-KFTEVDAVEIIVQILGAVEYMHS 164

Query: 182 HDLIYRDIKPDNFLIGRPGQPDANNIHLIDFGMAKQYRDPKTKQHIPYREKKSLSGTA-R 240
            ++++RD+KP+N L     + + + + + DFG+AKQ    K ++ + Y+   SL   A  
Sbjct: 165 KNVVHRDLKPENVLY--VDKSENSPLVIADFGIAKQL---KGEEDLIYKAAGSLGYVAPE 219

Query: 241 YMSINTHLGREQSRRDDMEALGHVFFYFLRGHLPW 275
            ++ + H      +  D+ ++G + +  L G+ P+
Sbjct: 220 VLTQDGH-----GKPCDIWSIGVITYTLLCGYSPF 249

>AFR092W [3284] [Homologous to ScYJL095W (BCK1) - SH]
            complement(595092..599363) [4272 bp, 1423 aa]
          Length = 1423

 Score = 60.5 bits (145), Expect = 3e-09,   Method: Compositional matrix adjust.
 Identities = 53/222 (23%), Positives = 99/222 (44%), Gaps = 27/222 (12%)

Query: 72   GKKIGEGSFGVLFEGTNMINGVPVAIKF----------EPRKTEAPQLRDEYKTYKILNG 121
            G+ IG+GSFG ++ G N+  G  +A+K           E     A  L  E  T K L+ 
Sbjct: 1127 GEMIGKGSFGAVYLGLNVTTGEMMAVKQVEVPKFGSQDETTVNNAEALISEVSTLKDLDH 1186

Query: 122  TPNIPYAYYFGQEGLHNILVIDLLGPSLEDLFDWCGRKFSVKTVVQVAVQMITLIEDLHA 181
               + Y  +  +  ++++ +  + G S+  L    G  F  + +  +  Q++  +  LH 
Sbjct: 1187 LNIVQYLGFENKNCIYSLFLEYVAGGSVGSLIRLYGH-FDEQLIRFLTTQVLEGLAYLHL 1245

Query: 182  HDLIYRDIKPDNFLIGRPGQPDANNIHLIDFGMAKQYRDPKTKQHIPYREKKSLSGTARY 241
              +++RD+K DN L+   G        + DFG++++        +I    + ++ GT  +
Sbjct: 1246 RGILHRDMKADNLLLDNDGV-----CKISDFGISRK------SNNIYSNSEMTMRGTVFW 1294

Query: 242  MS---INTHLGREQSRRDDMEALGHVFFYFLRGHLPWQGLKA 280
            M+   ++T  G   S + D+ +LG V      G  PW  L+ 
Sbjct: 1295 MAPEMVDTTQG--YSAKVDIWSLGCVVLEMFAGKRPWSNLEV 1334

>Kwal_26.7788
          Length = 1267

 Score = 59.7 bits (143), Expect = 4e-09,   Method: Compositional matrix adjust.
 Identities = 58/218 (26%), Positives = 97/218 (44%), Gaps = 28/218 (12%)

Query: 69  YKIGKKIGEGSFGVLFEGTNMINGVPVAIKFEPRKTEAPQ-------LRDEYKTYKILNG 121
           +K+GK +G+GS G +    NM  G   AIK  P KT++ +       +  E    K+++ 
Sbjct: 58  WKLGKTLGKGSSGRVRLAKNMETGKLAAIKIVP-KTKSSRTGSLPYGIEREIIIMKLISH 116

Query: 122 TPNIPYAYYFGQEGLHNILVIDLLGPSLEDLFDWC---GRKFSVKTVVQVAVQMITLIED 178
            PN+   Y   +  L   LV++ +     +LFD+    GR    K  +    Q+I     
Sbjct: 117 -PNVMGLYEVWENKLELFLVLEYVDGG--ELFDYLVSRGR-LPEKEAIHYFRQIIEGTAY 172

Query: 179 LHAHDLIYRDIKPDNFLIGRPGQPDANNIHLIDFGMAKQYRDPKTKQHIPYREKKSLSGT 238
            H  ++ +RD+KP+N L+ +  +     I + DFGMA      K  +        +  G+
Sbjct: 173 CHGFNICHRDLKPENLLLDKKNK----RIKIADFGMAALQTSNKLLE--------TSCGS 220

Query: 239 ARYMSINTHLGRE-QSRRDDMEALGHVFFYFLRGHLPW 275
             Y S    +G+       D+ + G + F  L GHLP+
Sbjct: 221 PHYASPEIVMGKNYNGGPSDVWSCGIILFALLTGHLPF 258

>YGL158W (RCK1) [1831] chr7 (207036..208574) Serine/threonine
           protein kinase with similarity to Cmk1p, Cmk2p, and
           Cmk3p [1539 bp, 512 aa]
          Length = 512

 Score = 59.3 bits (142), Expect = 4e-09,   Method: Compositional matrix adjust.
 Identities = 60/248 (24%), Positives = 106/248 (42%), Gaps = 51/248 (20%)

Query: 68  HYKIGKKIGEGSFGVLFE--GTNMINGVPVAIKFEPRK----------------TEAPQL 109
           +YK+  KIGEG+F  +F+  G N  +  PVAIK   +K                +   ++
Sbjct: 120 NYKLLNKIGEGAFSRVFKAVGINTDDQAPVAIKAIIKKGISSDAILKGNDRIQGSSRKKV 179

Query: 110 RDEYKTYKILN-GTPNIPYAYYFGQEGLHNILVIDLLGPSLEDLFDWCGR--KFSVKTVV 166
            +E   +K+++   P+      F +   +  LV +L+     ++FD   +   FS     
Sbjct: 180 LNEVAIHKLVSKNNPHCTKFIAFQESANYYYLVTELVTGG--EIFDRIVQLTCFSEDLAR 237

Query: 167 QVAVQMITLIEDLHAHDLIYRDIKPDNFLI------GRPGQPDANN-------------I 207
            V  Q+   I+ +H   +++RD+KP+N L       G  G     +             +
Sbjct: 238 HVITQVAIAIKHMHYMGIVHRDVKPENLLFEPIPFYGLDGDMQKEDEFTLGVGGGGIGLV 297

Query: 208 HLIDFGMAKQYRDPKTKQHIPYREKKSLSGTARYMSINTHLGREQSRRDDMEALGHVFFY 267
            L+DFG+AK+ R+            K+  GT  Y++      +  S + DM ++G V F 
Sbjct: 298 KLMDFGLAKKLRN---------NTAKTPCGTIEYVASEVFTSKRYSMKVDMWSIGCVLFT 348

Query: 268 FLRGHLPW 275
            L G+ P+
Sbjct: 349 LLCGYPPF 356

>KLLA0D03190g 267933..269051 highly similar to sp|P06245
           Saccharomyces cerevisiae YPL203w TPK2 cAMP-dependent
           protein kinase 2, catalytic chain, start by similarity
          Length = 372

 Score = 58.5 bits (140), Expect = 4e-09,   Method: Compositional matrix adjust.
 Identities = 59/228 (25%), Positives = 103/228 (45%), Gaps = 26/228 (11%)

Query: 69  YKIGKKIGEGSFGVLFEGTNMINGVPVAIKFEP-----RKTEAPQLRDEYKTYKILNGTP 123
           ++I + +G GSFG +    ++ NG   AIK        R  +     DE +  K++   P
Sbjct: 62  FQIMRTLGTGSFGRVHLVRSVHNGRYYAIKVLKKHQIIRMKQIEHTNDERRMLKLVEH-P 120

Query: 124 NIPYAYYFGQEGLHNILVIDLL-GPSLEDLFDWCGRKFSVKTVVQVAVQMITLIEDLHAH 182
            +   +   Q+  +  +V+D + G  L  L     ++F        A ++   +E LH+H
Sbjct: 121 FLIRMWGTFQDSRNLFMVMDYIEGGELFSLLR-KSQRFPNPVAKFYAAEVTLALEYLHSH 179

Query: 183 DLIYRDIKPDNFLIGRPGQPDANNIHLIDFGMAKQYRDPKTKQHIPYREKKSLSGTARYM 242
           ++IYRD+KP+N L+ R G     +I + DFG AK+                +L GT  Y+
Sbjct: 180 NIIYRDLKPENILLDRNG-----HIKITDFGFAKEV----------ITVTWTLCGTPDYI 224

Query: 243 SINTHLGREQSRRDDMEALGHVFFYFLRGHLPWQGLKAPNNKQKYEKI 290
           +      +  ++  D  +LG + F  L G+ P+  +      + YEKI
Sbjct: 225 APEVITTKPYNKSVDWWSLGILIFEMLAGYTPFYDVTP---MKTYEKI 269

>Kwal_33.13846
          Length = 375

 Score = 58.5 bits (140), Expect = 4e-09,   Method: Compositional matrix adjust.
 Identities = 58/228 (25%), Positives = 102/228 (44%), Gaps = 26/228 (11%)

Query: 69  YKIGKKIGEGSFGVLFEGTNMINGVPVAIKFEPRKT-----EAPQLRDEYKTYKILNGTP 123
           + I + +G GSFG +    +  NG   A+K   ++T     +     DE +   +++  P
Sbjct: 65  FHILRTLGTGSFGRVHLVRSNHNGRFYAMKVLKKRTIVKLKQVEHTNDERRMLSVVSH-P 123

Query: 124 NIPYAYYFGQEGLHNILVIDLL-GPSLEDLFDWCGRKFSVKTVVQVAVQMITLIEDLHAH 182
            I   +   Q+  H  +++D + G  L  L     ++F        A ++   +E LHA 
Sbjct: 124 FIIRMWGTFQDAEHVFMIMDYIEGGELFSLLR-KSQRFPNPVAKFYAAEVCLALEYLHAQ 182

Query: 183 DLIYRDIKPDNFLIGRPGQPDANNIHLIDFGMAKQYRDPKTKQHIPYREKKSLSGTARYM 242
           D+IYRD+KP+N L+ + G     ++ + DFG AK   D      + Y    +L GT  Y+
Sbjct: 183 DIIYRDLKPENVLLDKNG-----HVKITDFGFAKFVPD------VTY----TLCGTPDYI 227

Query: 243 SINTHLGREQSRRDDMEALGHVFFYFLRGHLPWQGLKAPNNKQKYEKI 290
           +      +  ++  D  + G + F  L G+ P+      N  + YE I
Sbjct: 228 APEVVSTKPYNKSVDWWSFGILIFEMLAGYTPFYD---SNTMKTYENI 272

>KLLA0B02332g complement(206863..207948) similar to sp|P38991
           Saccharomyces cerevisiae YPL209c IPL1 ser/thr protein
           kinase, start by similarity
          Length = 361

 Score = 58.5 bits (140), Expect = 5e-09,   Method: Compositional matrix adjust.
 Identities = 55/218 (25%), Positives = 104/218 (47%), Gaps = 29/218 (13%)

Query: 69  YKIGKKIGEGSFGVLFEGTNMINGVPVAIKFEPRK-----TEAPQLRDEYK---TYKILN 120
           ++IGK +G+G FG ++   +   G+  A+K   +K     T   Q R E +   ++K  N
Sbjct: 100 FEIGKILGKGKFGKVYCVKHRETGLICALKAMEKKEIVQYTIQKQFRREVEIQGSFKHKN 159

Query: 121 GTPNIPYAYYFGQEGLHNILVIDLLGPSLEDLFDWCGRKFSVKTVVQ--VAVQMITLIED 178
            T    Y +++ ++ ++ ++     G    +L+ +      +   +      QM   ++ 
Sbjct: 160 LTQ--LYGFFYDEKRVYLLMEYVYYG----ELYKFLKNNGPLNETLASYFVYQMANALDY 213

Query: 179 LHAHDLIYRDIKPDNFLIGRPGQPDANNIHLIDFGMAKQYRDPKTKQHIPYREKKSLSGT 238
           +H+ ++++RDIKP+N LIG       N I L DFG +    D +        ++K+L GT
Sbjct: 214 MHSKNILHRDIKPENILIGF-----NNTIKLTDFGWSVYNEDGQ--------KRKTLCGT 260

Query: 239 ARYMSINTHLGREQSRRDDMEALGHVFFYFLRGHLPWQ 276
             Y+S      RE + + D+ ALG + +  L G  P++
Sbjct: 261 IDYLSPELIKSREYNNKVDVWALGVLTYELLVGSPPFE 298

>YPL141C (YPL141C) [5305] chr16 complement(283463..286060)
           Serine/threonine protein kinase with similarity to Kin4p
           [2598 bp, 865 aa]
          Length = 865

 Score = 59.3 bits (142), Expect = 5e-09,   Method: Compositional matrix adjust.
 Identities = 62/266 (23%), Positives = 121/266 (45%), Gaps = 44/266 (16%)

Query: 69  YKIGKKIGEGSFGVLFEG-----TNMINGV-----PVAIKFEPRKTEAPQLRDEYKTYKI 118
           Y +G  +GEG FG +  G     +N  N        VAIK   R + +   R E K Y+ 
Sbjct: 41  YILGSTLGEGEFGKVKLGWPKNFSNSSNSTFDFPKQVAIKLIKRDSISNDYRKEVKIYRE 100

Query: 119 LNGTPNIPYAYYFG-QEGLHNILVIDLLGPSLE-----DLFDWCGRKFSVKTV--VQVAV 170
           +N   ++ +      +E L N   I ++   LE     + + +  +K  +K +   ++  
Sbjct: 101 INALKHLSHPNIVKLEEVLQNSRYIGIV---LEYACGGEFYKYIQKKRRLKEMNACRLFS 157

Query: 171 QMITLIEDLHAHDLIYRDIKPDNFLIGRPGQPDANNIHLIDFGMAKQYRDPKTKQHIPYR 230
           Q+I+ +  +H+  L++RD+K +N L+ +       N+ + DFG   ++    ++  +   
Sbjct: 158 QLISGVHYIHSKGLVHRDLKLENLLLDK-----NENLVITDFGFVNEF---CSRNEL--- 206

Query: 231 EKKSLSGTARYMSINTHLGRE--QSRRDDMEALGHVFFYFLRGHLPWQGLKAPNNKQKYE 288
             K+  G+  Y +    +  E  ++R+ D+ + G + +  L G+LPW     PNN +  +
Sbjct: 207 -MKTSCGSPCYAAPELVISAEPYEARKADIWSCGVILYAILAGYLPWDD--DPNNPEGSD 263

Query: 289 KIGEKKRSTNVYDLAQGLPVQFGRYL 314
            IG       +Y+     P++F  Y+
Sbjct: 264 -IGR------LYNYINSTPLKFPDYI 282

>Scas_720.94
          Length = 1683

 Score = 59.3 bits (142), Expect = 6e-09,   Method: Compositional matrix adjust.
 Identities = 76/294 (25%), Positives = 122/294 (41%), Gaps = 49/294 (16%)

Query: 21   NANFNVQANKQLHHQAVDSPXXXXXXXXXXXXXXXXXXXXXXXIVGLHYKIGKK--IGEG 78
            N+ F ++A K+L   +  +P                       I  L  +  K+  IG G
Sbjct: 1311 NSQFRLRAIKELEKSSKRNPHQIGKVLDDTDKGNKYLSSLASSISNLSIRWQKRNFIGGG 1370

Query: 79   SFGVLFEGTNMINGVPVA---IKFEPRKTEA---PQLRDEYKTYKILNGTPNIPYAYYFG 132
            +FG ++   N+ NG  +A   IK +  KT     P +++E    ++LN  PNI    Y+G
Sbjct: 1371 TFGTVYSAVNLDNGEILAVKEIKIQDSKTMKKIFPLVKEEMTVLEMLNH-PNI--VQYYG 1427

Query: 133  QEGLH----NILVIDLLGPSLEDLFDWCGRKFSVKTVVQV-AVQMITLIEDLHAHDLIYR 187
             E +H    NI +    G S+  L +  GR    + V QV  ++++  +  LH   +++R
Sbjct: 1428 VE-VHRDKVNIFMEYCEGGSMASLLE-HGR-IEDEMVTQVYTLELLEGLAYLHQAGVVHR 1484

Query: 188  DIKPDNFLIGRPGQPDANNIHLIDFGMAKQYRDPKTKQHIPYREKKS------------- 234
            DIKP+N L+   G      I  +DFG A++     TK  +     KS             
Sbjct: 1485 DIKPENILLDFNGI-----IKYVDFGAARKIAKNGTK--VTNINSKSKDDDEPDEKDTEG 1537

Query: 235  -------LSGTARYM---SINTHLGREQSRRDDMEALGHVFFYFLRGHLPWQGL 278
                   + GT  YM   SI  +  + +   DD+ + G V    + G  PW  L
Sbjct: 1538 GANSVHDMLGTPMYMAPESITGYKNKTKFGSDDIWSFGCVVLEMITGRRPWANL 1591

>KLLA0F23155g 2157146..2158429 similar to sp|P22517 Saccharomyces
           cerevisiae YOL016c CMK2 Ca2+/calmodulin-dependent
           ser/thr protein kinase, type II, start by similarity
          Length = 427

 Score = 58.2 bits (139), Expect = 7e-09,   Method: Compositional matrix adjust.
 Identities = 55/215 (25%), Positives = 100/215 (46%), Gaps = 20/215 (9%)

Query: 69  YKIGKKIGEGSFGVLFEGTNMINGVPVAIKFEPRKT---EAPQLRDEYKTYKILNGT--P 123
           Y  GK +G G+FGV+ +   + +G  VA+K   +K    ++ QL+  Y    IL     P
Sbjct: 46  YIFGKTLGAGTFGVVRQARCISSGENVAVKILLKKALKGQSVQLQMLYDELSILQQLNHP 105

Query: 124 NIP-YAYYFGQEGLHNILVIDLLGPSLEDLFDWCGRK--FSVKTVVQVAVQMITLIEDLH 180
           NI  +  +F  E      ++  L    E LFD    K  F     V +  Q++  ++ LH
Sbjct: 106 NIVRFKDWF--ESKEKFYIVTQLATGGE-LFDRILEKGKFCEVDAVFIVKQILQGVQYLH 162

Query: 181 AHDLIYRDIKPDNFLIGRPGQPDANNIHLIDFGMAKQYRDPKTKQHIPYREKKSLSGTAR 240
             ++++RD+KP+N L     + D + + + DFG+AK+ +D     H         +G+  
Sbjct: 163 QRNIVHRDLKPENILY--LNKSDDSPLVIGDFGIAKELKDDNELIH-------KAAGSMG 213

Query: 241 YMSINTHLGREQSRRDDMEALGHVFFYFLRGHLPW 275
           Y++          +  D+ ++G + +  L G+ P+
Sbjct: 214 YVAPEVLTSSGHGKPCDIWSIGVITYTLLCGYSPF 248

>YHR102W (KIC1) [2390] chr8 (316574..319816) Serine/threonine
           protein kinase involved in regulation of cell wall beta
           1,6-glucan levels, interacts with Cdc31p [3243 bp, 1080
           aa]
          Length = 1080

 Score = 58.9 bits (141), Expect = 7e-09,   Method: Compositional matrix adjust.
 Identities = 54/222 (24%), Positives = 99/222 (44%), Gaps = 21/222 (9%)

Query: 65  VGLHYKIGKKIGEGSFGVLFEGTNMINGVPVAIKFEPRKTEAPQLRDEYKTYKILNGTPN 124
           V   +K  + IG G FGV+++G N+  G   AIK     +++ ++ D  +  + L     
Sbjct: 19  VSSLFKRTEVIGRGKFGVVYKGYNVKTGRVYAIKVLNLDSDSDEVEDVQREIQFLASLKQ 78

Query: 125 IP-----YAYYFGQEGLHNILVIDLLGPSLEDLFDWCGRKFSVKTVVQVAVQMITLIEDL 179
           I      Y  Y     L  I++    G SL  L      K   K +  +  +++  ++ +
Sbjct: 79  ISNITRYYGSYLKDTSLW-IIMEHCAGGSLRSLLR--PGKIDEKYIGVIMRELLVALKCI 135

Query: 180 HAHDLIYRDIKPDNFLIGRPGQPDANNIHLIDFGMAKQYRDPKTKQHIPYREKKSLSGTA 239
           H  ++I+RDIK  N LI   G     N+ L DFG+A Q      +       +++++GT 
Sbjct: 136 HKDNVIHRDIKAANVLITNEG-----NVKLCDFGVAAQVNQTSLR-------RQTMAGTP 183

Query: 240 RYMSINTHL-GREQSRRDDMEALGHVFFYFLRGHLPWQGLKA 280
            +M+    + G     + D+ +LG   +    G+ P+  ++A
Sbjct: 184 YWMAPEVIMEGVYYDTKVDIWSLGITTYEIATGNPPYCDVEA 225

>AFR335C [3527] [Homologous to ScYOL100W (PKH2) - SH; ScYDR490C
           (PKH1) - SH] (1046762..1049863) [3102 bp, 1033 aa]
          Length = 1033

 Score = 58.2 bits (139), Expect = 1e-08,   Method: Compositional matrix adjust.
 Identities = 60/232 (25%), Positives = 100/232 (43%), Gaps = 20/232 (8%)

Query: 69  YKIGKKIGEGSFGVLFEGTNMINGVPVAIKFEPRKTEAPQLRDEY-----KTYKILNGT- 122
           +K G+ +G+GS+  +   T + +G   A K   ++    Q + +Y      T + LN + 
Sbjct: 200 FKFGEALGDGSYSTVVLATCIESGKKYAAKILNKEYLIKQKKVKYVNIEKNTLQRLNSSR 259

Query: 123 -PNIPYAYYFGQEGLHNILVIDLLGPSLEDLFDWCGR--KFSVKTVVQVAVQMITLIEDL 179
            P +   Y+  Q+   N+  +    P+  D      R    S +       Q++  I  L
Sbjct: 260 VPGVIKLYFTFQDEA-NLYFLLEYAPN-GDFLSVMKRFGTLSEECTKYYGAQILDAIHHL 317

Query: 180 HAHDLIYRDIKPDNFLIGRPGQPDANNIHLIDFGMAKQY-RDPKTKQHIPYREKKSLSGT 238
           H   +I+RD+KP+N L+ +        I L DFG AK   R+ + K +      KS  GT
Sbjct: 318 HKQGIIHRDVKPENILLDK-----TMKIKLTDFGTAKLIGREDENKPYDLNTRSKSFVGT 372

Query: 239 ARYMSINTHLGREQSRRDDMEALGHVFFYFLRGHLPWQGLKAPNNKQKYEKI 290
           A Y+S           R D+ A G + F  + G  P+   KA N    ++K+
Sbjct: 373 AEYVSPELLNDNYVDSRCDIWAFGCILFQMVAGKPPF---KATNEYLTFQKV 421

>Sklu_2437.16 YOL100W, Contig c2437 35714-38929 reverse complement
          Length = 1071

 Score = 58.2 bits (139), Expect = 1e-08,   Method: Compositional matrix adjust.
 Identities = 59/254 (23%), Positives = 112/254 (44%), Gaps = 36/254 (14%)

Query: 69  YKIGKKIGEGSFGVLFEGTNMINGVPVAIK-----FEPRKTEAPQLRDEYKTYKILNGTP 123
           +K G+ +G+GS+  +   T+  +G   A+K     +  R+ +   +  E  T + LN + 
Sbjct: 182 FKFGEILGDGSYSTVMLATSNDSGKKYAVKVLNKEYLIRQKKVKYVNIEKNTLQRLNNSR 241

Query: 124 NIPYAYYFGQEGLHNILVI------DLLG--PSLEDLFDWCGRKFSVKTVVQVAVQMITL 175
            +   Y+  Q+      ++      D L        L + C R +          QM+  
Sbjct: 242 GVIKLYFTFQDEASLYFLLEYAPNGDFLSVMKKFGSLNEECCRYY--------GAQMLDA 293

Query: 176 IEDLHAHDLIYRDIKPDNFLIGRPGQPDANNIHLIDFGMAKQY-RDPKTKQHIPYREKKS 234
           I+ +H + +++RDIKP+N L+      +   + L DFG AK   RD K+  ++  ++ +S
Sbjct: 294 IDFIHKNGVVHRDIKPENILLD-----EHMKVKLTDFGTAKLLDRDEKSGYNL-LKKSRS 347

Query: 235 LSGTARYMSINTHLGREQSRRDDMEALGHVFFYFLRGHLPWQGLKAPNNKQKYEKIGEKK 294
             GTA Y+S         + + D+ A G + +  + G  P+   KA N    ++K+ + +
Sbjct: 348 FVGTAEYVSPELLNDNCVNYKCDIWAFGCILYQMIAGKPPF---KATNEYLTFQKVMKVQ 404

Query: 295 RSTNVYDLAQGLPV 308
                Y    G P+
Sbjct: 405 -----YAFTAGFPL 413

>Scas_613.5
          Length = 517

 Score = 57.4 bits (137), Expect = 1e-08,   Method: Compositional matrix adjust.
 Identities = 58/239 (24%), Positives = 105/239 (43%), Gaps = 37/239 (15%)

Query: 69  YKIGKKIGEGSFGVLFEGTNMINGVPVAIK-FEPRKTE----APQLRDEYKTYKILNGTP 123
           Y +GK +G G +  + EG N + G  VA+K F P++ +    + Q R+E      ++  P
Sbjct: 204 YVLGKDLGSGHYATVKEGINKVTGQTVAVKIFHPQQNDDEKKSKQFREETNILMRIHH-P 262

Query: 124 NIPYAYYF-----GQEGLHNILVIDLLGPSLEDLFDWCGRKFSVKTVVQVAV--QMITLI 176
           NI     F      +  +   LV+D +     +LF+   +K  ++     A+  Q++  +
Sbjct: 263 NIVNLLDFFIEPVSKSQIQKYLVLDKIDDG--ELFERIVKKTCLRQDETKAIFNQILMGL 320

Query: 177 EDLHAHDLIYRDIKPDNFL--IGRPGQPDAN------------NIHLIDFGMAKQYRDPK 222
           + LH  ++I+RDIKP+N L  I R   P+               + + DFG+AK   +  
Sbjct: 321 KHLHQQNIIHRDIKPENILLNITRRTNPEQKQLGPWDEDEIDIQVKIADFGLAKFTGE-- 378

Query: 223 TKQHIPYREKKSLSGTARYMSINTHLGREQSRRDDMEALGHVFFYFLRGHLPWQGLKAP 281
                  +   +L GT  Y++      +  + + DM + G + +  L G  P+     P
Sbjct: 379 ------MQFTNTLCGTPSYVAPEVLTKKGYTSKVDMWSAGVILYVCLCGFPPFSEQLGP 431

>CAGL0L07326g 808532..810052 similar to sp|P39009 Saccharomyces
           cerevisiae YDL101c DUN1 protein kinase, start by
           similarity
          Length = 506

 Score = 57.4 bits (137), Expect = 2e-08,   Method: Compositional matrix adjust.
 Identities = 58/239 (24%), Positives = 106/239 (44%), Gaps = 37/239 (15%)

Query: 69  YKIGKKIGEGSFGVLFEGTNMINGVPVAIK-FEPRKTEA----PQLRDEYKTYKILNGTP 123
           Y +GK +G G + ++ E  N   G  VA+K F P++ +      Q R+E      ++  P
Sbjct: 193 YLLGKDLGSGHYAIVKEAKNKTTGETVAVKIFHPQQNDDQKKNKQFREETTILMKIHH-P 251

Query: 124 NI-----PYAYYFGQEGLHNILVIDLLGPSLEDLFDWCGRKFSVKTVVQVAV--QMITLI 176
           NI      +     +  +   LV++ +     +LFD   +K S+      A+  Q++T +
Sbjct: 252 NIVNLLDSFVEPISKTQIQKYLVLEKIDDG--ELFDRIVKKTSLPQEESKAIFKQILTGL 309

Query: 177 EDLHAHDLIYRDIKPDNFL--IGRPGQPDAN------------NIHLIDFGMAKQYRDPK 222
           + LH+ ++I+RDIKP+N L  I R   PD               + + DFG+AK   + +
Sbjct: 310 KYLHSQNIIHRDIKPENILLNIRRRQSPDERQLGPWDEDEIDIQVKIADFGLAKFTGEMQ 369

Query: 223 TKQHIPYREKKSLSGTARYMSINTHLGREQSRRDDMEALGHVFFYFLRGHLPWQGLKAP 281
                      +L GT  Y++    + +  + + D+ + G + +  L G  P+     P
Sbjct: 370 FTN--------TLCGTPSYVAPEVLVKKGYTSKVDLWSAGVILYVCLCGFPPFSDQLGP 420

>KLLA0F16467g 1519800..1520822 highly similar to sp|P19454
           Saccharomyces cerevisiae YOR061w CKA2 casein kinase II
           alpha chain, start by similarity
          Length = 340

 Score = 56.6 bits (135), Expect = 2e-08,   Method: Compositional matrix adjust.
 Identities = 43/159 (27%), Positives = 82/159 (51%), Gaps = 22/159 (13%)

Query: 68  HYKIGKKIGEGSFGVLFEGTNMINGVPVAIK-FEPRKTEAPQLRDEYKTYKILNGTPNIP 126
           +Y++ KKIG G +  +F+G +++N +P  IK  +P K +  ++  E K    L G PNI 
Sbjct: 50  NYEVIKKIGRGKYSEVFKGKSVLNDIPCVIKVLKPVKMK--KIYRELKVLTNLTGGPNII 107

Query: 127 YAYYFGQEGLHNIL------VIDLLGPSLEDL-FDWCGRKFSVKTVVQVAVQMITLIEDL 179
                   GL +I+      +  L+   ++++ F      F++        Q++T ++  
Sbjct: 108 --------GLLDIVQDPGSKIPALIFEEVKNVDFRTLYPSFTLSDTQFYFTQLLTALDYC 159

Query: 180 HAHDLIYRDIKPDNFLIGRPGQPDANNIHLIDFGMAKQY 218
           H+  +++RD+KP N +I     P+   + LID+G+A+ Y
Sbjct: 160 HSMGIMHRDVKPQNVMI----DPNERKLRLIDWGLAEFY 194

>YOL100W (PKH2) [4721] chr15 (129236..132481) Serine/threonine
           protein kinase with similarity to mammalian
           3-phosphoinositide-dependent protein kinase,
           phosphorylates and activates Ypk2p, required for
           endocytosis [3246 bp, 1081 aa]
          Length = 1081

 Score = 57.8 bits (138), Expect = 2e-08,   Method: Compositional matrix adjust.
 Identities = 60/239 (25%), Positives = 100/239 (41%), Gaps = 33/239 (13%)

Query: 69  YKIGKKIGEGSFGVLFEGTNMINGVPVAIK-----FEPRKTEAPQLRDEYKTYKILNGTP 123
           +K G  IG+G++  +   T++      A K     +  R+ +   +  E    + LN +P
Sbjct: 179 FKFGSVIGDGAYSTVMLATSIDTKKRYAAKVLNKEYLIRQKKVKYVSIEKTALQKLNNSP 238

Query: 124 NIP--YAYYFGQEGLHNILVIDLLGPSLE------DLFDWCGRKFSVKTVVQVAVQMITL 175
           ++   ++ +  +  L+ +L     G  L        L + C R +        A Q+I  
Sbjct: 239 SVVRLFSTFQDESSLYFLLEYAPNGDFLSLMKKYGSLDETCARYY--------AAQIIDA 290

Query: 176 IEDLHAHDLIYRDIKPDNFLIGRPGQPDANNIHLIDFGMAKQYRDPKTKQHIP----YRE 231
           I+ LH++ +I+RDIKP+N L+    +     I L DFG AK           P       
Sbjct: 291 IDYLHSNGIIHRDIKPENILLDGEMK-----IKLTDFGTAKLLNPTNNSVSKPEYDLSTR 345

Query: 232 KKSLSGTARYMSINTHLGREQSRRDDMEALGHVFFYFLRGHLPWQGLKAPNNKQKYEKI 290
            KS  GTA Y+S           R D+ A G + F  + G  P+   KA N    ++K+
Sbjct: 346 SKSFVGTAEYVSPELLNDSFTDYRCDIWAFGCILFQMIAGKPPF---KATNEYLTFQKV 401

>Scas_502.2
          Length = 1116

 Score = 57.8 bits (138), Expect = 2e-08,   Method: Compositional matrix adjust.
 Identities = 59/249 (23%), Positives = 110/249 (44%), Gaps = 25/249 (10%)

Query: 69  YKIGKKIGEGSFGVLFEGTNMINGVPVAIK-----FEPRKTEAPQLRDEYKTYKILNGTP 123
           +K G+ +G+G++  +   T+  +G   A+K     +  R+ +   +  E    + LN + 
Sbjct: 174 FKFGEMLGDGAYSTVMLATSNDSGKKYAVKVLNKEYLIRQKKVKYVNIEKLALQRLNNSR 233

Query: 124 NIPYAYYFGQEGLHNILVIDLLGPSLEDLFDWCGRKFSV--KTVVQVAVQMITLIEDLHA 181
           +I   ++  Q+      +++   P+  DL     +  S+  +       Q+I  I+ +H+
Sbjct: 234 SIIRLFFTFQDEASLYFLLEY-APN-GDLLSLMKKFGSLNEECCCYYGAQIIDAIKFMHS 291

Query: 182 HDLIYRDIKPDNFLIGRPGQPDANNIHLIDFGMAK--QYRDPKTKQHIPYREKKSLSGTA 239
             +I+RDIKP+N L+ +  +     + + DFG AK    + P T   +  R  KS  GTA
Sbjct: 292 KGIIHRDIKPENILLDKDMK-----VKITDFGTAKILDNKPPGTSYDLLTRS-KSFVGTA 345

Query: 240 RYMSINTHLGREQSRRDDMEALGHVFFYFLRGHLPWQGLKAPNNKQKYEKIGEKKRSTNV 299
            Y+S           R D+ A G + F  + G  P+   KA N    ++K+ + +     
Sbjct: 346 EYVSPELLNDNYTDARSDIWAFGCIVFQMIAGKPPF---KATNEYLTFQKVMKVQ----- 397

Query: 300 YDLAQGLPV 308
           Y    G P 
Sbjct: 398 YAFTAGFPT 406

>Kwal_47.18307
          Length = 621

 Score = 57.4 bits (137), Expect = 2e-08,   Method: Compositional matrix adjust.
 Identities = 35/123 (28%), Positives = 62/123 (50%), Gaps = 11/123 (8%)

Query: 168 VAVQMITLIEDLHAHDLIYRDIKPDNFLIGRPGQPDANNIHLIDFGMAKQYRDPKTKQHI 227
           +  Q++  ++ +H+  +I+RD+KP+N L+ + G+     + + DFG A    D K +   
Sbjct: 117 ITAQLVDTVDYMHSKGVIHRDLKPENVLLSQEGR-----VVITDFGAACTAADRKFENT- 170

Query: 228 PYREKKSLSGTARYMSINTHLGREQSRRDDMEALGHVFFYFLRGHLPWQGLKAPNNKQKY 287
             +   S  GTA Y+S    L  +     D+ ALG + +   +G  P++G    N  Q +
Sbjct: 171 --KRTASFVGTAEYVSPELLLHSQCGFSSDIWALGCIIYQLNQGKPPFRG---ENELQTF 225

Query: 288 EKI 290
           EKI
Sbjct: 226 EKI 228

>CAGL0J03872g 365869..367854 similar to sp|Q01919 Saccharomyces
           cerevisiae YOR233w KIN4 ser/thr protein kinase or
           tr|Q03002 Saccharomyces cerevisiae YPL141c, start by
           similarity
          Length = 661

 Score = 57.0 bits (136), Expect = 2e-08,   Method: Compositional matrix adjust.
 Identities = 55/225 (24%), Positives = 101/225 (44%), Gaps = 31/225 (13%)

Query: 69  YKIGKKIGEGSFGVLFEG-TNMINGVP---------VAIKFEPRKTEAPQLRDEYKTYKI 118
           Y +G  +GEG FG +  G T   +  P         VAIK   R T       E K Y+ 
Sbjct: 44  YIVGSTLGEGEFGKVKLGWTRTPSTGPEQRPAVSKQVAIKLIRRDTIVKNSEKEIKIYRE 103

Query: 119 LNGTPNIPYAYYFG-QEGLHNILVIDLLG--PSLEDLFDWCGRKFSVK--TVVQVAVQMI 173
           +N   ++ +      +E L N   I ++    S  + + +  RK  +K  T  ++  Q+I
Sbjct: 104 INALKHLTHPNVVRLEEVLQNSKYIGIVLEYASGGEFYKYIQRKRRLKESTACRLFAQLI 163

Query: 174 TLIEDLHAHDLIYRDIKPDNFLIGRPGQPDANNIHLIDFGMAKQYRDPKTKQHIPYRE-K 232
           + +  +H+ +L++RD+K +N L+ +       N+ + DFG   ++        +P  E  
Sbjct: 164 SGVTYMHSKNLVHRDLKLENLLLDK-----NENLVITDFGFVNEF--------LPDNEYM 210

Query: 233 KSLSGTARYMSINTHLGREQ--SRRDDMEALGHVFFYFLRGHLPW 275
           K+  G+  Y +    +      +R+ D+ + G + +  L G+LPW
Sbjct: 211 KTSCGSPCYAAPELVISTRPYVARKADVWSCGIILYAMLAGYLPW 255

>YPL153C (RAD53) [5294] chr16 complement(261726..264191)
           Serine/threonine/tyrosine protein kinase with a
           checkpoint function in S and G2 phases, contains
           forkhead associated (FHA) domain [2466 bp, 821 aa]
          Length = 821

 Score = 57.0 bits (136), Expect = 2e-08,   Method: Compositional matrix adjust.
 Identities = 56/238 (23%), Positives = 103/238 (43%), Gaps = 33/238 (13%)

Query: 71  IGKKIGEGSFGVLFEGTNMINGVPVAIKFEPRKTEAPQLRDEYKTYKILNGT--PNIPYA 128
           I + +G+G+F  + +      G   A+K   ++     +    +  ++L     P I   
Sbjct: 200 IDEVVGQGAFATVKKAIERTTGKTFAVKIISKRKVIGNMDGVTRELEVLQKLNHPRIVRL 259

Query: 129 YYFGQEGLHNILVIDLLGPSLEDLFDWCGRKFSVKTVV--QVAVQMITLIEDLHAHDLIY 186
             F ++     +V++ +  S  DL D+     +V      +++ Q++T I+ +H+  + +
Sbjct: 260 KGFYEDTESYYMVMEFV--SGGDLMDFVAAHGAVGEDAGREISRQILTAIKYIHSMGISH 317

Query: 187 RDIKPDNFLIGRPGQPDANNIHLIDFGMAKQYRDPKTKQHIPYREKKSLSGTARYMSINT 246
           RD+KPDN LI    Q D   + + DFG+AK   +            K+  GT  Y++   
Sbjct: 318 RDLKPDNILI---EQDDPVLVKITDFGLAKVQGNGSF--------MKTFCGTLAYVAPEV 366

Query: 247 HLGR-------------EQSRRDDMEALGHVFFYFLRGHLPWQGLKAPNNKQKYEKIG 291
             G+             E S   DM ++G + +  L GHLP+ G       Q Y++IG
Sbjct: 367 IRGKDTSVSPDEYEERNEYSSLVDMWSMGCLVYVILTGHLPFSG---STQDQLYKQIG 421

>Scas_673.20*
          Length = 758

 Score = 57.0 bits (136), Expect = 3e-08,   Method: Compositional matrix adjust.
 Identities = 58/223 (26%), Positives = 98/223 (43%), Gaps = 42/223 (18%)

Query: 68  HYKIGKKIGEGSFGVLFEGTNMINGVPVAIK-----FEPRK----TEAPQLRDEYKTYKI 118
            Y+  K+IGEG+ G+++    +   + VAIK      +PR     TE   L+ EY+   I
Sbjct: 480 RYRKLKRIGEGASGIVYTAYEIGTDISVAIKQIDLKIQPRLQMIWTEMLVLK-EYQHPNI 538

Query: 119 LNGTPNIPYAYYFGQEGLHNILVIDLL---GPSLEDLFDWCGRKFSVKTVVQVAV---QM 172
           +N         +     LH+ L I +    G SL D+       F   T  Q+A    + 
Sbjct: 539 IN---------FINSYLLHDTLWIVMEYMDGGSLADIV-----SFFTPTEEQMATICRET 584

Query: 173 ITLIEDLHAHDLIYRDIKPDNFLIGRPGQPDANNIHLIDFGMAKQYRDPKTKQHIPYREK 232
           +  +  LH+  +++RDIK DN L+   G     +I + DFG   Q  +  TK       +
Sbjct: 585 LFGLNFLHSRGIVHRDIKSDNILLSMNG-----DIKITDFGFCGQLTESNTK-------R 632

Query: 233 KSLSGTARYMSINTHLGREQSRRDDMEALGHVFFYFLRGHLPW 275
            ++ GT  +M+      +E   + D+ +LG +    + G  P+
Sbjct: 633 TTMVGTPYWMAPEVIASKEYGPKVDVWSLGIMIIEMIEGEPPY 675

>Kwal_56.22693
          Length = 984

 Score = 57.0 bits (136), Expect = 3e-08,   Method: Compositional matrix adjust.
 Identities = 68/303 (22%), Positives = 127/303 (41%), Gaps = 38/303 (12%)

Query: 69  YKIGKKIGEGSFGVLFEGTNMINGVPVAIK-----FEPRKTEAPQLRDEYKTYKILNGTP 123
           ++ G+ +G+GS+  +    +  +G   A+K     +  R+ +   +  E  T + LN   
Sbjct: 158 FRFGEVLGDGSYSTVMLARSNDSGKKYAVKVLNKEYLIRQKKVKYVNIEKNTLQRLNDGR 217

Query: 124 NIPYAYYFGQEGLHNILVIDLLGPSLEDLFDWCGRKF---SVKTVVQVAVQMITLIEDLH 180
            +   Y+  Q+      +++   P+ +  F    +KF   S +  V  + Q++  I+ LH
Sbjct: 218 GVIKLYFTFQDEASLYFLLEY-APNGD--FLSVIKKFGSLSQECAVYYSAQILDAIDYLH 274

Query: 181 AHDLIYRDIKPDNFLIGRPGQPDANNIHLIDFGMAKQYRDPKTKQHIPYREK-KSLSGTA 239
              +++RDIKP+N L+ +  +     + L DFG A+     +T Q     E+ KS  GTA
Sbjct: 275 HKGIVHRDIKPENILLDKDMK-----VKLTDFGTARILEKDETTQTFNLLERSKSFVGTA 329

Query: 240 RYMSINTHLGREQSRRDDMEALGHVFFYFLRGHLPWQGLKAPNNKQKYEKIGEKKRSTNV 299
            Y+S           + D+ A G + F  + G  P+   KA N    ++K+ + +     
Sbjct: 330 EYVSPELLNDNYVDYKCDIWAFGCILFQMIAGKPPF---KATNEYLTFQKVMKVQ----- 381

Query: 300 YDLAQGLPVQFGRYLEIVRSLSFEECPDYEGYRKLLLSVLDDLGETADGQYDWMKLNDGR 359
           Y    G P+     ++ +   S E+  D    +K                +  +  NDG 
Sbjct: 382 YAFTAGFPLVIRDLIKKILVKSPEQRLDASQIKKHHF-------------FKDVNFNDGS 428

Query: 360 GWD 362
            WD
Sbjct: 429 VWD 431

>Scas_660.28
          Length = 623

 Score = 56.2 bits (134), Expect = 3e-08,   Method: Compositional matrix adjust.
 Identities = 48/159 (30%), Positives = 80/159 (50%), Gaps = 14/159 (8%)

Query: 68  HYKIGKKIGEGSFGVLFEGTNMINGVPVAIKFEPRKTEAP---QLRDEYK-TYKILNGTP 123
           +Y+I K +GEGSFG +    +M  G  VA+K   +K  A    Q R E + +Y  L   P
Sbjct: 45  NYQIVKTLGEGSFGKVKLAYHMTTGQKVALKIINKKVLAKSDMQGRIEREISYLRLLRHP 104

Query: 124 NIPYAYYFGQEGLHNILVIDLLGPSLEDLFDWCGR--KFSVKTVVQVAVQMITLIEDLHA 181
           +I   Y   +     I+V++  G    +LFD+  +  K S     +   Q+I+ +E  H 
Sbjct: 105 HIIKLYDVIKSKDEIIMVMEYAG---NELFDYIVQRDKMSEDEARRFFQQIISAVEYCHR 161

Query: 182 HDLIYRDIKPDNFLIGRPGQPDANNIHLIDFGMAKQYRD 220
           H +++RD+KP+N L+      +  N+ + DFG++    D
Sbjct: 162 HKIVHRDLKPENLLLD-----EHLNVKIADFGLSNIMTD 195

>YGR052W (YGR052W) [2015] chr7 (593598..594707) Serine/threonine
           protein kinase of unknown function [1110 bp, 369 aa]
          Length = 369

 Score = 55.8 bits (133), Expect = 4e-08,   Method: Compositional matrix adjust.
 Identities = 55/220 (25%), Positives = 94/220 (42%), Gaps = 28/220 (12%)

Query: 73  KKIGEGSFGVLFEGTNMINGVPVAIKFEPR-KTEAPQLRDEYKTYKILNGT---PNIPYA 128
           + I  G+F  +++  +  +   VA+K  P+ KT    +++EY   KIL+     PNI   
Sbjct: 6   RSIQSGTFSTVYKAWSTTHNRYVALKITPKYKTSEANMKNEYDVMKILSSCNPHPNICSM 65

Query: 129 YYFGQEGLHNILVIDLLGP-SLEDLFDWCGRKFSVKTVVQVAVQMITLIEDL-------H 180
             F  +  + I+V++      L D  D    + S  +   + + M  +I+ L       H
Sbjct: 66  LDFYTDDSYYIMVLEYCECGDLYDFLDIAKSQGSPSSPSLIQIDMQKIIKQLCSAISFAH 125

Query: 181 AHDLIYRDIKPDNFLIGRPGQPDANNIHLIDFGMAKQYRDPKTKQHIP----YREKKSLS 236
           +  + +RDIKP+N L+   G     +I L D+G A Q   PK+         YR  ++ S
Sbjct: 126 SLGIAHRDIKPENILLTING-----DIKLADWGHAIQ--SPKSNDFQIGTDNYRAPETFS 178

Query: 237 GTARYMSINTHLGREQ-----SRRDDMEALGHVFFYFLRG 271
           G         +  R       + + D  +LG   FY + G
Sbjct: 179 GRVSNSCFKKNFDRSSAPLYNTYQADYWSLGATIFYLMFG 218

>ABL034W [558] [Homologous to ScYKL101W (HSL1) - SH]
           complement(333434..337711) [4278 bp, 1425 aa]
          Length = 1425

 Score = 56.6 bits (135), Expect = 4e-08,   Method: Compositional matrix adjust.
 Identities = 54/220 (24%), Positives = 96/220 (43%), Gaps = 28/220 (12%)

Query: 69  YKIGKKIGEGSFGVLFEGTNMINGVPVAIKFEPRK---------TEAP-QLRDEYKTYKI 118
           +K+GK +G+GS G +    NM +G   AIK  P++         T  P  +  E    K+
Sbjct: 61  WKLGKTLGKGSSGRVRLAKNMQSGKLAAIKIVPKRNVRHNQKQVTALPYGIEREIIIMKL 120

Query: 119 LNGTPNIPYAYYFGQEGLHNILVIDLLGPSLEDLFDW--CGRKFSVKTVVQVAVQMITLI 176
           +   PNI   Y   +      LV++ +     +LFD+     K   +  +    Q++  +
Sbjct: 121 ITH-PNIMALYEVWENKSELYLVLEYVEGG--ELFDYLIARGKLPEQEAIHYFKQIVQGV 177

Query: 177 EDLHAHDLIYRDIKPDNFLIGRPGQPDANNIHLIDFGMAKQYRDPKTKQHIPYREKKSLS 236
              H  ++ +RD+KP+N L+ +  +     + + DFGMA              R  ++  
Sbjct: 178 SYCHNFNICHRDLKPENLLLDKKNK----TVKIADFGMA--------ALETTNRLLETSC 225

Query: 237 GTARYMSINTHLGRE-QSRRDDMEALGHVFFYFLRGHLPW 275
           G+  Y S    +G++      D+ + G + F  L GHLP+
Sbjct: 226 GSPHYASPEIVMGQKYHGSPSDVWSCGIILFALLTGHLPF 265

>AFL188C [3007] [Homologous to ScYDL101C (DUN1) - SH] (88793..90211)
           [1419 bp, 472 aa]
          Length = 472

 Score = 56.2 bits (134), Expect = 4e-08,   Method: Compositional matrix adjust.
 Identities = 61/239 (25%), Positives = 102/239 (42%), Gaps = 35/239 (14%)

Query: 68  HYKIGKKIGEGSFGVLFEGTNMINGVPVAIK-FEPRKTE----APQLRDEYKTYKILNGT 122
            Y  GK++G G + ++ E  N I G  VA+K F P+K +      Q R+E K    LN  
Sbjct: 154 RYIPGKELGSGHYAIVKEAINKITGQSVAVKIFHPQKNDDAKKTRQFREETKILMGLNHE 213

Query: 123 PNIPYAYYF----GQEGLHNILVIDLLGPSLEDLFDWCGRKFSVKTVVQVAV--QMITLI 176
             +     F     +  +   LV++ +     +LFD   RK  +      A+  Q++  +
Sbjct: 214 NIVKLLERFVEPLSKSQVQTYLVLEKIQDG--ELFDKIVRKTKLHQDETRALFKQILAGL 271

Query: 177 EDLHAHDLIYRDIKPDNFL--IGRPGQPDAN------------NIHLIDFGMAKQYRDPK 222
           + LH  ++I+RDIKP+N L  I R   PD               + + DFG+AK   +  
Sbjct: 272 KYLHDRNIIHRDIKPENILLSIRRRTSPDQVQLGPWDEDELDITVKIADFGLAKFTGE-- 329

Query: 223 TKQHIPYREKKSLSGTARYMSINTHLGREQSRRDDMEALGHVFFYFLRGHLPWQGLKAP 281
                  +   +L GT  Y++         + + D+ + G + +  L G  P+    AP
Sbjct: 330 ------MQFTTTLCGTPSYVAAEVLTKTGYTSKVDLWSAGVLLYVCLCGFPPFSDQLAP 382

>CAGL0M08910g complement(887703..889541) highly similar to sp|Q00372
           Saccharomyces cerevisiae YDR477w carbon catabolite
           derepressing ser/thr protein kinase, hypothetical start
          Length = 612

 Score = 56.2 bits (134), Expect = 4e-08,   Method: Compositional matrix adjust.
 Identities = 48/159 (30%), Positives = 81/159 (50%), Gaps = 14/159 (8%)

Query: 68  HYKIGKKIGEGSFGVLFEGTNMINGVPVAIKFEPRKTEAP---QLRDEYK-TYKILNGTP 123
           +Y+I K +GEGSFG +    ++  G  VA+K   +K  A    Q R E + +Y  L   P
Sbjct: 38  NYQIVKTLGEGSFGKVKLAYHVTTGQKVALKIINKKVLAKSDMQGRIEREISYLRLLRHP 97

Query: 124 NIPYAYYFGQEGLHNILVIDLLGPSLEDLFDWCGR--KFSVKTVVQVAVQMITLIEDLHA 181
           +I   Y   +     I+VI+  G    +LFD+  +  K S +   +   Q+I+ +E  H 
Sbjct: 98  HIIKLYDVIKSKDEIIMVIEYAG---NELFDYIVQRNKMSEQEARRFFQQIISAVEYCHR 154

Query: 182 HDLIYRDIKPDNFLIGRPGQPDANNIHLIDFGMAKQYRD 220
           H +++RD+KP+N L+      +  N+ + DFG++    D
Sbjct: 155 HKIVHRDLKPENLLLD-----EHLNVKIADFGLSNIMTD 188

>Kwal_26.8709
          Length = 829

 Score = 56.2 bits (134), Expect = 5e-08,   Method: Compositional matrix adjust.
 Identities = 57/224 (25%), Positives = 97/224 (43%), Gaps = 33/224 (14%)

Query: 69  YKIGKKIGEGSFGVLFEG----TNMINGVP--VAIKFEPRKTEAPQLRDEYKTYKILNGT 122
           Y +G  +GEG FG +  G    +N    VP  VAIK   R T       E K Y+ +N  
Sbjct: 40  YIVGSTLGEGEFGKVKLGWSKTSNSSMDVPKQVAIKLIRRDTIPKNSEKEIKIYREINAL 99

Query: 123 -----PNIPYAYYFGQEGLHNILVIDLLGPSLEDLFDWCGRKFSVKT--VVQVAVQMITL 175
                PNI       Q   +  +V++    S  + + +  +K  +K     ++  Q+I+ 
Sbjct: 100 KHLNHPNIVRLEEVLQNSKYIGIVLEYA--SGGEFYKYIQKKRRLKEGPACRLFAQLISG 157

Query: 176 IEDLHAHDLIYRDIKPDNFLIGRPGQPDANNIHLIDFGMAKQYRDP----KTKQHIPYRE 231
           +  +H+  L++RD+K +N L+ +       N+ + DFG   ++       KT    P   
Sbjct: 158 VYYMHSKGLVHRDLKLENLLLDK-----NENLLITDFGFVNEFLPENELMKTSCGSPCYA 212

Query: 232 KKSLSGTARYMSINTHLGREQSRRDDMEALGHVFFYFLRGHLPW 275
              L  TAR           ++R+ D+ + G + +  L G+LPW
Sbjct: 213 APELVVTARPY---------EARKADVWSCGVILYAMLAGYLPW 247

>YHR205W (SCH9) [2490] chr8 (509361..511835) Serine/threonine
           protein kinase involved in stress response and
           nutrient-sensing signaling pathway that is probably
           parallel to cAMP pathway, affects life span [2475 bp,
           824 aa]
          Length = 824

 Score = 56.2 bits (134), Expect = 5e-08,   Method: Compositional matrix adjust.
 Identities = 38/124 (30%), Positives = 61/124 (49%), Gaps = 20/124 (16%)

Query: 170 VQMITLIEDLHAHDLIYRDIKPDNFLIGRPGQPDAN-NIHLIDFGMAKQYRDPKTKQHIP 228
            +++  +E LH +D++YRD+KP+N L+      DAN NI L DFG++K     +T     
Sbjct: 520 AELVLALEHLHDNDIVYRDLKPENILL------DANGNIALCDFGLSKADLKDRT----- 568

Query: 229 YREKKSLSGTARYMSINTHLGREQ-SRRDDMEALGHVFFYFLRGHLPWQGLKAPNNKQKY 287
                +  GT  Y++    L     ++  D  +LG + F    G   W    A NN++ Y
Sbjct: 569 ----NTFCGTTEYLAPELLLDETGYTKMVDFWSLGVLIFEMCCG---WSPFFAENNQKMY 621

Query: 288 EKIG 291
           +KI 
Sbjct: 622 QKIA 625

>YDR477W (SNF1) [1293] chr4 (1412361..1414262) Serine/threonine
           protein kinase essential for derepression of
           glucose-repressed genes, acts in concert with Snf4p,
           involved in aging [1902 bp, 633 aa]
          Length = 633

 Score = 55.8 bits (133), Expect = 5e-08,   Method: Compositional matrix adjust.
 Identities = 48/159 (30%), Positives = 80/159 (50%), Gaps = 14/159 (8%)

Query: 68  HYKIGKKIGEGSFGVLFEGTNMINGVPVAIKFEPRKTEAP---QLRDEYK-TYKILNGTP 123
           +Y+I K +GEGSFG +    +   G  VA+K   +K  A    Q R E + +Y  L   P
Sbjct: 54  NYQIVKTLGEGSFGKVKLAYHTTTGQKVALKIINKKVLAKSDMQGRIEREISYLRLLRHP 113

Query: 124 NIPYAYYFGQEGLHNILVIDLLGPSLEDLFDWCGR--KFSVKTVVQVAVQMITLIEDLHA 181
           +I   Y   +     I+VI+  G    +LFD+  +  K S +   +   Q+I+ +E  H 
Sbjct: 114 HIIKLYDVIKSKDEIIMVIEYAG---NELFDYIVQRDKMSEQEARRFFQQIISAVEYCHR 170

Query: 182 HDLIYRDIKPDNFLIGRPGQPDANNIHLIDFGMAKQYRD 220
           H +++RD+KP+N L+      +  N+ + DFG++    D
Sbjct: 171 HKIVHRDLKPENLLLD-----EHLNVKIADFGLSNIMTD 204

>CAGL0K10604g complement(1029226..1030566) similar to sp|P27466
           Saccharomyces cerevisiae YFR014c CMK1
           Ca2+/calmodulin-dependent ser/thr protein kinase type I,
           hypothetical start
          Length = 446

 Score = 55.8 bits (133), Expect = 5e-08,   Method: Compositional matrix adjust.
 Identities = 50/214 (23%), Positives = 97/214 (45%), Gaps = 15/214 (7%)

Query: 69  YKIGKKIGEGSFGVLFEGTNMINGVPVAIKFEPRKTEAPQ-----LRDEYKTYKILNGTP 123
           Y   + +G GSFGV+     + +   VA+K   ++          + DE    + L+   
Sbjct: 65  YLFQRTLGAGSFGVVKRAKQLHSDEDVAVKILLKRALEKNGGLEPIYDELNIIQHLDHPN 124

Query: 124 NIPYAYYFGQEGLHNILVIDLLGPSLEDLFDWCGRKFSVKTVVQVAVQMITLIEDLHAHD 183
            + +  +F  E    I+     G  L D     G K++ +  V + VQ++  +E LH+ +
Sbjct: 125 IVKFKDWFETESKFYIVTQLASGGELFDRIMHDG-KYTEEDAVNIVVQILKAVEYLHSQN 183

Query: 184 LIYRDIKPDNFLIGRPGQPDANNIHLIDFGMAKQYRDPKTKQHIPYREKKSLSGTARYMS 243
           +I+RD+KP+N L     +   + I L DFG+A+Q  +      + YR     +G+  Y++
Sbjct: 184 IIHRDLKPENLLYLDKSKD--SRIVLADFGIARQLEND---DDVIYRP----AGSLGYVA 234

Query: 244 INTHLGREQSRRDDMEALGHVFFYFLRGHLPWQG 277
                     +  D+ ++G + +  L G+ P++ 
Sbjct: 235 PEVFTSDGHGKPSDIWSVGVITYTLLCGYSPFKA 268

>CAGL0K03399g complement(310487..312598) highly similar to sp|P12688
           Saccharomyces cerevisiae YKL126w
           Serine/threonine-protein kinase, start by similarity
          Length = 703

 Score = 55.8 bits (133), Expect = 5e-08,   Method: Compositional matrix adjust.
 Identities = 60/230 (26%), Positives = 99/230 (43%), Gaps = 27/230 (11%)

Query: 69  YKIGKKIGEGSFGVLFE----GTNMINGVPVAIK-FEPRKTEAPQLRDEYKTYKILNGTP 123
           + + K IG+GSFG + +     T  I  +    K +   K+E      E      ++   
Sbjct: 370 FDLLKVIGKGSFGKVMQVRKKDTKKIYALKAIRKSYIVSKSEVTHTLAERTVLARIDCPF 429

Query: 124 NIPYAYYF-GQEGLHNILVIDLLGPSLEDLFDWCGR--KFSVKTVVQVAVQMITLIEDLH 180
            +P  + F  QE L+ +L     G    +LF    R  +F +      A +++  ++ LH
Sbjct: 430 IVPLKFSFQSQEKLYLVLACINGG----ELFYHLQREGRFDLSRSRFYAAELLCALDTLH 485

Query: 181 AHDLIYRDIKPDNFLIGRPGQPDANNIHLIDFGMAKQYRDPKTKQHIPYREKKSLSGTAR 240
             D+IYRD+KP+N L+   G     +I L DFG+ K     + K         +  GT  
Sbjct: 486 KMDVIYRDLKPENILLDYQG-----HIALCDFGLCKLNMKDEDKTD-------TFCGTPE 533

Query: 241 YMSINTHLGREQSRRDDMEALGHVFFYFLRGHLPWQGLKAPNNKQKYEKI 290
           Y++    LG+  S+  D   LG + +  L G  P+     P   + Y+KI
Sbjct: 534 YLAPELLLGQGYSKVVDWWTLGVLLYEMLTGLPPYYDENVP---KMYKKI 580

>YNR031C (SSK2) [4613] chr14 complement(680693..685432) MAP kinase
            kinase kinase (MAPKKK) involved in the high-osmolarity
            signal transduction pathway [4740 bp, 1579 aa]
          Length = 1579

 Score = 56.2 bits (134), Expect = 6e-08,   Method: Compositional matrix adjust.
 Identities = 67/253 (26%), Positives = 110/253 (43%), Gaps = 50/253 (19%)

Query: 65   VGLHYKIGKKIGEGSFGVLFEGTNMINGVPVAIK---FEPRKTEA---PQLRDEYKTYKI 118
            V + ++    IG G+FG ++   ++ NG  +A+K    +  K+     P +++E    +I
Sbjct: 1262 VSMRWQKRNFIGGGTFGRVYSAVDLDNGEILAVKEINIQDSKSMQKIFPLIKEEMSVLEI 1321

Query: 119  LNGTPNIPYAYYFGQEGLH----NILVIDLLGPSLEDLFDWCGRKFSVKTVVQV-AVQMI 173
            LN  PNI    Y+G E +H    NI +    G SL  L +  GR    + V QV  +Q++
Sbjct: 1322 LNH-PNI--VSYYGVE-VHRDKVNIFMEYCEGGSLAALLE-HGR-IEDEMVTQVYTLQLL 1375

Query: 174  TLIEDLHAHDLIYRDIKPDNFLIGRPGQPDANNIHLIDFGMAKQYRDPKTK--------- 224
              +  LH   +++RD+KP+N L+   G      I  +DFG AK+  +  T+         
Sbjct: 1376 EGLAYLHESGIVHRDVKPENILLDFNGV-----IKYVDFGAAKKIANNGTRLASMNKIEN 1430

Query: 225  --------QHIPYREKK--------SLSGTARYM---SINTHLGREQSRRDDMEALGHVF 265
                     H+   +           + GT  YM   SI     + +   DD+ +LG V 
Sbjct: 1431 ADGEHEDVTHVSDSKAVKNNENALLDMMGTPMYMAPESITGSTTKGKLGADDVWSLGCVV 1490

Query: 266  FYFLRGHLPWQGL 278
               + G  PW  L
Sbjct: 1491 LEMITGRRPWANL 1503

>CAGL0G04609g complement(437162..440059) similar to sp|Q12236
           Saccharomyces cerevisiae YOL100w PKH2, hypothetical
           start
          Length = 965

 Score = 55.8 bits (133), Expect = 7e-08,   Method: Compositional matrix adjust.
 Identities = 60/242 (24%), Positives = 101/242 (41%), Gaps = 38/242 (15%)

Query: 69  YKIGKKIGEGSFGVLFEGTNMINGVPV-AIKFEPRKTEAPQLRDEY--------KTYKIL 119
           +K G  +G+GS+  +F  T+  +     A+K   ++    Q + +Y        +  K +
Sbjct: 118 FKFGDMLGDGSYSQVFLATSKTDSSKTYAVKVLNKEYLIKQKKVKYVNIEKTALQNLKSV 177

Query: 120 NGTPNIPYAY------YFGQEGLHNILVIDLLGPSLEDLFDWCGRKFSVKTVVQVAVQMI 173
            G  N+ + +      YF  E   N   + L+      L + C         +  + Q+I
Sbjct: 178 TGVINLSFTFQDEANLYFLLEYAPNGDFLSLIK-KFGTLNEEC--------TIYYSAQII 228

Query: 174 TLIEDLHAHDLIYRDIKPDNFLIGRPGQPDAN-NIHLIDFGMAKQYRDPKTKQHIPY--- 229
             I  +H+H +I+RDIKP+N L+      D N  I L DFG AK  +    K   P+   
Sbjct: 229 DAIGSMHSHGIIHRDIKPENILL------DGNMKIKLTDFGTAKLLQKKSDKNGKPHYNL 282

Query: 230 -REKKSLSGTARYMSINTHLGREQSRRDDMEALGHVFFYFLRGHLPWQGLKAPNNKQKYE 288
                S  GTA Y+S           + D+ A G + +  + G  P+   KA N    ++
Sbjct: 283 LTRSSSFVGTAEYVSPELLSDNYTDYKCDIWAFGCLVYQMIAGKPPF---KATNEYLTFQ 339

Query: 289 KI 290
           K+
Sbjct: 340 KV 341

>Kwal_26.7635
          Length = 691

 Score = 55.5 bits (132), Expect = 7e-08,   Method: Compositional matrix adjust.
 Identities = 57/227 (25%), Positives = 96/227 (42%), Gaps = 21/227 (9%)

Query: 69  YKIGKKIGEGSFGVLFE----GTNMINGVPVAIK-FEPRKTEAPQLRDEYKTYKILNGTP 123
           +++ K IG+GSFG + +     TN +  +    K +   K+E      E      +    
Sbjct: 358 FELLKVIGKGSFGKVMQVRKKDTNKVYALKAIRKSYIVSKSEVIHTLAERTVLARVENPF 417

Query: 124 NIPYAYYFGQEGLHNILVIDLLGPSLEDLFDWCGRKFSVKTVVQVAVQMITLIEDLHAHD 183
            +P  + F       I++  + G  L       GR FS+        +++  +E LH  D
Sbjct: 418 IVPLKFTFQSPDKLYIVLAFINGGELFYHLQREGR-FSLSRARLYTAELLCALETLHNLD 476

Query: 184 LIYRDIKPDNFLIGRPGQPDANNIHLIDFGMAKQYRDPKTKQHIPYREKKSLSGTARYMS 243
           +IYRD+KP+N L+   G      I L DFG+ K     + K +       +  GT  Y++
Sbjct: 477 VIYRDLKPENILLDHQGH-----IALCDFGLCKLNMKGQDKTN-------TFCGTPEYLA 524

Query: 244 INTHLGREQSRRDDMEALGHVFFYFLRGHLPWQGLKAPNNKQKYEKI 290
               LG+  S+  D   LG + +  + G  P+     P   + Y+KI
Sbjct: 525 PELLLGQGYSKVVDWWTLGVLLYEMMTGLPPYYDEDVP---KMYKKI 568

>Scas_689.25*
          Length = 409

 Score = 54.7 bits (130), Expect = 8e-08,   Method: Compositional matrix adjust.
 Identities = 53/213 (24%), Positives = 97/213 (45%), Gaps = 23/213 (10%)

Query: 69  YKIGKKIGEGSFGVLFEGTNMINGVPVAIKFEPRKT--EAPQLRDEYKTYKILNGTPNIP 126
           + I +  G GSFG +    ++ NG   A+K   ++T     Q+       ++L+ + +  
Sbjct: 99  FNILRTSGTGSFGRVHLVRSVHNGRFYALKVLKKQTVVRLKQVEHTNDERRMLSVSVHAF 158

Query: 127 YAYYFG--QEGLHNILVIDLLGPSLEDLFDWCGR--KFSVKTVVQVAVQMITLIEDLHAH 182
               +G  Q+  H  +++D +     +LF    R  +F        A ++   ++ LH+ 
Sbjct: 159 IVRLWGTFQDSEHLFMIMDYVEGG--ELFSLLRRSQRFPNPVAKFYAAEVCLALDYLHSL 216

Query: 183 DLIYRDIKPDNFLIGRPGQPDANNIHLIDFGMAKQYRDPKTKQHIPYREKKSLSGTARYM 242
           D+IYRD+KP+N L+ R G     +I + DFG AK   D      + Y    +L GT  Y+
Sbjct: 217 DIIYRDLKPENLLLDRNG-----HIKVTDFGFAKYVPD------VTY----TLCGTPDYI 261

Query: 243 SINTHLGREQSRRDDMEALGHVFFYFLRGHLPW 275
           +      +  ++  D  + G + +  L GH P+
Sbjct: 262 APEVISAKPYNKSVDWWSFGILIYEMLSGHTPF 294

>AFR377C [3569] [Homologous to ScYDR466W - SH] (1116595..1118775)
           [2181 bp, 726 aa]
          Length = 726

 Score = 55.5 bits (132), Expect = 8e-08,   Method: Compositional matrix adjust.
 Identities = 59/229 (25%), Positives = 104/229 (45%), Gaps = 24/229 (10%)

Query: 73  KKIGEGSFGVLFEGTNMINGVPVAIKFEPRKTEAPQLRDEYKTYK--ILN--GTPNIP-- 126
           +++G GS+  ++      +    AIK   ++    + + +Y T +   LN  G  N P  
Sbjct: 14  EELGHGSYSTVYRVVERSSQHQYAIKICSKRHIIGENKVKYVTIEKNTLNLLGQANHPGI 73

Query: 127 ---YAYYFGQEGLHNILVIDLLGPSLEDLFDWCGRKFSVKTVVQVAVQMITLIEDLHAHD 183
              Y  +  QE L+ ++ +   G  L+ L     R FS         Q++  +E +H+  
Sbjct: 74  IKLYYTFHDQENLYFVMDLAPGGELLQLLRR--QRVFSEAWARHYMCQLVDTVEYIHSMG 131

Query: 184 LIYRDIKPDNFLIGRPGQPDANNIHLIDFGMAKQY--RDPKTKQHIPYREKKSLSGTARY 241
           +I+RD+KP+N L+ + G+     + + DFG A      D  +    P     S  GTA Y
Sbjct: 132 VIHRDLKPENVLLDKEGR-----LMIADFGAAYTVGQSDAGSDGDKP---ATSFVGTAEY 183

Query: 242 MSINTHLGREQSRRDDMEALGHVFFYFLRGHLPWQGLKAPNNKQKYEKI 290
           +S    L  +     D+ ALG + + FL+G  P++G    N  + +E+I
Sbjct: 184 VSPELLLENKSYYSSDVWALGCMLYQFLQGTPPFRG---QNEMETFEQI 229

>Kwal_47.18233
          Length = 598

 Score = 55.1 bits (131), Expect = 8e-08,   Method: Compositional matrix adjust.
 Identities = 47/158 (29%), Positives = 79/158 (50%), Gaps = 14/158 (8%)

Query: 69  YKIGKKIGEGSFGVLFEGTNMINGVPVAIKFEPRKTEAP---QLRDEYK-TYKILNGTPN 124
           Y+I K +GEGSFG +    ++  G  VA+K   +K  A    Q R E + +Y  L   P+
Sbjct: 31  YQIIKTLGEGSFGKVKLAYHVTTGQKVALKIINKKVLAKSDMQGRIEREISYLRLLRHPH 90

Query: 125 IPYAYYFGQEGLHNILVIDLLGPSLEDLFDWCGR--KFSVKTVVQVAVQMITLIEDLHAH 182
           I   Y   +     ++VI+  G    +LFD+  +  K S     +   Q+I+ +E  H H
Sbjct: 91  IIKLYDVVKSKDEIVMVIEYAG---NELFDYIVQRDKMSENEARRFFQQIISAVEYCHRH 147

Query: 183 DLIYRDIKPDNFLIGRPGQPDANNIHLIDFGMAKQYRD 220
            +++RD+KP+N L+      +  N+ + DFG++    D
Sbjct: 148 KIVHRDLKPENLLLD-----EHLNVKIADFGLSNIMTD 180

>CAGL0K06479g 636296..639271 some similarities with tr|Q03306
           Saccharomyces cerevisiae YDR466w, start by similarity
          Length = 991

 Score = 55.5 bits (132), Expect = 9e-08,   Method: Compositional matrix adjust.
 Identities = 63/244 (25%), Positives = 106/244 (43%), Gaps = 35/244 (14%)

Query: 73  KKIGEGSFGVLFEGTNMINGV-PVAIKFEPRKTEAPQLRDEYKTYK--ILN-----GTPN 124
           +++G GS+  +++  +  +   P AIK   ++    + + +Y T +   LN       P 
Sbjct: 15  EELGHGSYSTVYKALDKKDLKKPYAIKVCSKRHIIKEAKVKYVTIEKNTLNLLARGNHPG 74

Query: 125 IPYAYYFGQEGLHNILVIDLL-GPSLEDLFDWCGRKFSVKTVVQVAVQMITLIEDLHAHD 183
           I   YY   +  +   V+D   G  L  L    G  F+       A Q++  +E +HA  
Sbjct: 75  IVKLYYTFHDEENLYFVLDYASGGELLSLLHKMG-TFTDSWAKHFAAQLVDTLEFMHARG 133

Query: 184 LIYRDIKPDNFLIGRPGQPDANNIHLIDFGMA--------KQYRDPKTKQHIP------- 228
           +I+RD+KP+N L+ + G      + + DFG A        K        + IP       
Sbjct: 134 VIHRDLKPENVLLSKEGI-----LMITDFGAAATQNNFSDKDNTRSNANEGIPKDDVPSS 188

Query: 229 --YREKKSLSGTARYMSINTHLGREQSRRDDMEALGHVFFYFLRGHLPWQGLKAPNNKQK 286
               E  S  GTA Y+S    L  + S   D+ ALG + + F++G  P++G    N  + 
Sbjct: 189 GDKTECSSFVGTAEYVSPELLLYNKCSFGSDIWALGCMVYQFIQGFPPFRG---ENELKT 245

Query: 287 YEKI 290
           +EKI
Sbjct: 246 FEKI 249

>Kwal_14.1273
          Length = 415

 Score = 54.7 bits (130), Expect = 9e-08,   Method: Compositional matrix adjust.
 Identities = 63/281 (22%), Positives = 114/281 (40%), Gaps = 41/281 (14%)

Query: 74  KIGEGSFGVLFEGTNMINGVPVAIKFEPRKTE-------APQLRDEYKTYKIL-NGTPNI 125
           KI  GSF  ++   +      VA+K   + +E       A  +  E +  ++L  G PN+
Sbjct: 7   KIQSGSFSTVYRAYDTERARDVALKILKKPSEPAMASKLATLVGSELEVLRVLGTGHPNV 66

Query: 126 PYAYYFGQEGLHNILVIDLLGPSLEDLFD----WCGRKFSVKTV----VQVAVQMITLIE 177
                F +     + V++       DL+D    W  ++ S + V     +V +Q+ + IE
Sbjct: 67  CALLDFYERETCYVFVMEYAARG--DLYDVIRGW--KRHSAERVPVELARVVLQLCSAIE 122

Query: 178 DLHAHDLIYRDIKPDNFLIGRPGQPDANNIHLIDFGMAKQYRDPKTKQHIPYREKKSLSG 237
             H+  + +RDIKP+N L+   G     N+ L D+G++ + R              +  G
Sbjct: 123 YAHSCGIAHRDIKPENVLLDSAG-----NVKLADWGLSTRMR----------VSCDTRIG 167

Query: 238 TARYMSINTHLGREQSRRDDMEALGHVFFYFLRGHLPWQG---LKAPNNKQKYEKIGEKK 294
           T +Y++   +     +   D  +LG    + + G  P++     K+PNN      +    
Sbjct: 168 TEKYLAPEAYASPHDTFLADFWSLGVTLLFVMFGACPFKNACLTKSPNNPNFAHFVASPH 227

Query: 295 RSTNVYDLAQGLPVQFGRYLEIVRSLSFEECPDYEGYRKLL 335
           R  + Y     LP++  R  +    LS     D     +LL
Sbjct: 228 RFISEYYF---LPLRAARSAKPAEWLSLPHVSDALQREQLL 265

>YDR466W (PKH3) [1284] chr4 (1395109..1397805) Serine/threonine
           protein kinase of unknown function [2697 bp, 898 aa]
          Length = 898

 Score = 55.1 bits (131), Expect = 1e-07,   Method: Compositional matrix adjust.
 Identities = 37/132 (28%), Positives = 62/132 (46%), Gaps = 18/132 (13%)

Query: 169 AVQMITLIEDLHAHDLIYRDIKPDNFLIGRPGQPDANNIHLIDFGMAKQYRDPKTKQHIP 228
             Q+I  +E +H+H +I+RD+KP+N L+ R G+     + + DFG A       +     
Sbjct: 119 TAQLIDALEFIHSHGIIHRDLKPENVLLDRDGR-----LMITDFGAAATIDPSLSGDSAK 173

Query: 229 YREKK----------SLSGTARYMSINTHLGREQSRRDDMEALGHVFFYFLRGHLPWQGL 278
           +              S  GTA Y+S    L  +     D+ ALG + + F++G  P++G 
Sbjct: 174 FNSDSNGSKDNQNCASFVGTAEYVSPELLLYNQCGYGSDIWALGCMIYQFVQGQPPFRG- 232

Query: 279 KAPNNKQKYEKI 290
              N  + +EKI
Sbjct: 233 --ENELKTFEKI 242

>CAGL0M08404g complement(836791..838179) some similarities with
           sp|P05986 Saccharomyces cerevisiae YKL166c TPK3 or
           sp|P06244 Saccharomyces cerevisiae YJL164c SRA3 or
           sp|P06245 Saccharomyces cerevisiae YPL203w TPK2,
           hypothetical start
          Length = 462

 Score = 54.7 bits (130), Expect = 1e-07,   Method: Compositional matrix adjust.
 Identities = 59/228 (25%), Positives = 101/228 (44%), Gaps = 26/228 (11%)

Query: 69  YKIGKKIGEGSFGVLFEGTNMINGVPVAIKFEPRKT-----EAPQLRDEYKTYKILNGTP 123
           ++I + +G GSFG +    +  NG   A+K   + T     +     DE +   I++  P
Sbjct: 152 FQILRTLGTGSFGRVHLIRSNHNGRFYALKALKKHTVVKLKQVEHTNDERRMLSIVS-HP 210

Query: 124 NIPYAYYFGQEGLHNILVIDLL-GPSLEDLFDWCGRKFSVKTVVQVAVQMITLIEDLHAH 182
            I   +   Q+  H  +V+D + G  L  L     R F        A ++   +E LH+ 
Sbjct: 211 FIIRMWGTFQDSQHVFMVMDYIEGGELFSLLRKSQR-FPNPVAKFYAAEVCLALEYLHSK 269

Query: 183 DLIYRDIKPDNFLIGRPGQPDANNIHLIDFGMAKQYRDPKTKQHIPYREKKSLSGTARYM 242
           ++IYRD+KP+N L+ + G     +I + DFG AK   D      + Y    +L GT  Y+
Sbjct: 270 EIIYRDLKPENILLDKNG-----HIKITDFGFAKYVPD------VTY----TLCGTPDYI 314

Query: 243 SINTHLGREQSRRDDMEALGHVFFYFLRGHLPWQGLKAPNNKQKYEKI 290
           +      +  ++  D  + G + +  L G+ P+      N  + YE I
Sbjct: 315 APEVVSTKPYNKSVDWWSFGILIYEMLAGYTPFYD---ANTMKTYEHI 359

>CAGL0L11550g 1229719..1232937 similar to sp|P38692 Saccharomyces
           cerevisiae YHR102w NRK1 ser/thr protein kinase, start by
           similarity
          Length = 1072

 Score = 55.1 bits (131), Expect = 1e-07,   Method: Compositional matrix adjust.
 Identities = 52/230 (22%), Positives = 100/230 (43%), Gaps = 37/230 (16%)

Query: 65  VGLHYKIGKKIGEGSFGVLFEGTNMINGVPVAIK---FEPRKTEAPQLRDEYKTYKILNG 121
           +   +K  + IG G FG++++G ++      AIK    +  + E   ++ E +    L  
Sbjct: 12  ISSTFKRTEVIGRGKFGIVYKGYHVKTKQVYAIKVLNLDSSEDEVEDVQREIQFLASLKQ 71

Query: 122 TPNIPYAYYFGQEGLHNILVIDLLGPSLEDLFDWCGR----------KFSVKTVVQVAVQ 171
            PNI    Y+G           L G SL  + ++C            K   K +  +  +
Sbjct: 72  IPNI--TRYYGSY---------LRGTSLWIIMEYCAGGSLRSLLRPGKIDEKYIGVIMRE 120

Query: 172 MITLIEDLHAHDLIYRDIKPDNFLIGRPGQPDANNIHLIDFGMAKQYRDPKTKQHIPYRE 231
           ++  ++ +H  ++I+RDIK  N LI   GQ     + L DFG+A Q      +       
Sbjct: 121 LLVALKVIHKDNVIHRDIKAANVLITNEGQ-----VKLCDFGVAAQLNQTSLR------- 168

Query: 232 KKSLSGTARYMSINTHL-GREQSRRDDMEALGHVFFYFLRGHLPWQGLKA 280
           +++++GT  +M+    + G     + D+ +LG   +    G+ P+  ++A
Sbjct: 169 RQTMAGTPYWMAPEVIMEGVYYDTKVDIWSLGITAYEIATGNPPYCDVEA 218

>CAGL0G09020g 860266..861351 highly similar to sp|P06245
           Saccharomyces cerevisiae YPL203w TPK2 cAMP-dependent
           protein kinase 2, catalytic chain, hypothetical start
          Length = 361

 Score = 53.9 bits (128), Expect = 1e-07,   Method: Compositional matrix adjust.
 Identities = 58/229 (25%), Positives = 104/229 (45%), Gaps = 28/229 (12%)

Query: 69  YKIGKKIGEGSFGVLFEGTNMINGVPVAIKFEPRKTEAPQLR------DEYKTYKILNGT 122
           + I + +G GSFG +    ++ NG   AIK   +K +  +++      DE +  K++   
Sbjct: 51  FHIMRTLGTGSFGRVHLVRSVHNGRYYAIKV-LKKAQVVKMKQIEHTNDERRMLKLVEH- 108

Query: 123 PNIPYAYYFGQEGLHNILVIDLL-GPSLEDLFDWCGRKFSVKTVVQVAVQMITLIEDLHA 181
           P +   +   Q+  +  +V+D + G  L  L     ++F        A ++   +E LH 
Sbjct: 109 PFLIRMWGTFQDSRNLFMVMDYIEGGELFTLLR-KSQRFPNPVAKFYAAEVTLALEYLHF 167

Query: 182 HDLIYRDIKPDNFLIGRPGQPDANNIHLIDFGMAKQYRDPKTKQHIPYREKKSLSGTARY 241
           H++IYRD+KP+N L+ R G     +I + DFG AK+                +L GT  Y
Sbjct: 168 HNIIYRDLKPENILLDRNG-----HIKITDFGFAKEVETVTW----------TLCGTPDY 212

Query: 242 MSINTHLGREQSRRDDMEALGHVFFYFLRGHLPWQGLKAPNNKQKYEKI 290
           ++      +  ++  D  +LG + +  L G+ P+         + YEKI
Sbjct: 213 IAPEVIATKPYNKSVDWWSLGVLIYEMLAGYTPFYD---TTPMKTYEKI 258

>CAGL0I07513g 721775..725005 similar to sp|Q12236 Saccharomyces
           cerevisiae YOL100w PKH2, start by similarity
          Length = 1076

 Score = 54.7 bits (130), Expect = 1e-07,   Method: Compositional matrix adjust.
 Identities = 64/261 (24%), Positives = 108/261 (41%), Gaps = 46/261 (17%)

Query: 69  YKIGKKIGEGSFGVLFEGTNMINGVPVAIKFEPRKTEAPQLRDEY-----KTYKILNGTP 123
           +K G+ +G+G++  +   T   +G   A+K   ++    Q + +Y        + LN + 
Sbjct: 182 FKFGEMVGDGAYSTVMLATAKDSGKKYAVKVLNKEYLIKQKKVKYVNIEKNALQRLNNSR 241

Query: 124 NIPYAYYFGQE--GLHNIL----------VIDLLGPSLEDLFDWCGRKFSVKTVVQVAVQ 171
            I   ++  Q+   L+ +L          V+   G   ED    C R +S         Q
Sbjct: 242 GIVKLFFTFQDESSLYFLLEYAPNGDFLSVMKKYGSLSED----CTRYYSA--------Q 289

Query: 172 MITLIEDLHAHDLIYRDIKPDNFLIGRPGQPDANNIHLIDFGMAKQYRDPKTKQHIP--- 228
           +I  I+ LH+  +I+RDIKP+N L+ +  +     + + DFG AK        +  P   
Sbjct: 290 IIDGIKYLHSKGIIHRDIKPENILLDKDMK-----VKITDFGTAKILEPKNEDEDNPEFN 344

Query: 229 -YREKKSLSGTARYMSINTHLGREQSRRDDMEALGHVFFYFLRGHLPWQGLKAPNNKQKY 287
                KS  GTA Y+S           R D+ A G + F  + G  P+   KA N    +
Sbjct: 345 LLTRSKSFVGTAEYVSPELLNDSYVDARCDIWAFGCMVFQMIAGKPPF---KATNEYLTF 401

Query: 288 EKIGEKKRSTNVYDLAQGLPV 308
           +K+ + +     Y    G PV
Sbjct: 402 QKVMKVQ-----YAFTAGFPV 417

>ADR058C [1799] [Homologous to ScYBR160W (CDC28) - SH]
           (810941..811828) [888 bp, 295 aa]
          Length = 295

 Score = 53.5 bits (127), Expect = 1e-07,   Method: Compositional matrix adjust.
 Identities = 56/206 (27%), Positives = 91/206 (44%), Gaps = 22/206 (10%)

Query: 69  YKIGKKIGEGSFGVLFEGTNMINGVPVA----IKFEPRKTEAPQLR-DEYKTYKILNGTP 123
           YK  +K+GEG++GV+++  ++ +G  +     I+ E      P     E    K L    
Sbjct: 7   YKRLEKVGEGTYGVVYKAVDLRHGQRIVALKKIRLESEDEGVPSTAIREISLLKELKDD- 65

Query: 124 NIPYAYYFGQEGLHNI-LVIDLLGPSLEDLFDWCGRK--FSVKTVVQVAVQMITLIEDLH 180
           NI   Y       H + LV + L   L+   +   +      K + +  +Q+   I   H
Sbjct: 66  NIVRLYDIVHSDAHKLYLVFEFLELDLKRYMESVPKDQPLGDKIIKKFMMQLCKGIAYCH 125

Query: 181 AHDLIYRDIKPDNFLIGRPGQPDANNIHLIDFGMAKQYRDPKTKQHIPYREKKSLSGTAR 240
           AH +I+RD+KP N LI R G     N+ L DFG+A+ +        +P R       T  
Sbjct: 126 AHRIIHRDLKPQNLLINRNG-----NLKLGDFGLARAF-------GVPLRAYTHEIVTLW 173

Query: 241 YMSINTHLGREQ-SRRDDMEALGHVF 265
           Y +    LG +Q S   D+ ++G +F
Sbjct: 174 YRAPEVLLGGKQYSTGVDVWSIGCIF 199

>KLLA0B12716g 1109939..1112089 similar to sp|P12688 Saccharomyces
           cerevisiae YKL126w YPK1 ser/thr-specific protein kinase,
           start by similarity
          Length = 716

 Score = 54.7 bits (130), Expect = 1e-07,   Method: Compositional matrix adjust.
 Identities = 59/230 (25%), Positives = 98/230 (42%), Gaps = 27/230 (11%)

Query: 69  YKIGKKIGEGSFGVLFE----GTNMINGVPVAIK-FEPRKTEAPQLRDEYKTYKILNGTP 123
           + + K IG+GSFG + +     TN I  +    K +   K+E      E      ++   
Sbjct: 382 FDLLKVIGKGSFGKVMQVRKRDTNKIYALKAIRKSYIVSKSEVTHTLAERTVLARVDNPF 441

Query: 124 NIPYAYYF-GQEGLHNILVIDLLGPSLEDLFDWCGR--KFSVKTVVQVAVQMITLIEDLH 180
            +P  + F   E L+ +L     G    +LF    R  +F +        +++  +E LH
Sbjct: 442 IVPLKFSFQSSEKLYLVLAFINGG----ELFYHLQREGRFDLSRSRFYTAELLCALEALH 497

Query: 181 AHDLIYRDIKPDNFLIGRPGQPDANNIHLIDFGMAKQYRDPKTKQHIPYREKKSLSGTAR 240
             D+IYRD+KP+N L+   G     +I L DFG+ K     + K         +  GT  
Sbjct: 498 DFDIIYRDLKPENILLDYQG-----HIALCDFGLCKLNMKDQEKT-------TTFCGTPE 545

Query: 241 YMSINTHLGREQSRRDDMEALGHVFFYFLRGHLPWQGLKAPNNKQKYEKI 290
           Y++    LG+  ++  D   LG + +  L G  P+     P   + Y+KI
Sbjct: 546 YLAPELLLGQGYTKVVDWWTLGVLLYEMLTGLPPYYDEDVP---KMYKKI 592

>CAGL0F09075g 894761..897001 similar to sp|P11792 Saccharomyces
           cerevisiae YHR205w SCH9 serine/threonine protein kinase,
           start by similarity
          Length = 746

 Score = 54.3 bits (129), Expect = 1e-07,   Method: Compositional matrix adjust.
 Identities = 37/124 (29%), Positives = 61/124 (49%), Gaps = 20/124 (16%)

Query: 170 VQMITLIEDLHAHDLIYRDIKPDNFLIGRPGQPDAN-NIHLIDFGMAKQYRDPKTKQHIP 228
            +++  +E LH +D++YRD+KP+N L+      DAN NI L DFG++K     +T     
Sbjct: 448 AELVLALEHLHDNDIVYRDLKPENILL------DANGNIALCDFGLSKADLKDRT----- 496

Query: 229 YREKKSLSGTARYMSINTHLGREQ-SRRDDMEALGHVFFYFLRGHLPWQGLKAPNNKQKY 287
                +  GT  Y++    L     ++  D  +LG + F    G   W    A +N++ Y
Sbjct: 497 ----NTFCGTTEYLAPELLLDESGYTKMVDFWSLGVLIFEMCCG---WSPFYAEDNQKMY 549

Query: 288 EKIG 291
           +KI 
Sbjct: 550 QKIA 553

>YKL166C (TPK3) [3104] chr11 complement(134514..135710) Catalytic
           subunit of cAMP-dependent protein kinase 3, protein
           kinase A or PKA [1197 bp, 398 aa]
          Length = 398

 Score = 53.9 bits (128), Expect = 1e-07,   Method: Compositional matrix adjust.
 Identities = 58/228 (25%), Positives = 101/228 (44%), Gaps = 26/228 (11%)

Query: 69  YKIGKKIGEGSFGVLFEGTNMINGVPVAIKFEPRKT-----EAPQLRDEYKTYKILNGTP 123
           ++I + +G GSFG +    +  NG   A+K   + T     +     DE +   I++  P
Sbjct: 88  FQILRTLGTGSFGRVHLIRSNHNGRFYALKTLKKHTIVKLKQVEHTNDERRMLSIVSH-P 146

Query: 124 NIPYAYYFGQEGLHNILVIDLL-GPSLEDLFDWCGRKFSVKTVVQVAVQMITLIEDLHAH 182
            I   +   Q+     +V+D + G  L  L     ++F        A ++   +E LH+ 
Sbjct: 147 FIIRMWGTFQDSQQVFMVMDYIEGGELFSLLR-KSQRFPNPVAKFYAAEVCLALEYLHSK 205

Query: 183 DLIYRDIKPDNFLIGRPGQPDANNIHLIDFGMAKQYRDPKTKQHIPYREKKSLSGTARYM 242
           D+IYRD+KP+N L+ + G     +I + DFG AK   D      + Y    +L GT  Y+
Sbjct: 206 DIIYRDLKPENILLDKNG-----HIKITDFGFAKYVPD------VTY----TLCGTPDYI 250

Query: 243 SINTHLGREQSRRDDMEALGHVFFYFLRGHLPWQGLKAPNNKQKYEKI 290
           +      +  ++  D  + G + +  L G+ P+      N  + YE I
Sbjct: 251 APEVVSTKPYNKSVDWWSFGVLIYEMLAGYTPFYN---SNTMKTYENI 295

>YJL164C (TPK1) [2757] chr10 complement(109959..111152) Catalytic
           subunit of cAMP-dependent protein kinase 1, protein
           kinase A or PKA [1194 bp, 397 aa]
          Length = 397

 Score = 53.9 bits (128), Expect = 2e-07,   Method: Compositional matrix adjust.
 Identities = 61/233 (26%), Positives = 101/233 (43%), Gaps = 26/233 (11%)

Query: 64  IVGLHYKIGKKIGEGSFGVLFEGTNMINGVPVAIK-----FEPRKTEAPQLRDEYKTYKI 118
           IV  +++I + +G GSFG +    +  NG   A+K        R  +     DE     I
Sbjct: 82  IVYKNFQILRTLGTGSFGRVHLIRSRHNGRYYAMKVLKKEIVVRLKQVEHTNDERLMLSI 141

Query: 119 LNGTPNIPYAYYFGQEGLHNILVIDLL-GPSLEDLFDWCGRKFSVKTVVQVAVQMITLIE 177
           +   P I   +   Q+     +++D + G  L  L     R F        A ++   +E
Sbjct: 142 VTH-PFIIRMWGTFQDAQQIFMIMDYIEGGELFSLLRKSQR-FPNPVAKFYAAEVCLALE 199

Query: 178 DLHAHDLIYRDIKPDNFLIGRPGQPDANNIHLIDFGMAKQYRDPKTKQHIPYREKKSLSG 237
            LH+ D+IYRD+KP+N L+ + G     +I + DFG AK   D      + Y    +L G
Sbjct: 200 YLHSKDIIYRDLKPENILLDKNG-----HIKITDFGFAKYVPD------VTY----TLCG 244

Query: 238 TARYMSINTHLGREQSRRDDMEALGHVFFYFLRGHLPWQGLKAPNNKQKYEKI 290
           T  Y++      +  ++  D  + G + +  L G+ P+      N  + YEKI
Sbjct: 245 TPDYIAPEVVSTKPYNKSIDWWSFGILIYEMLAGYTPFYD---SNTMKTYEKI 294

>Kwal_47.16761
          Length = 744

 Score = 54.3 bits (129), Expect = 2e-07,   Method: Compositional matrix adjust.
 Identities = 37/124 (29%), Positives = 61/124 (49%), Gaps = 20/124 (16%)

Query: 170 VQMITLIEDLHAHDLIYRDIKPDNFLIGRPGQPDAN-NIHLIDFGMAKQYRDPKTKQHIP 228
            +++  +E LH +D++YRD+KP+N L+      DAN NI L DFG++K     +T     
Sbjct: 442 AELVLALEYLHENDIVYRDLKPENILL------DANGNIALCDFGLSKADLKDRT----- 490

Query: 229 YREKKSLSGTARYMSINTHLGREQ-SRRDDMEALGHVFFYFLRGHLPWQGLKAPNNKQKY 287
                +  GT  Y++    L     ++  D  +LG + F    G   W    A +N++ Y
Sbjct: 491 ----NTFCGTTEYLAPELLLDESGYTKMVDFWSLGVLIFEMCCG---WSPFFAEDNQKMY 543

Query: 288 EKIG 291
           +KI 
Sbjct: 544 QKIA 547

>AEL230W [2276] [Homologous to ScYDR477W (SNF1) - SH]
           complement(198401..200227) [1827 bp, 608 aa]
          Length = 608

 Score = 54.3 bits (129), Expect = 2e-07,   Method: Compositional matrix adjust.
 Identities = 47/158 (29%), Positives = 79/158 (50%), Gaps = 14/158 (8%)

Query: 69  YKIGKKIGEGSFGVLFEGTNMINGVPVAIKFEPRKTEAP---QLRDEYK-TYKILNGTPN 124
           Y++ K +GEGSFG +    ++  G  VA+K   +K  A    Q R E + +Y  L   P+
Sbjct: 39  YQVIKTLGEGSFGKVKLAHHVSTGQKVALKIINKKVLAKSDMQGRIEREISYLRLLRHPH 98

Query: 125 IPYAYYFGQEGLHNILVIDLLGPSLEDLFDWCGR--KFSVKTVVQVAVQMITLIEDLHAH 182
           I   Y   +     I+VI+  G    +LFD+  +  K S     +   Q+I+ +E  H H
Sbjct: 99  IIKLYDVIKSKDEIIMVIEYAG---NELFDYIVQRDKMSENEARRFFQQIISAVEYCHRH 155

Query: 183 DLIYRDIKPDNFLIGRPGQPDANNIHLIDFGMAKQYRD 220
            +++RD+KP+N L+      +  N+ + DFG++    D
Sbjct: 156 KIVHRDLKPENLLLD-----EHLNVKIADFGLSNIMTD 188

>Scas_690.13
          Length = 354

 Score = 53.5 bits (127), Expect = 2e-07,   Method: Compositional matrix adjust.
 Identities = 60/232 (25%), Positives = 105/232 (45%), Gaps = 26/232 (11%)

Query: 69  YKIGKKIGEGSFGVLFEGTNMINGVPVAIKF-----EPRKTEAPQLRDEYKTYKILNGTP 123
           +++ + +G GSFG +    ++ NG   AIK        R  +     DE +  K++   P
Sbjct: 44  FQVMRTLGTGSFGRVHLVRSVHNGRYYAIKVLKKQQVVRMKQIEHTNDERRMLKLVEH-P 102

Query: 124 NIPYAYYFGQEGLHNILVIDLL-GPSLEDLFDWCGRKFSVKTVVQVAVQMITLIEDLHAH 182
            +   +   Q+  +  +V+D + G  L  L     ++F        A ++   +E LH+H
Sbjct: 103 FLIRMWGTFQDSRNLFMVMDYIEGGELFSLLR-KSQRFPNPVAKFYAAEVTLGLEYLHSH 161

Query: 183 DLIYRDIKPDNFLIGRPGQPDANNIHLIDFGMAKQYRDPKTKQHIPYREKKSLSGTARYM 242
           ++IYRD+KP+N L+ R G     +I + DFG AK+  D  T          +L G   Y+
Sbjct: 162 NIIYRDLKPENILLDRNG-----HIKITDFGFAKEV-DTVT---------WTLCGPPDYI 206

Query: 243 SINTHLGREQSRRDDMEALGHVFFYFLRGHLPWQGLKAPNNKQKYEKIGEKK 294
           +      +  ++  D  +LG + F  L G+ P+         + YEKI + K
Sbjct: 207 APEVIATKPYNKSVDWWSLGVLIFEMLAGYTPFYDTTP---MKTYEKILQGK 255

>Sklu_2104.1 YBR160W, Contig c2104 694-1593
          Length = 299

 Score = 53.1 bits (126), Expect = 2e-07,   Method: Compositional matrix adjust.
 Identities = 55/206 (26%), Positives = 92/206 (44%), Gaps = 22/206 (10%)

Query: 69  YKIGKKIGEGSFGVLFEGTNMINGVPVA----IKFEPRKTEAPQLR-DEYKTYKILNGTP 123
           YK  +K+GEG++GV+++  ++ +G  +     I+ E      P     E    K L    
Sbjct: 7   YKRLEKVGEGTYGVVYKALDLRHGNRIVALKKIRLESEDEGVPSTAIREISLLKELRDD- 65

Query: 124 NIPYAYYFGQEGLHNI-LVIDLLGPSLEDLFDWCGRK--FSVKTVVQVAVQMITLIEDLH 180
           NI   Y       H + LV + L   L+   +   ++     K + +  +Q+   I   H
Sbjct: 66  NIVRLYDIVHSDAHKLYLVFEFLDLDLKRYMESVPKEQPLGNKIIKKFMMQLCKGIAYCH 125

Query: 181 AHDLIYRDIKPDNFLIGRPGQPDANNIHLIDFGMAKQYRDPKTKQHIPYREKKSLSGTAR 240
           AH +++RD+KP N LI R G     N+ L DFG+A+ +        +P R       T  
Sbjct: 126 AHRILHRDLKPQNLLINRDG-----NLKLGDFGLARAF-------GVPLRAYTHEIVTLW 173

Query: 241 YMSINTHLGREQ-SRRDDMEALGHVF 265
           Y +    LG +Q S   D+ ++G +F
Sbjct: 174 YRAPEVLLGGKQYSTGVDIWSIGCIF 199

>ABL028W [564] [Homologous to ScYKL126W (YPK1) - SH; ScYMR104C
           (YPK2) - SH] complement(345955..348123) [2169 bp, 722
           aa]
          Length = 722

 Score = 54.3 bits (129), Expect = 2e-07,   Method: Compositional matrix adjust.
 Identities = 59/228 (25%), Positives = 99/228 (43%), Gaps = 23/228 (10%)

Query: 69  YKIGKKIGEGSFGVLFE----GTNMINGVPVAIK-FEPRKTEAPQLRDEYKTYKILNGTP 123
           + + K IG+GSFG + +     TN I  +    K +   K+E      E      ++   
Sbjct: 389 FDLLKVIGKGSFGKVMQVKKKDTNKIYALKAIRKSYIVSKSEVTHTLAERTVLARVDNPF 448

Query: 124 NIPYAYYF-GQEGLHNILVIDLLGPSLEDLFDWCGRKFSVKTVVQVAVQMITLIEDLHAH 182
            +P  + F   E L+ +L   + G  L       GR F +        +++  +E LH+ 
Sbjct: 449 IVPLKFSFQSPEKLYLVLAF-INGGELFFHLQKEGR-FDLSRARFYTAELLCALETLHSL 506

Query: 183 DLIYRDIKPDNFLIGRPGQPDANNIHLIDFGMAKQYRDPKTKQHIPYREKKSLSGTARYM 242
           ++IYRD+KP+N L+   G     +I L DFG+ K     + K +       +  GT  Y+
Sbjct: 507 NVIYRDLKPENILLDYQG-----HIALCDFGLCKLNMKDQDKTN-------TFCGTPEYL 554

Query: 243 SINTHLGREQSRRDDMEALGHVFFYFLRGHLPWQGLKAPNNKQKYEKI 290
           +    LG+  S+  D   LG + +  L G  P+     P   + Y+KI
Sbjct: 555 APELLLGQGYSKVVDWWTLGVLLYEMLTGLPPYYDEDVP---KMYKKI 599

>YKL101W (HSL1) [3161] chr11 (248566..253122) Serine/threonine
           protein kinase that genetically interacts with histone
           mutants and negatively regulates Swe1p protein kinase
           [4557 bp, 1518 aa]
          Length = 1518

 Score = 54.3 bits (129), Expect = 2e-07,   Method: Compositional matrix adjust.
 Identities = 58/249 (23%), Positives = 105/249 (42%), Gaps = 56/249 (22%)

Query: 69  YKIGKKIGEGSFGVLFEGTNMINGVPVAIKFEPRK------TEAPQLRDEYKTYKILN-- 120
           +K+GK +G+GS G +    NM  G   AIK  P+K      +    + + Y +  + +  
Sbjct: 81  WKLGKTLGKGSSGRVRLAKNMETGQLAAIKIVPKKKAFVHCSNNGTVPNSYSSSMVTSNV 140

Query: 121 GTPNIPYAYY--------FGQEGLHNILVIDLLGPS------------------LE---- 150
            +P+I    +        +G E    I+++ L+  +                  LE    
Sbjct: 141 SSPSIASREHSNHSQTNPYGIE--REIVIMKLISHTNVMALFEVWENKSELYLVLEYVDG 198

Query: 151 -DLFDWCGRKFSV--KTVVQVAVQMITLIEDLHAHDLIYRDIKPDNFLIGRPGQPDANNI 207
            +LFD+   K  +  +  +    Q++  +   H+ ++ +RD+KP+N L+ +  +     I
Sbjct: 199 GELFDYLVSKGKLPEREAIHYFKQIVEGVSYCHSFNICHRDLKPENLLLDKKNR----RI 254

Query: 208 HLIDFGMAKQYRDPKTKQHIPYREKKSLSGTARYMSINTHLGRE-QSRRDDMEALGHVFF 266
            + DFGMA           +P +  K+  G+  Y S    +GR       D+ + G V F
Sbjct: 255 KIADFGMA--------ALELPNKLLKTSCGSPHYASPEIVMGRPYHGGPSDVWSCGIVLF 306

Query: 267 YFLRGHLPW 275
             L GHLP+
Sbjct: 307 ALLTGHLPF 315

>Sklu_2430.5 YKL126W, Contig c2430 8144-10345
          Length = 733

 Score = 53.9 bits (128), Expect = 2e-07,   Method: Compositional matrix adjust.
 Identities = 59/228 (25%), Positives = 99/228 (43%), Gaps = 23/228 (10%)

Query: 69  YKIGKKIGEGSFGVLFE----GTNMINGVPVAIK-FEPRKTEAPQLRDEYKTYKILNGTP 123
           + + K IG+GSFG + +     TN I  +    K +   K+E      E      ++   
Sbjct: 400 FDLLKVIGKGSFGKVMQVRKKDTNKIYALKAIRKSYIVSKSEVTHTLAERTVLARVDNPF 459

Query: 124 NIPYAYYF-GQEGLHNILVIDLLGPSLEDLFDWCGRKFSVKTVVQVAVQMITLIEDLHAH 182
            +P  + F   E L+ +L   + G  L       GR F +        +++  +E LH+ 
Sbjct: 460 IVPLKFSFQSPEKLYLVLAF-INGGELFYHLQKEGR-FDLSRARFYTAELLCALETLHSL 517

Query: 183 DLIYRDIKPDNFLIGRPGQPDANNIHLIDFGMAKQYRDPKTKQHIPYREKKSLSGTARYM 242
           ++IYRD+KP+N L+   G     +I L DFG+ K     + K +       +  GT  Y+
Sbjct: 518 NVIYRDLKPENILLDYQG-----HIALCDFGLCKLNMQDQDKTN-------TFCGTPEYL 565

Query: 243 SINTHLGREQSRRDDMEALGHVFFYFLRGHLPWQGLKAPNNKQKYEKI 290
           +    LG+  S+  D   LG + +  L G  P+     P   + Y+KI
Sbjct: 566 APELLLGQGYSKVVDWWTLGVLLYEMLTGLPPYYDEDVP---KMYKKI 610

>Kwal_26.8796
          Length = 796

 Score = 53.9 bits (128), Expect = 2e-07,   Method: Compositional matrix adjust.
 Identities = 53/225 (23%), Positives = 97/225 (43%), Gaps = 45/225 (20%)

Query: 75  IGEGSFGVLFEGTNMINGVPVAIKFEPRKTEAPQLRDEYKTYKILNGT------------ 122
           +G+G+F            V  AI+ +  KT A ++  + K   +++G             
Sbjct: 194 VGQGAFAT----------VKKAIERKTGKTHAVKIISKRKVVGVMDGVARELEVLQRLDH 243

Query: 123 PNIPYAYYFGQEGLHNILVIDLLGPSLEDLFDWCGRKFSVKTVV--QVAVQMITLIEDLH 180
           P I     F ++   + LV++ +  S  DL D+     SV      ++  Q++  ++ +H
Sbjct: 244 PRIVSLKGFYEDKDSHYLVMEFV--SGGDLMDFVAAHGSVGEDAGREITRQILEAVKYIH 301

Query: 181 AHDLIYRDIKPDNFLIGRPGQPDANNIHLIDFGMAKQYRDPKTKQHIPYREKKSLSGTAR 240
           +  + +RD+KPDN LI R    D   + + DFG+AK   +            K+  GT  
Sbjct: 302 SMGISHRDLKPDNILIER---DDPVLVKITDFGLAKIQGNGTF--------MKTFCGTLA 350

Query: 241 YMSINTHLGREQSRRD--------DMEALGHVFFYFLRGHLPWQG 277
           Y++     G+    ++        DM ++G + +  L GHLP+ G
Sbjct: 351 YVAPEVISGKNSGEKEGNTYSSLVDMWSIGCLVYVILTGHLPFSG 395

>Scas_703.5
          Length = 749

 Score = 53.9 bits (128), Expect = 2e-07,   Method: Compositional matrix adjust.
 Identities = 37/124 (29%), Positives = 61/124 (49%), Gaps = 20/124 (16%)

Query: 170 VQMITLIEDLHAHDLIYRDIKPDNFLIGRPGQPDAN-NIHLIDFGMAKQYRDPKTKQHIP 228
            +++  +E LH +D++YRD+KP+N L+      DAN NI L DFG++K     +T     
Sbjct: 452 AELVLALEYLHDNDIVYRDLKPENILL------DANGNIALCDFGLSKADLKDRT----- 500

Query: 229 YREKKSLSGTARYMSINTHLGREQ-SRRDDMEALGHVFFYFLRGHLPWQGLKAPNNKQKY 287
                +  GT  Y++    L     ++  D  +LG + F    G   W    A +N++ Y
Sbjct: 501 ----NTFCGTTEYLAPELLLDEAGYTKMVDFWSLGVLIFEMCCG---WSPFFAEDNQKMY 553

Query: 288 EKIG 291
           +KI 
Sbjct: 554 QKIA 557

>Scas_616.10
          Length = 1461

 Score = 53.9 bits (128), Expect = 3e-07,   Method: Compositional matrix adjust.
 Identities = 58/252 (23%), Positives = 100/252 (39%), Gaps = 60/252 (23%)

Query: 69  YKIGKKIGEGSFGVLFEGTNMINGVPVAIKFEPRK------------------------- 103
           +K+GK +G+GS G +    N+  G   AIK  P+K                         
Sbjct: 101 WKLGKTLGKGSSGRVRLAKNIETGQLAAIKIVPKKHKLFMKSSHSNVSFFSAASNSNSNI 160

Query: 104 ----TEAPQ-------------LRDEYKTYKILNGTPNIPYAYYFGQEGLHNILVIDLLG 146
               T  P              +  E    K+++  PN+   Y   +      LV++ + 
Sbjct: 161 STLATSPPMNNGSEKNQPNPYGIEREIVIMKLISH-PNVMALYEVWENKSELYLVLEYVD 219

Query: 147 PSLEDLFDWCGRK--FSVKTVVQVAVQMITLIEDLHAHDLIYRDIKPDNFLIGRPGQPDA 204
               +LFD+   K   S K  V    Q+I  +   H+ ++ +RD+KP+N L+ +  +   
Sbjct: 220 GG--ELFDYLVSKGKLSEKEAVHYFKQIIQGVSYCHSFNICHRDLKPENLLLDKKNK--- 274

Query: 205 NNIHLIDFGMAKQYRDPKTKQHIPYREKKSLSGTARYMSINTHLGRE-QSRRDDMEALGH 263
            +I + DFGMA           +P +  ++  G+  Y S    +G+       D+ + G 
Sbjct: 275 -SIKIADFGMA--------ALELPNKLLQTSCGSPHYASPEIVMGKSYHGGPSDVWSCGI 325

Query: 264 VFFYFLRGHLPW 275
           + F  L GHLP+
Sbjct: 326 ILFALLTGHLPF 337

>KLLA0E21780g complement(1936438..1939488) similar to sp|P38692
           Saccharomyces cerevisiae YHR102w NRK1 ser/thr protein
           kinase that interacts with CDC31P, start by similarity
          Length = 1016

 Score = 53.5 bits (127), Expect = 3e-07,   Method: Compositional matrix adjust.
 Identities = 52/227 (22%), Positives = 102/227 (44%), Gaps = 39/227 (17%)

Query: 69  YKIGKKIGEGSFGVLFEGTNMINGVPVAIK---FEPRKTEAPQLRDEYKTYKILNGTPNI 125
           +K  + IG G FGV+++  ++      AIK    +  + E   +R E +    L  TPNI
Sbjct: 16  FKRKEIIGRGKFGVVYKAFHVKTQQVYAIKVLNLDNTEDEVEDIRKEIQFLSSLKQTPNI 75

Query: 126 PYAYYFGQEGLHNILVIDLLGPSLEDLFDWCGRKFSVKTVVQVAV-----------QMIT 174
              +Y+G           L+   L  + ++C    S++T+++  +           +++ 
Sbjct: 76  --THYYGSY---------LIDTKLWVIMEYCAGG-SLRTLLRPGIIEEKYIGVIMREILV 123

Query: 175 LIEDLHAHDLIYRDIKPDNFLIGRPGQPDANNIHLIDFGMAKQYRDPKTKQHIPYREKKS 234
            +  +H  ++I+RDIK  N LI   G     ++ L DFG+A Q      K       +++
Sbjct: 124 ALISIHRDNVIHRDIKAANILIANNG-----SVKLCDFGVAAQLSQSMLK-------RQT 171

Query: 235 LSGTARYMSINTHL-GREQSRRDDMEALGHVFFYFLRGHLPWQGLKA 280
           ++GT  +M+    + G     + D+ +LG   +    G+ P+  ++A
Sbjct: 172 MAGTPYWMAPEVIMEGVYYDTKVDIWSLGITAYEIATGNPPYCHMEA 218

>Kwal_55.21545
          Length = 865

 Score = 53.5 bits (127), Expect = 3e-07,   Method: Compositional matrix adjust.
 Identities = 55/223 (24%), Positives = 96/223 (43%), Gaps = 23/223 (10%)

Query: 65  VGLHYKIGKKIGEGSFGVLFEG----TNMINGVPVAIKFEPRKTEAPQLRDEYKTYKILN 120
           V   +K  + IG G FGV+++G    T  +  + V +  +    E   ++ E +    L 
Sbjct: 15  VSTLFKRTEVIGRGKFGVVYKGYYTKTKQVCAIKV-LNLDSADDEVEDVQKEIQFLSSLK 73

Query: 121 GTPNIP--YAYYFGQEGLHNILVIDLLGPSLEDLFDWCGRKFSVKTVVQVAVQMITLIED 178
             PNI   Y  Y     L  I+     G SL  L      K   + +  +  +++T +  
Sbjct: 74  QVPNITHYYGSYLNDTKLWVIMEY-CAGGSLRTLLR--PGKIGEQYIGVIMRELLTALMH 130

Query: 179 LHAHDLIYRDIKPDNFLIGRPGQPDANNIHLIDFGMAKQYRDPKTKQHIPYREKKSLSGT 238
           +H   +I+RDIK  N LI   G      I L DFG+A Q    K +       +++++GT
Sbjct: 131 IHKDGVIHRDIKAANVLITNDGH-----IKLCDFGVAAQLSQTKIR-------RQTMAGT 178

Query: 239 ARYMSINTHL-GREQSRRDDMEALGHVFFYFLRGHLPWQGLKA 280
             +M+    + G     + D+ +LG   +    G+ P+  ++A
Sbjct: 179 PYWMAPEVIMEGVYYDTKVDIWSLGITAYEIATGNPPYCEVEA 221

>CAGL0I09504g 909319..910905 similar to sp|P38147 Saccharomyces
           cerevisiae YBR274w CHK1 regulats inhibitory Cdk
           phosphorylation of PDS1, start by similarity
          Length = 528

 Score = 53.1 bits (126), Expect = 3e-07,   Method: Compositional matrix adjust.
 Identities = 58/223 (26%), Positives = 92/223 (41%), Gaps = 35/223 (15%)

Query: 70  KIGKKIGEGSFGVLFEG-TNMINGVPVAIKFE--PRKTEAPQLRDEYKTYKILNGT---- 122
           ++G  IGEGSFG +        + V VA+KF   P   E+   + +     +L+      
Sbjct: 15  ELGGTIGEGSFGCVRSARLKFDSSVVVAVKFVHLPTCAESGLSQKDVSREVVLHSKCSKH 74

Query: 123 PNIPYAYYFGQEGLHNILVIDLLGPSLEDLFDWCGRKFSVK-TVVQVAVQ-MITLIEDLH 180
            N+         G +  +++++      DLFD       V   V Q   Q +I  +  LH
Sbjct: 75  ANVLRVIDCNVGGEYLWIMLEMADGG--DLFDKIEPDVGVDPDVAQFYFQQLIRALNYLH 132

Query: 181 AHDLIYRDIKPDNFLIGRPGQPDANNIHLIDFGMAKQYRDPKTKQHI--------PYREK 232
              + +RDIKP+N L+ + G     N+ L DFG+A Q+R       +        PY   
Sbjct: 133 DVGVAHRDIKPENILLDKKG-----NLKLADFGLASQFRRKDGTLRVSTDQRGSPPYMAP 187

Query: 233 KSLSGTARYMSINTHLGREQSRRDDMEALGHVFFYFLRGHLPW 275
           + LS    Y +I            D+ + G + F  L G +PW
Sbjct: 188 EILSSQGYYANIT-----------DIWSAGVLLFVLLTGEIPW 219

>ADL389W [1352] [Homologous to ScYHR205W (SCH9) - SH]
           complement(27643..29778) [2136 bp, 711 aa]
          Length = 711

 Score = 53.1 bits (126), Expect = 4e-07,   Method: Compositional matrix adjust.
 Identities = 37/124 (29%), Positives = 61/124 (49%), Gaps = 20/124 (16%)

Query: 170 VQMITLIEDLHAHDLIYRDIKPDNFLIGRPGQPDAN-NIHLIDFGMAKQYRDPKTKQHIP 228
            +++  +E LH +D++YRD+KP+N L+      DAN NI L DFG++K     +T     
Sbjct: 412 AELVLALEYLHDNDIVYRDLKPENILL------DANGNIALCDFGLSKADLKDRT----- 460

Query: 229 YREKKSLSGTARYMSINTHLGRE-QSRRDDMEALGHVFFYFLRGHLPWQGLKAPNNKQKY 287
                +  GT  Y++    L     ++  D  +LG + F    G   W    A +N++ Y
Sbjct: 461 ----NTFCGTTEYLAPELLLDETGYTKMVDFWSLGVLIFEMCCG---WSPFFAEDNQKMY 513

Query: 288 EKIG 291
           +KI 
Sbjct: 514 QKIA 517

>KLLA0B03586g complement(326871..329075) similar to sp|P11792
           Saccharomyces cerevisiae YHR205w SCH9 serine/threonine
           protein kinase involved in stress response and
           nutrient-sensing signaling pathway, start by similarity
          Length = 734

 Score = 53.1 bits (126), Expect = 4e-07,   Method: Compositional matrix adjust.
 Identities = 36/124 (29%), Positives = 61/124 (49%), Gaps = 20/124 (16%)

Query: 170 VQMITLIEDLHAHDLIYRDIKPDNFLIGRPGQPDAN-NIHLIDFGMAKQYRDPKTKQHIP 228
            +++  +E LH +D++YRD+KP+N L+      DAN NI L DFG++K     +T     
Sbjct: 433 AELVLALEYLHDNDIVYRDLKPENILL------DANGNIALCDFGLSKADLKDRT----- 481

Query: 229 YREKKSLSGTARYMSINTHLGREQ-SRRDDMEALGHVFFYFLRGHLPWQGLKAPNNKQKY 287
                +  GT  Y++    +     ++  D  +LG + F    G   W    A +N++ Y
Sbjct: 482 ----NTFCGTTEYLAPELLMDETGYTKMVDFWSLGVLIFEMCCG---WSPFFASDNQKMY 534

Query: 288 EKIG 291
           +KI 
Sbjct: 535 QKIA 538

>Scas_700.54
          Length = 698

 Score = 53.1 bits (126), Expect = 4e-07,   Method: Compositional matrix adjust.
 Identities = 51/228 (22%), Positives = 100/228 (43%), Gaps = 28/228 (12%)

Query: 75  IGEGSFGVLFEGTNMINGVPVAIKFEPRKTEAPQLRDEYKTYKILNGT--PNIPYAYYFG 132
           +G+G+F  + +      G   A+K   ++     +    +  ++L     P I     F 
Sbjct: 229 VGQGAFATVKKAVERSTGKTFAVKIISKRKVMGNMEGVSRELEVLQQLDHPRIVRLKGFY 288

Query: 133 QEGLHNILVIDLLGPSLEDLFDWCGRKFSV--KTVVQVAVQMITLIEDLHAHDLIYRDIK 190
           ++     +V++ +     DL D+     +V  +   +++ Q++  ++ +H+  + +RD+K
Sbjct: 289 EDKDSYYMVMEFVSGG--DLMDFVAAHGAVGEEAGKEISRQILEAVKYIHSKGISHRDLK 346

Query: 191 PDNFLIGRPGQPDANNIHLIDFGMAKQYRDPKTKQHIPYREKKSLSGTARYMSINTHLGR 250
           PDN LI    Q D   + + DFG+AK   +            K+  GT  Y++     G+
Sbjct: 347 PDNILI---EQDDPVLVKITDFGLAKVQGNGSF--------MKTFCGTLAYVAPEVIGGK 395

Query: 251 --------EQSRRDDMEALGHVFFYFLRGHLPWQGLKAPNNKQKYEKI 290
                   E S   DM ++G + +  L GHLP+ G      +Q Y++I
Sbjct: 396 GETNEERNEYSSLVDMWSMGCLVYVILTGHLPFSG---STQEQLYKQI 440

>Kwal_33.13984
          Length = 649

 Score = 52.8 bits (125), Expect = 4e-07,   Method: Compositional matrix adjust.
 Identities = 49/182 (26%), Positives = 82/182 (45%), Gaps = 24/182 (13%)

Query: 69  YKIGKKIGEGSFGVLFEGTNMINGVPVAIKFEPRKTE-APQLRDEYKTYKILNGT--PNI 125
           Y +   +G+G+FG + +  N++    +A+K    K+E   Q   E K  ++LNG   P  
Sbjct: 278 YLVLDILGQGTFGQVVKCQNLLTKEILAVKVVKSKSEYLNQSITEAKILELLNGKIDPQG 337

Query: 126 PYAYYFGQEGL----HNILVIDLLGPSLEDLFDWCG-RKFSVKTVVQVAVQMITLIEDLH 180
            + +    E      H  LV +LL  +L +L         S+  +   A Q++  +  L 
Sbjct: 338 EHHFLRMHETFVHKNHLCLVFELLSSNLYELLKQNQFHGLSISLIRTFARQLLDSLCVLK 397

Query: 181 AHDLIYRDIKPDNFLIGRPGQPDANNIHLIDFGMAKQ-------------YRDPKTKQHI 227
            H LI+ D+KP+N L+    +P+   + +IDFG A +             YR P+    I
Sbjct: 398 EHKLIHCDLKPENILLVSLDRPE---LKVIDFGSACEETRTLYTYIQSRFYRAPEVILGI 454

Query: 228 PY 229
           PY
Sbjct: 455 PY 456

>CAGL0I05896g 560169..562505 some similarities with sp|P14680
           Saccharomyces cerevisiae YJL141c YAK1 ser/thr protein
           kinase, hypothetical start
          Length = 778

 Score = 52.8 bits (125), Expect = 5e-07,   Method: Compositional matrix adjust.
 Identities = 48/184 (26%), Positives = 84/184 (45%), Gaps = 28/184 (15%)

Query: 69  YKIGKKIGEGSFGVLFEGTNMINGVPVAIKFEPRKTE-APQLRDEYKTYKILNGT--PNI 125
           Y +   +G+G+FG + +  N+     +A+K    ++E   Q   E K  ++LN    PN 
Sbjct: 361 YLVLDILGQGTFGQVVKCQNLQTKEIIAVKVVKSRSEYLNQSISEAKILELLNEKIDPNN 420

Query: 126 PYAYYFGQEGL----HNILVIDLLGPSLEDLFDWCGRKF---SVKTVVQVAVQMITLIED 178
            + +    +      H  LV +LL  +L +L      KF   S++ +    +Q++  +  
Sbjct: 421 KHHFLRMHDSFVHKNHLCLVFELLSNNLYELLK--QNKFHGLSIQLIRTFTIQILDSLCV 478

Query: 179 LHAHDLIYRDIKPDNFLIGRPGQPDANNIHLIDFGMAKQ-------------YRDPKTKQ 225
           L    LI+ D+KP+N L+  P +PD   + +IDFG + +             YR P+   
Sbjct: 479 LKDSKLIHCDLKPENILLCSPDKPD---LKVIDFGSSCEETRTVYTYIQSRFYRAPEIIL 535

Query: 226 HIPY 229
            IPY
Sbjct: 536 GIPY 539

>Kwal_27.11919
          Length = 209

 Score = 50.8 bits (120), Expect = 5e-07,   Method: Compositional matrix adjust.
 Identities = 54/206 (26%), Positives = 91/206 (44%), Gaps = 22/206 (10%)

Query: 69  YKIGKKIGEGSFGVLFEGTNMINGVPVA----IKFEPRKTEAPQLR-DEYKTYKILNGTP 123
           YK  +K+GEG++GV+++  ++ +G  V     I+ E      P     E    K L    
Sbjct: 7   YKRLEKVGEGTYGVVYKALDLRHGQRVVALKKIRLESEDEGVPSTAIREISLLKELK-DD 65

Query: 124 NIPYAYYFGQEGLHNI-LVIDLLGPSLEDLFDWCGRK--FSVKTVVQVAVQMITLIEDLH 180
           NI   Y       H + LV + L   L+   +   ++       + +  +Q+   I   H
Sbjct: 66  NIVRLYDIVHSDAHKLYLVFEFLDLDLKRYMEAIPKEQPLGDNIIKKFMMQLCKGIAYCH 125

Query: 181 AHDLIYRDIKPDNFLIGRPGQPDANNIHLIDFGMAKQYRDPKTKQHIPYREKKSLSGTAR 240
           +H +++RD+KP N LI R G     N+ L DFG+A+ +        +P R       T  
Sbjct: 126 SHRILHRDLKPQNLLINRDG-----NMKLADFGLARAF-------GVPLRAYTHEIVTLW 173

Query: 241 YMSINTHLGREQ-SRRDDMEALGHVF 265
           Y +    LG +Q S   D+ ++G +F
Sbjct: 174 YRAPEVLLGGKQYSTGVDIWSIGCIF 199

>YPL209C (IPL1) [5240] chr16 complement(156489..157592)
           Serine/threonine protein kinase of the mitotic spindle,
           involved in chromosome segregation and activation of the
           spindle checkpoint by detection of kinetochore tension,
           required for proper spindle disassembly and orientation
           [1104 bp, 367 aa]
          Length = 367

 Score = 52.0 bits (123), Expect = 5e-07,   Method: Compositional matrix adjust.
 Identities = 59/209 (28%), Positives = 92/209 (44%), Gaps = 21/209 (10%)

Query: 108 QLRDEYKTYKILNGTPNIPYAY-YFGQEGLHNILVIDLLGPSLEDLFDWCGRKFSVKTVV 166
           Q R E +    LN  PN+  +Y YF  E    +L+  L+   +  L    G  F+     
Sbjct: 148 QFRREVEIQTSLNH-PNLTKSYGYFHDEKRVYLLMEYLVNGEMYKLLRLHG-PFNDILAS 205

Query: 167 QVAVQMITLIEDLHAHDLIYRDIKPDNFLIGRPGQPDANNIHLIDFGMAKQYRDPKTKQH 226
               Q+   ++ +H  ++I+RDIKP+N LIG       N I L DFG +    +P     
Sbjct: 206 DYIYQIANALDYMHKKNIIHRDIKPENILIGF-----NNVIKLTDFGWS--IINP----- 253

Query: 227 IPYREKKSLSGTARYMSINTHLGREQSRRDDMEALGHVFFYFLRGHLPWQGLKAPNNKQK 286
            P   +K++ GT  Y+S      RE     D  ALG + F  L G  P++          
Sbjct: 254 -PENRRKTVCGTIDYLSPEMVESREYDHTIDAWALGVLAFELLTGAPPFE---EEMKDTT 309

Query: 287 YEKIG--EKKRSTNVYDLAQGLPVQFGRY 313
           Y++I   + K  +N+   AQ L ++  +Y
Sbjct: 310 YKRIAALDIKMPSNISQDAQDLILKLLKY 338

>CAGL0B04301g 420544..422172 similar to sp|P38070 Saccharomyces
           cerevisiae YBR028c, start by similarity
          Length = 542

 Score = 52.4 bits (124), Expect = 6e-07,   Method: Compositional matrix adjust.
 Identities = 42/160 (26%), Positives = 75/160 (46%), Gaps = 16/160 (10%)

Query: 164 TVVQVAVQMITLIEDLHAHDLIYRDIKPDNFLIGRPGQPDANNIHLIDFGMAKQYRDPKT 223
           TV   A ++   ++ LH+  ++YRD+KP+N L+ + G     ++ L DFG++K      +
Sbjct: 271 TVAFYAAEISCALKFLHSKGVVYRDLKPENCLLNQNG-----HLVLTDFGLSKSSASNAS 325

Query: 224 KQHI-------PYREKKSLSGTARYMSINTHLGREQSRRDDMEALGHVFFYFLRGHLPWQ 276
           ++ +          E  S+ GT  Y +    LG+  +   D  +LG + +  L G  P+ 
Sbjct: 326 QEDLGAGNEGEDVNELHSIIGTPEYCAPEILLGQPYTANCDWYSLGCLLYDMLTGKPPYT 385

Query: 277 GLKAPNNKQKYEKIGEKKRSTNV-YDLAQGLPVQFGRYLE 315
           G    N+K    KI   K+   + Y L+ G+    G  L+
Sbjct: 386 G---ANHKVIANKIKNDKQGPKIPYYLSDGMKDVLGALLK 422

>KLLA0A03806g complement(338807..340615) gi|2181934|emb|CAA61235.1
           Kluyveromyces lactis putative kinase, start by
           similarity
          Length = 602

 Score = 52.4 bits (124), Expect = 6e-07,   Method: Compositional matrix adjust.
 Identities = 46/158 (29%), Positives = 79/158 (50%), Gaps = 14/158 (8%)

Query: 69  YKIGKKIGEGSFGVLFEGTNMINGVPVAIKFEPRKTEAP---QLRDEYK-TYKILNGTPN 124
           Y+I K +GEGSFG +    ++  G  VA+K   +K  A    Q R E + +Y  L   P+
Sbjct: 35  YQIIKTLGEGSFGKVKLAYHISTGQKVALKIINKKVLAKSDMQGRIEREISYLRLLRHPH 94

Query: 125 IPYAYYFGQEGLHNILVIDLLGPSLEDLFDWCGR--KFSVKTVVQVAVQMITLIEDLHAH 182
           I   Y   +     I+VI+  G    +LFD+  +  K   +   +   Q+I+ ++  H H
Sbjct: 95  IIKLYDVIKSKDEIIMVIEYAG---NELFDYIVQRDKMPEQEARRFFQQIISAVDYCHRH 151

Query: 183 DLIYRDIKPDNFLIGRPGQPDANNIHLIDFGMAKQYRD 220
            +++RD+KP+N L+      +  N+ + DFG++    D
Sbjct: 152 KIVHRDLKPENLLLD-----EHLNVKIADFGLSNIMTD 184

>CAGL0M02233g complement(267332..269635) highly similar to sp|P22216
           Saccharomyces cerevisiae YPL153c SPK1 ser/thr/tyr
           protein kinase, hypothetical start
          Length = 767

 Score = 52.4 bits (124), Expect = 7e-07,   Method: Compositional matrix adjust.
 Identities = 55/234 (23%), Positives = 99/234 (42%), Gaps = 34/234 (14%)

Query: 75  IGEGSFGVLFEGTNMINGVPVAIKFEPRKTEAPQLRDEYKTYKILNGT--PNIPYAYYFG 132
           +G G+F  + +      G   A+K   ++     +    +  ++L     P I     F 
Sbjct: 194 VGTGAFATVKKAVERNTGKTFAVKIINKRKVVGNMDGVSRELEVLQKLNHPRIVSLKAFY 253

Query: 133 QEGLHNILVIDLLGPSLEDLFDWCGRKFSVKTVV--QVAVQMITLIEDLHAHDLIYRDIK 190
           ++  +  +V++ +     DL D+     +V      +++ Q++  I+ +H+  + +RD+K
Sbjct: 254 EDEANYYMVMEFISGG--DLMDFVAAHGAVGEEAGREISRQILEAIQYIHSKGISHRDLK 311

Query: 191 PDNFLIGRPGQPDANNIHLIDFGMAKQYRDPKTKQHIPYREKKSLSGTARYMS---INTH 247
           PDN LI    Q D   + + DFG+AK   +            K+  GT  Y++   I   
Sbjct: 312 PDNILI---EQDDPVLVKITDFGLAKVQGNGSI--------MKTFCGTLAYVAPEVIGGF 360

Query: 248 LG-----------REQSRRDDMEALGHVFFYFLRGHLPWQGLKAPNNKQKYEKI 290
            G            E S   DM ++G + F  L GHLP+ G      +Q YE+I
Sbjct: 361 TGATGEEETEEERIEYSSLVDMWSMGCLVFVILTGHLPFSG---STQEQLYEQI 411

>Scas_721.46
          Length = 296

 Score = 51.2 bits (121), Expect = 8e-07,   Method: Compositional matrix adjust.
 Identities = 56/207 (27%), Positives = 91/207 (43%), Gaps = 22/207 (10%)

Query: 68  HYKIGKKIGEGSFGVLFEGTNMINGVPVA----IKFEPRKTEAPQLR-DEYKTYKILNGT 122
           +YK  +K+GEG++GV+++  +M  G  V     I+ E      P     E    K L   
Sbjct: 7   NYKRLEKVGEGTYGVVYKALDMRQGQRVVALKKIRLESEDEGVPSTAIREISLLKELKDD 66

Query: 123 PNIPYAYYFGQEGLHNI-LVIDLLGPSLEDLFDWCGRKFSVKT--VVQVAVQMITLIEDL 179
            NI   Y       H + LV + L   L+   +   +  S+ +  + +   Q+   I   
Sbjct: 67  -NIVRLYDIVHSDAHKLYLVFEFLDLDLKRYMESIPKDQSLGSDIIKKFMRQLCKGIAYC 125

Query: 180 HAHDLIYRDIKPDNFLIGRPGQPDANNIHLIDFGMAKQYRDPKTKQHIPYREKKSLSGTA 239
           HAH +++RD+KP N LI + G     N+ L DFG+A+ +        +P R       T 
Sbjct: 126 HAHRILHRDLKPQNLLINKEG-----NLKLGDFGLARAF-------GVPLRAYTHEIVTL 173

Query: 240 RYMSINTHLGREQ-SRRDDMEALGHVF 265
            Y +    LG +Q S   D  ++G +F
Sbjct: 174 WYRAPEVLLGGKQYSTGVDTWSIGCIF 200

>KLLA0E01584g 149713..150960 highly similar to sp|P39009
           Saccharomyces cerevisiae YDL101c DUN1 protein kinase,
           start by similarity
          Length = 415

 Score = 51.6 bits (122), Expect = 1e-06,   Method: Compositional matrix adjust.
 Identities = 60/243 (24%), Positives = 106/243 (43%), Gaps = 45/243 (18%)

Query: 69  YKIGKKIGEGSFGVLFEGTNMINGVPVAIK-FEPRKTEAPQLRDEYKTYKILNGT----- 122
           Y  GK++G G + ++ E  N   G  VA+K F P++ +     D+ +T K    T     
Sbjct: 101 YLAGKELGTGHYAIVKEARNKETGETVAVKIFHPQQND-----DDKRTKKFTEETKILLS 155

Query: 123 ---PNIP-----YAYYFGQEGLHNILVIDLLGPSLEDLFDWCGRKFSVKTVVQVAV--QM 172
              PNI      +     +  +   LV++ +     +LF+   RK +++     A+  Q+
Sbjct: 156 IQHPNIVKLIDRFVEPVSKTQIQTYLVLEKINDG--ELFERIVRKNNLREDETKALFRQL 213

Query: 173 ITLIEDLHAHDLIYRDIKPDNFLIGR------------PGQPDANNIH--LIDFGMAKQY 218
           +  ++ LH+ ++I+RDIKP+N L+              P   D  +I   + DFG+AK  
Sbjct: 214 LNGLKYLHSRNIIHRDIKPENILLSISKRRSPEEIALGPWDDDELDIQVKIADFGLAKFT 273

Query: 219 RDPKTKQHIPYREKKSLSGTARYMSINTHLGREQSRRDDMEALGHVFFYFLRGHLPWQGL 278
            + K           +L GT  Y++    +    + R DM + G + +  L G  P+   
Sbjct: 274 GEMKFTN--------TLCGTPSYVAPEVLVKTGYTSRVDMWSAGVLLYVCLCGFPPFSEQ 325

Query: 279 KAP 281
            AP
Sbjct: 326 LAP 328

>KLLA0C12485g 1060167..1062944 weakly similar to sp|Q12236
           Saccharomyces cerevisiae YOL100w PKH2, start by
           similarity
          Length = 925

 Score = 52.0 bits (123), Expect = 1e-06,   Method: Compositional matrix adjust.
 Identities = 58/233 (24%), Positives = 102/233 (43%), Gaps = 23/233 (9%)

Query: 69  YKIGKKIGEGSFGVLFEGTNMINGVPVAIKFEPRKTEAPQLRDEY-----KTYKILNGTP 123
           +K G+ +G+GS+  +   T++ +    A+K   ++    Q + +Y      T + L  T 
Sbjct: 155 FKFGETLGDGSYSTVLLATSIESNKKYAVKILNKEYLIKQKKVKYVNIEKNTLQRLKNTK 214

Query: 124 NIPYAYYFGQEGLHNILVIDLLGPSLEDLFDWCGRKFSV--KTVVQVAVQMITLIEDLHA 181
            I   Y+  Q+      +++   P+  DL     +  SV  K     A Q+I  +  +H 
Sbjct: 215 GIISLYFTFQDESSLYFLLEY-APN-GDLLSLMRKHGSVNEKCTQYYAAQIIDALGFMHD 272

Query: 182 HDLIYRDIKPDNFLIGRPGQPDAN-NIHLIDFGMAKQYRDPKTKQHIPY---REKKSLSG 237
             +I+RD+KP+N L+      D +  + L DFG A+   D  ++  + Y       S  G
Sbjct: 273 KGVIHRDLKPENILL------DVDMKVKLTDFGTAR-LLDSTSEDDLKYDLLTRSNSFVG 325

Query: 238 TARYMSINTHLGREQSRRDDMEALGHVFFYFLRGHLPWQGLKAPNNKQKYEKI 290
           TA Y+S           R D+ A G + F  + G  P+   KA N    ++K+
Sbjct: 326 TAEYVSPELLNDNYVDFRCDIWAFGCILFQMIAGKPPF---KANNEYLTFQKV 375

>YBR028C (YBR028C) [220] chr2 complement(294387..295964)
           Serine/threonine protein kinase with similarity to
           Ypk2p/Ykr2p and Ypk1p [1578 bp, 525 aa]
          Length = 525

 Score = 51.6 bits (122), Expect = 1e-06,   Method: Compositional matrix adjust.
 Identities = 41/147 (27%), Positives = 71/147 (48%), Gaps = 12/147 (8%)

Query: 164 TVVQVAVQMITLIEDLHAHDLIYRDIKPDNFLIGRPGQPDANNIHLIDFGMAKQ-YRDPK 222
           TV   A ++   +  LH   ++YRD+KP+N L+ + G      + L DFG++K+   D  
Sbjct: 253 TVSFYAAEISCALRFLHTKGVVYRDLKPENCLLNQRGH-----LVLTDFGLSKKSANDSA 307

Query: 223 TKQHIPYREKK--SLSGTARYMSINTHLGREQSRRDDMEALGHVFFYFLRGHLPWQGLKA 280
             +  P       S+ GT  Y +    LG+  S+  D  +LG + +  L G  P+ G   
Sbjct: 308 VDEEDPENVNALYSIIGTPEYCAPEILLGKAYSQNCDWYSLGCLLYDMLVGKPPYTG--- 364

Query: 281 PNNKQKYEKIGEKKRSTNV-YDLAQGL 306
            N+K    KI + K+   + + L++G+
Sbjct: 365 SNHKVIINKIQQNKQGPKIPFYLSEGM 391

>YBR274W (CHK1) [453] chr2 (749551..751134) Checkpoint kinase,
           required for metaphase DNA-damage checkpoint [1584 bp,
           527 aa]
          Length = 527

 Score = 51.6 bits (122), Expect = 1e-06,   Method: Compositional matrix adjust.
 Identities = 32/109 (29%), Positives = 54/109 (49%), Gaps = 12/109 (11%)

Query: 171 QMITLIEDLHAH-DLIYRDIKPDNFLIGRPGQPDANNIHLIDFGMAKQYRDPKTKQHIPY 229
           Q+++ I  LH    + +RDIKP+N L+ + G     N+ L DFG+A Q+R       +  
Sbjct: 124 QLVSAINYLHVECGVAHRDIKPENILLDKNG-----NLKLADFGLASQFRRKDGTLRVSM 178

Query: 230 REKKSLSGTARYMSINTHLGRE--QSRRDDMEALGHVFFYFLRGHLPWQ 276
            ++    G+  YM+       E   + R D+ ++G + F  L G  PW+
Sbjct: 179 DQR----GSPPYMAPEVLYSEEGYYADRTDIWSIGILLFVLLTGQTPWE 223

>Sklu_1843.3 YOR231W, Contig c1843 2632-4092 reverse complement
          Length = 486

 Score = 51.2 bits (121), Expect = 1e-06,   Method: Compositional matrix adjust.
 Identities = 34/127 (26%), Positives = 58/127 (45%), Gaps = 14/127 (11%)

Query: 157 GRKFSVKTVVQVAVQMITLIEDLHAHDLIYRDIKPDNFLIGRPGQPDANNIHLIDFGMAK 216
           G + S K + ++A  ++  +  LH   +I+RDIKP N L+   GQ     + L DFG++ 
Sbjct: 295 GGRISEKVLGKIAESVLRGLSYLHERRIIHRDIKPQNILLNEIGQ-----VKLCDFGVSG 349

Query: 217 QYRDPKTKQHIPYREKKSLSGTARYMSINTHLGREQSRRDDMEALGHVFFYFLRGHLPWQ 276
           +  +             + +GT+ YM+     G+  S   D+ +LG       +GH P+ 
Sbjct: 350 EAVNSLA---------TTFTGTSYYMAPERIQGQPYSVTSDVWSLGLTLLEVAQGHFPFN 400

Query: 277 GLKAPNN 283
             K   N
Sbjct: 401 SDKMAIN 407

>KLLA0B07205g complement(624606..625973) some similarities with
           sp|P05986 Saccharomyces cerevisiae YKL166c TPK3
           cAMP-dependent protein kinase 3, catalytic chain,
           hypothetical start
          Length = 455

 Score = 51.2 bits (121), Expect = 1e-06,   Method: Compositional matrix adjust.
 Identities = 57/228 (25%), Positives = 98/228 (42%), Gaps = 26/228 (11%)

Query: 69  YKIGKKIGEGSFGVLFEGTNMINGVPVAIKFEPRKT-----EAPQLRDEYKTYKILNGTP 123
           ++I + +G GSFG +    +  NG   A+K   + T     +     DE     I++  P
Sbjct: 145 FQILRTLGTGSFGRVHLVRSNHNGRFYAMKVLKKNTVVKLKQVEHTNDERNMLSIVSH-P 203

Query: 124 NIPYAYYFGQEGLHNILVIDLL-GPSLEDLFDWCGRKFSVKTVVQVAVQMITLIEDLHAH 182
            I   +   Q+     +++D + G  L  L     ++F        A ++   +E LH+ 
Sbjct: 204 FIIRMWGTFQDSQQLFMIMDYIEGGELFSLLR-KSQRFPNPVAKFYAAEVCLALEYLHSK 262

Query: 183 DLIYRDIKPDNFLIGRPGQPDANNIHLIDFGMAKQYRDPKTKQHIPYREKKSLSGTARYM 242
            +IYRD+KP+N L+ + G      I L DFG AK   D      + Y    +L GT  Y+
Sbjct: 263 GIIYRDLKPENILLDKNGH-----IKLTDFGFAKYVPD------VTY----TLCGTPDYI 307

Query: 243 SINTHLGREQSRRDDMEALGHVFFYFLRGHLPWQGLKAPNNKQKYEKI 290
           +      +  ++  D  + G + +  L G+ P+      N  + YE I
Sbjct: 308 APEVVSTKPYNKSVDWWSFGVLIYEMLAGYTPFYD---SNTIKTYENI 352

>Sklu_2232.2 YOR061W, Contig c2232 1216-2340 reverse complement
          Length = 374

 Score = 50.8 bits (120), Expect = 1e-06,   Method: Compositional matrix adjust.
 Identities = 41/159 (25%), Positives = 77/159 (48%), Gaps = 22/159 (13%)

Query: 68  HYKIGKKIGEGSFGVLFEGTNMINGVPVAIK-FEPRKTEAPQLRDEYKTYKILNGTPNIP 126
           +Y+I  KIG G +  +F G +++N     IK  +P K +  ++  E K    L+G PN+ 
Sbjct: 85  NYEIVNKIGRGKYSEVFRGKSIVNDQACVIKVLKPVKMK--KIYRELKILTNLSGGPNVI 142

Query: 127 YAYYFGQEGLHNIL------VIDLLGPSLEDL-FDWCGRKFSVKTVVQVAVQMITLIEDL 179
                   GL +I+      +  L+   + ++ F      F++  +     Q++  +E  
Sbjct: 143 --------GLLDIVQDPGSKIPALIFEEVRNVDFRTLYPTFTLSDIQYYFTQLLIALEYC 194

Query: 180 HAHDLIYRDIKPDNFLIGRPGQPDANNIHLIDFGMAKQY 218
           H+  +++RD+KP N +I     P    + LID+G+A+ Y
Sbjct: 195 HSMGIMHRDVKPQNVMI----DPTERKLRLIDWGLAEFY 229

>Scas_580.6
          Length = 1015

 Score = 51.6 bits (122), Expect = 1e-06,   Method: Compositional matrix adjust.
 Identities = 50/222 (22%), Positives = 99/222 (44%), Gaps = 21/222 (9%)

Query: 65  VGLHYKIGKKIGEGSFGVLFEGTNMINGVPVAIKFEPRKTEAPQLRDEYKTYKILNGTPN 124
           V   ++  + IG G FG++++G ++      AIK     ++  ++ D  +  + L+    
Sbjct: 33  VNSMFRRTEVIGRGKFGIVYKGYHVRTKQIYAIKVLNLDSDEDEVEDVQREVQFLSSLKQ 92

Query: 125 IP-----YAYYFGQEGLHNILVIDLLGPSLEDLFDWCGRKFSVKTVVQVAVQMITLIEDL 179
           IP     Y  Y     L  I++    G SL  L      K   K +  +  +++  ++ +
Sbjct: 93  IPNITRYYGSYLKDTSLW-IIMEYCAGGSLRSLLRPG--KIDEKYIGVIMRELLVALKYI 149

Query: 180 HAHDLIYRDIKPDNFLIGRPGQPDANNIHLIDFGMAKQYRDPKTKQHIPYREKKSLSGTA 239
           H  ++I+RDIK  N LI   G     ++ L DFG+A Q      +       +++++GT 
Sbjct: 150 HKDNVIHRDIKAANVLITNEG-----SVKLCDFGVAAQLNQSTLR-------RQTMAGTP 197

Query: 240 RYMSINTHL-GREQSRRDDMEALGHVFFYFLRGHLPWQGLKA 280
            +M+    + G     + D+ +LG   +    G+ P+  ++A
Sbjct: 198 YWMAPEVIMEGVYYDTKVDIWSLGITAYEIATGNPPYCEVEA 239

>CAGL0K07458g complement(736336..738450) similar to sp|P12688
           Saccharomyces cerevisiae YKL126w or sp|P18961
           Saccharomyces cerevisiae YMR104c ser/thr-specific
           protein kinases, start by similarity
          Length = 704

 Score = 51.2 bits (121), Expect = 1e-06,   Method: Compositional matrix adjust.
 Identities = 38/141 (26%), Positives = 63/141 (44%), Gaps = 22/141 (15%)

Query: 150 EDLFDWCGRKFSVKTVVQVAVQMITLIEDLHAHDLIYRDIKPDNFLIGRPGQPDANNIHL 209
           E +FD    +F        A +++  ++ LH  D++YRD+KP+N L+   G     +I L
Sbjct: 469 EGIFDISRARF-------YASELLLALDSLHKMDVVYRDLKPENILLDSQG-----HIAL 516

Query: 210 IDFGMAKQYRDPKTKQHIPYREKKSLSGTARYMSINTHLGREQSRRDDMEALGHVFFYFL 269
            DFG+ K       K         +  GT  Y++    LG+  ++  D   LG + +  L
Sbjct: 517 CDFGLCKLNMKDNEKT-------STFCGTPEYLAPEVLLGKGYTKVVDWWTLGVLLYEML 569

Query: 270 RGHLPWQGLKAPNNKQKYEKI 290
            G  P+      N  + Y+KI
Sbjct: 570 TGLPPYYD---ENVSEMYKKI 587

>CAGL0M08316g 829069..831963 weakly similar to sp|P36003
           Saccharomyces cerevisiae YKL171w, hypothetical start
          Length = 964

 Score = 51.2 bits (121), Expect = 1e-06,   Method: Compositional matrix adjust.
 Identities = 45/193 (23%), Positives = 92/193 (47%), Gaps = 26/193 (13%)

Query: 67  LHYKIGKKIGEGSFGVLFEGTNMINGVPVAIK---FEPRKTEAPQLRDEYKTYKILNGTP 123
           + +K+GK IG G++G++ E  ++ +G   A+K   F+  +     +  E   +K ++   
Sbjct: 485 MGHKLGKVIGFGAWGMIRECVDIQSGAQRAMKIVRFKDNQKVKRNVIREVNVWKEMHHMY 544

Query: 124 NIP---------YAYYFGQEGLHNILVIDLLGPSLEDLFDWCGRKFS-------VKTVVQ 167
            +P         YA Y   E + +  + DL+         W  RK +       +K  + 
Sbjct: 545 ILPLLDWKLISDYAMYCLTERVKDGTLYDLV-------LSWEDRKNNQIPVDERIKLTMF 597

Query: 168 VAVQMITLIEDLHAHDLIYRDIKPDNFLIGRPGQPDANNIHLIDFGMAKQYRDPKTKQHI 227
           + +Q+I+ ++ +H++  ++ DIK +N L+ +  Q     I L DFGM+ ++   +++   
Sbjct: 598 LMLQLISALKYMHSNSTVHGDIKLENCLLKKGRQHKNWTIFLCDFGMSCRFGSYRSRYDT 657

Query: 228 PYREKKSLSGTAR 240
              E+K+ SG  R
Sbjct: 658 LIDEEKNNSGIIR 670

>ACL191C [858] [Homologous to ScYGR040W (KSS1) - SH] (26475..27572)
           [1098 bp, 365 aa]
          Length = 365

 Score = 50.4 bits (119), Expect = 2e-06,   Method: Compositional matrix adjust.
 Identities = 42/160 (26%), Positives = 73/160 (45%), Gaps = 19/160 (11%)

Query: 68  HYKIGKKIGEGSFGVLFEGTNMINGVPVAI-KFEP--RKTEAPQLRDEYKTYKILNGTPN 124
           HYK+   IGEG++G++    +   G  VAI K +P  R     +   E K  K  +   N
Sbjct: 12  HYKLVDLIGEGAYGIVCSAIHKPTGTKVAIKKIQPFTRPMFVTRTLRELKLLKFFHSHEN 71

Query: 125 I--------PYAYYFGQEGLHNILVIDLLGPSLEDLFDWCGRKFSVKTVVQVAVQMITLI 176
           I        P +Y   Q+     LV +L+   L+ +        S   +     Q++  +
Sbjct: 72  IISVLDIVRPTSY---QDFEAVYLVQELMETDLQRIISQPNSFLSDDHIQYFTYQILRAL 128

Query: 177 EDLHAHDLIYRDIKPDNFLIGRPGQPDANNIHLIDFGMAK 216
           + LH+  +I+RD+KP N L+       + ++ L DFG+++
Sbjct: 129 KSLHSAQVIHRDLKPSNLLLN-----SSCDLKLCDFGLSR 163

>Kwal_14.1159
          Length = 1521

 Score = 51.2 bits (121), Expect = 2e-06,   Method: Compositional matrix adjust.
 Identities = 42/154 (27%), Positives = 71/154 (46%), Gaps = 12/154 (7%)

Query: 69  YKIGKKIGEGSFGVLFEGTNMINGVPVAIKFEPR-----KTEAPQLRDEYKTYKILNGTP 123
           Y + K I +G++G +F     I G   AIK   +     K +   ++ E     + +  P
Sbjct: 677 YDVIKPISKGAYGSVFLAKRRITGEYFAIKVLKKSDMIAKNQVTNVKSERAIMMVQSNKP 736

Query: 124 NIPYAYYFGQEGLHNILVIDLL-GPSLEDLFDWCGRKFSVKTVVQVAVQMITLIEDLHAH 182
            +   Y   Q   +  LV++ L G  L  L    G     + V Q   ++I  +ED+H  
Sbjct: 737 YVAKLYATFQNRGNLFLVMEYLSGGDLGTLIKMMG-SLPDQWVKQYISEVIYGVEDMHQS 795

Query: 183 DLIYRDIKPDNFLIGRPGQPDANNIHLIDFGMAK 216
            +I+ D+KPDN LI + G     ++ L DFG+++
Sbjct: 796 GIIHHDLKPDNLLIDQRG-----HLKLTDFGLSR 824

>KLLA0F24618g complement(2288943..2290613) similar to sp|P38070
           Saccharomyces cerevisiae YBR028c, start by similarity
          Length = 556

 Score = 50.8 bits (120), Expect = 2e-06,   Method: Compositional matrix adjust.
 Identities = 39/135 (28%), Positives = 67/135 (49%), Gaps = 10/135 (7%)

Query: 164 TVVQVAVQMITLIEDLHAHDLIYRDIKPDNFLIGRPGQPDANNIHLIDFGMAKQ--YRDP 221
           TV   A ++   ++ LH+  ++YRD+KP+N L+   G     ++ L DFG++K+  + D 
Sbjct: 282 TVAFYAAELSCALKFLHSKGIVYRDLKPENCLLNERG-----HLVLTDFGLSKKSVFDDA 336

Query: 222 KTKQHIP-YREKKSLSGTARYMSINTHLGREQSRRDDMEALGHVFFYFLRGHLPWQGL-- 278
            T +      +  S+ GT  Y +     G   ++  D  +LG + +  L G  P+ G+  
Sbjct: 337 ATPEEGENVNQLYSIIGTPEYCAPEILAGEPYTQNCDWYSLGCLVYDMLIGKPPFTGVNH 396

Query: 279 KAPNNKQKYEKIGEK 293
           K   NK K EK G +
Sbjct: 397 KIILNKIKQEKTGAR 411

>CAGL0H07535g 736241..737137 highly similar to sp|P00546
           Saccharomyces cerevisiae YBR160w CDC28, start by
           similarity
          Length = 298

 Score = 50.1 bits (118), Expect = 2e-06,   Method: Compositional matrix adjust.
 Identities = 55/209 (26%), Positives = 90/209 (43%), Gaps = 24/209 (11%)

Query: 68  HYKIGKKIGEGSFGVLFEGTNMING------VPVAIKFEPRKTEAPQLR-DEYKTYKILN 120
           +YK  +K+GEG++GV+++  ++  G          I+ E      P     E    K L 
Sbjct: 7   NYKRLEKVGEGTYGVVYKALDLRPGKGQRVVALKKIRLESEDEGVPSTAIREISLLKELK 66

Query: 121 GTPNIPYAYYFGQEGLHNI-LVIDLLGPSLEDLFDWCGRK--FSVKTVVQVAVQMITLIE 177
              NI   Y       H + LV++ L   L+   +   +     V  + +  VQ+   I 
Sbjct: 67  DD-NIVRLYDIVHSDAHKLYLVLEFLDLDLKRYMESIPKDQPLGVNIIKKFMVQLCKGIA 125

Query: 178 DLHAHDLIYRDIKPDNFLIGRPGQPDANNIHLIDFGMAKQYRDPKTKQHIPYREKKSLSG 237
             HAH +++RD+KP N LI + G     N+ L DFG+A+ +        +P R       
Sbjct: 126 YCHAHRILHRDLKPQNLLIDKEG-----NLKLGDFGLARAF-------GVPLRAYTHEIV 173

Query: 238 TARYMSINTHLGREQ-SRRDDMEALGHVF 265
           T  Y +    LG +Q S   D  ++G +F
Sbjct: 174 TLWYRAPEVLLGGKQYSTGVDTWSIGCIF 202

>CAGL0K04301g 404419..405486 similar to sp|P53233 Saccharomyces
           cerevisiae YGR052w, hypothetical start
          Length = 355

 Score = 50.4 bits (119), Expect = 2e-06,   Method: Compositional matrix adjust.
 Identities = 60/237 (25%), Positives = 100/237 (42%), Gaps = 31/237 (13%)

Query: 69  YKIGKKIGEGSFGVLFEGTNMINGVPVAIKFEPR-KTEAPQLRDEYKTYKILN---GTPN 124
           YK    I  GSF  +++G N      VA+K  P+ K     + +EY   K+L+   G P 
Sbjct: 8   YKKLNPIQSGSFSTVYKGYNTETDDFVALKVIPKSKFSQRGMANEYNVGKLLSKDEGCPF 67

Query: 125 IPYAYYFGQEGLHNILVIDLL-GPSLEDLFDWCGRK--FSVKTVVQVAVQMITL-----I 176
           I     F ++  +  LV +        D  +   +K   +  +++++  Q + L     I
Sbjct: 68  ICSFVDFYEDETNYTLVQEYCECGDFYDFLELSKKKGDLNAPSIIKLNFQKVVLQLSYAI 127

Query: 177 EDLHAHDLIYRDIKPDNFLIGRPGQPDANNIHLIDFGMAKQYRDPKTKQHI---PYREKK 233
           +  H+  + +RDIKP+N LI   G     +I L D+G A          +I    YR  +
Sbjct: 128 KYAHSMGIAHRDIKPENILINYHG-----DIKLADWGHAIS-ASSSNDNNIGTDNYRGPE 181

Query: 234 SLSGTARYMSINTHLGREQSRRDDMEALGHVFFYFLRGHLPWQGLKAPNNKQKYEKI 290
           + S    Y   NT+       R D  ++G    Y L  H P++     N K  Y+++
Sbjct: 182 TFSAKVSY---NTY-------RSDYWSMGVTLLYLLFSHCPFRCSNIKNEKIVYKRL 228

>YJL141C (YAK1) [2777] chr10 complement(147885..150308)
           Serine/threonine protein kinase, negative regulator of
           cell growth acting in opposition to cAMP-dependent
           protein kinase A [2424 bp, 807 aa]
          Length = 807

 Score = 50.8 bits (120), Expect = 2e-06,   Method: Compositional matrix adjust.
 Identities = 47/184 (25%), Positives = 84/184 (45%), Gaps = 28/184 (15%)

Query: 69  YKIGKKIGEGSFGVLFEGTNMINGVPVAIKFEPRKTE-APQLRDEYKTYKILNGTPNIPY 127
           Y +   +G+G+FG + +  N++    +A+K    +TE   Q   E K  ++LN   +   
Sbjct: 369 YLVLDILGQGTFGQVVKCQNLLTKEILAVKVVKSRTEYLTQSITEAKILELLNQKIDPTN 428

Query: 128 AYYFGQ------EGLHNILVIDLLGPSLEDLFDWCGRKF---SVKTVVQVAVQMITLIED 178
            ++F +         H  LV +LL  +L +L      KF   S++ +     Q++  +  
Sbjct: 429 KHHFLRMYDSFVHKNHLCLVFELLSNNLYELLK--QNKFHGLSIQLIRTFTTQILDSLCV 486

Query: 179 LHAHDLIYRDIKPDNFLIGRPGQPDANNIHLIDFGMAKQ-------------YRDPKTKQ 225
           L    LI+ D+KP+N L+  P +P+   + +IDFG + +             YR P+   
Sbjct: 487 LKESKLIHCDLKPENILLCAPDKPE---LKIIDFGSSCEEARTVYTYIQSRFYRAPEIIL 543

Query: 226 HIPY 229
            IPY
Sbjct: 544 GIPY 547

>CAGL0C05005g complement(467626..470856) similar to sp|P27636
           Saccharomyces cerevisiae YAR019c CDC15, hypothetical
           start
          Length = 1076

 Score = 51.2 bits (121), Expect = 2e-06,   Method: Compositional matrix adjust.
 Identities = 57/217 (26%), Positives = 91/217 (41%), Gaps = 22/217 (10%)

Query: 66  GLHYKIGKKIGEGSFGVLFEGTNMINGVPVAIKFEPRKTEAPQLRDEYKTYKILNGTPNI 125
            + Y++ + IG GS+GV+++ TN      VAIK E    +  +L D      +L    +I
Sbjct: 19  SVQYQLRQIIGRGSYGVVYKATNKKTAQEVAIK-EVNYQDDDELVDIMSEIDLLKNLNHI 77

Query: 126 PYAYYFG----QEGLHNILVIDLLGPSLEDLFDWCGRKFSVKTVVQVAVQMITLIEDLHA 181
               Y G    Q  L+ IL     G SL++L     R  S         Q +  +  LH 
Sbjct: 78  NIVKYHGFIQKQHNLYIILEYCAKG-SLKNLISR-NRPMSEHEAKPYVRQTLNGLNYLHE 135

Query: 182 HDLIYRDIKPDNFLIGRPGQPDANNIHLIDFGMAKQYRDPKTKQHIPYREKKSLSGTARY 241
             +I+RDIK  N L+        N + L DFG++ +  +             +L+G+  +
Sbjct: 136 QGVIHRDIKAANILLD-----SENVVKLADFGVSTKVNNTAM----------TLAGSLNW 180

Query: 242 MSINTHLGREQSRRDDMEALGHVFFYFLRGHLPWQGL 278
           M+      R  S   D+ +LG      L G+ P+  L
Sbjct: 181 MAPEIIGNRGASTLSDIWSLGATVVELLTGNPPFHNL 217

>Scas_717.69
          Length = 674

 Score = 50.8 bits (120), Expect = 2e-06,   Method: Compositional matrix adjust.
 Identities = 59/228 (25%), Positives = 93/228 (40%), Gaps = 23/228 (10%)

Query: 69  YKIGKKIGEGSFGVLFE----GTNMINGVPVAIK-FEPRKTEAPQLRDEYKTYKILNGTP 123
           + + K IG+GSFG + +     T  I  +    K +   K+E      E      +N   
Sbjct: 345 FDLLKVIGKGSFGKVMQVRKRDTQKIYALKAIRKSYIVSKSEVTHTLAERTVLARVNCPF 404

Query: 124 NIPYAYYF-GQEGLHNILVIDLLGPSLEDLFDWCGRKFSVKTVVQVAVQMITLIEDLHAH 182
            +P  + F   E L+ +L   + G  L       GR F +        +++  +E LH  
Sbjct: 405 IVPLKFSFQSPEKLYLVLAC-INGGELFYHLQKEGR-FELSRARFYTAELLCALETLHNL 462

Query: 183 DLIYRDIKPDNFLIGRPGQPDANNIHLIDFGMAKQYRDPKTKQHIPYREKKSLSGTARYM 242
           D+IYRD+KP+N L+   G      I L DFG+ K     + K         +  GT  Y+
Sbjct: 463 DVIYRDLKPENILLDYQGH-----IALCDFGLCKLNMKDQDKT-------DTFCGTPEYL 510

Query: 243 SINTHLGREQSRRDDMEALGHVFFYFLRGHLPWQGLKAPNNKQKYEKI 290
           +    L +  S+  D   LG + +  L G  P+     P   + Y KI
Sbjct: 511 APELLLNQGYSKVVDWWTLGILLYEMLTGLPPYYDEDVP---KMYRKI 555

>Scas_721.124
          Length = 684

 Score = 50.8 bits (120), Expect = 2e-06,   Method: Compositional matrix adjust.
 Identities = 58/235 (24%), Positives = 97/235 (41%), Gaps = 37/235 (15%)

Query: 69  YKIGKKIGEGSFGVLFE----GTNMINGVPVAIK-FEPRKTEAPQLRDEYKTYKILNGTP 123
           + + K IG+GSFG + +     T  I  +    K +   K+E      E      ++   
Sbjct: 351 FDLLKVIGKGSFGKVMQVRKKDTQKIYALKAIRKAYIVSKSEVTHTLAERTVLARIDCPF 410

Query: 124 NIPYAYYFGQEGLHNILVIDLLGPSL------EDLFDWCGRKFSVKTVVQVAVQMITLIE 177
            +P  + F       +++  + G  L      E  FD    +F        A +++  +E
Sbjct: 411 IVPLKFSFQSPDKLYLVLACINGGELFYHLQKEGRFDLSRSRF-------YAAELLCALE 463

Query: 178 DLHAHDLIYRDIKPDNFLIGRPGQPDANNIHLIDFGMAK--QYRDPKTKQHIPYREKKSL 235
            LH  ++IYRD+KP+N L+   G     +I L DFG+ K     D KT          + 
Sbjct: 464 TLHNLNVIYRDLKPENILLDYQG-----HIALCDFGLCKLNMKDDDKT---------DTF 509

Query: 236 SGTARYMSINTHLGREQSRRDDMEALGHVFFYFLRGHLPWQGLKAPNNKQKYEKI 290
            GT  Y++    LG+  ++  D   LG + +  L G  P+     P   + Y+KI
Sbjct: 510 CGTPEYLAPELLLGQGYTKVVDWWTLGVLLYEMLTGLPPYYDEDVP---KMYKKI 561

>ADR204W [1945] [Homologous to ScYOR061W (CKA2) - SH]
           complement(1062595..1063614) [1020 bp, 339 aa]
          Length = 339

 Score = 50.1 bits (118), Expect = 2e-06,   Method: Compositional matrix adjust.
 Identities = 42/158 (26%), Positives = 76/158 (48%), Gaps = 22/158 (13%)

Query: 69  YKIGKKIGEGSFGVLFEGTNMINGVPVAIK-FEPRKTEAPQLRDEYKTYKILNGTPNIPY 127
           Y+I  KIG G +  +F G +++N  P  IK  +P K +  ++  E K    L G PNI  
Sbjct: 50  YEIINKIGRGKYSEVFRGKSIVNDHPCVIKVLKPVKMK--KIYRELKILTNLTGGPNII- 106

Query: 128 AYYFGQEGLHNIL------VIDLLGPSLEDL-FDWCGRKFSVKTVVQVAVQMITLIEDLH 180
                  GL +I+      +  L+   ++++ F      F++        Q++  ++  H
Sbjct: 107 -------GLLDIVQDPGSKIPALIFEEVKNVEFRTLYPAFTLSDTQHYFKQLLIALDYCH 159

Query: 181 AHDLIYRDIKPDNFLIGRPGQPDANNIHLIDFGMAKQY 218
           +  +++RD+KP N +I     P    + LID+G+A+ Y
Sbjct: 160 SMGIMHRDVKPQNVMI----DPTERKLRLIDWGLAEFY 193

>ADL283W [1458] [Homologous to ScYDL108W (KIN28) - SH]
           complement(205175..205199,205252..206147) [921 bp, 306
           aa]
          Length = 306

 Score = 49.7 bits (117), Expect = 2e-06,   Method: Compositional matrix adjust.
 Identities = 41/167 (24%), Positives = 75/167 (44%), Gaps = 20/167 (11%)

Query: 64  IVGLHYKIGKKIGEGSFGVLFEGTNMINGVPVAIKFEPRKTEAPQLRD--------EYKT 115
           +  ++Y   KK+GEG++ V++ G    +G  +AIK    + +  Q +D        E K 
Sbjct: 1   MTAVNYTKEKKVGEGTYAVVYLGHRQTDGRQIAIK----EIKTSQFKDGLDMSAIREVKY 56

Query: 116 YKILNGTPNIPYA-YYFGQEGLHNILVIDLLGPSLEDLFDWCGRKFSVKTVVQVAVQMIT 174
            + +     I     +  QE L+  LV++ L   LE L       F+   +    +  + 
Sbjct: 57  LQEIRHANVIELVDLFMAQENLN--LVLEFLPADLEMLIKDSSLLFTQADIKSWLLMTLR 114

Query: 175 LIEDLHAHDLIYRDIKPDNFLIGRPGQPDANNIHLIDFGMAKQYRDP 221
            +   H   +++RD+KP+N L+   GQ     + + DFG+A+    P
Sbjct: 115 GVHHCHRSFILHRDLKPNNLLLAPDGQ-----LKIADFGLARTLAAP 156

>KLLA0F09020g 836287..839073 weakly similar to sp|P43565
           Saccharomyces cerevisiae YFL033c RIM15 protein kinase
           involved in expression of meiotic genes, start by
           similarity
          Length = 928

 Score = 50.8 bits (120), Expect = 2e-06,   Method: Compositional matrix adjust.
 Identities = 47/201 (23%), Positives = 88/201 (43%), Gaps = 18/201 (8%)

Query: 69  YKIGKKIGEGSFGVLFEGTNMINGVPVAIKFEPR-----KTEAPQLRDEYKTYKILNGTP 123
           Y + K I +G++G ++     + G   AIK   +     K +   ++ E     + +  P
Sbjct: 702 YDVIKPISKGAYGSVYLAKKRVTGEYFAIKVLKKSDMIAKNQVTNVKSERAIMMVQSDKP 761

Query: 124 NIPYAYYFGQEGLHNILVIDLL-GPSLEDLFDWCGRKFSVKTVVQVAVQMITLIEDLHAH 182
            +   Y   Q   +  LV+  L G  +  L    G     K   Q   ++I+ ++D+H +
Sbjct: 762 YVARLYATFQNKENLFLVMQYLSGGDMATLIKMMGN-LPEKWAKQYICEVISGVDDMHQN 820

Query: 183 DLIYRDIKPDNFLIGRPGQPDANNIHLIDFGMAKQ--YRDPKTKQHIPYREKKSLSGTAR 240
            +I+ D+KPDN LI   G      I L DFG+++    R  K K+    R  +  S    
Sbjct: 821 GIIHHDLKPDNLLIDSLGH-----IKLTDFGLSRMGLLRRHKEKR----RNSQIQSSRNP 871

Query: 241 YMSINTHLGREQSRRDDMEAL 261
             + ++ + R+ S  D ++++
Sbjct: 872 SFTCDSSVTRKNSVTDSLQSV 892

>Scas_651.18
          Length = 371

 Score = 50.1 bits (118), Expect = 3e-06,   Method: Compositional matrix adjust.
 Identities = 56/228 (24%), Positives = 100/228 (43%), Gaps = 26/228 (11%)

Query: 69  YKIGKKIGEGSFGVLFEGTNMINGVPVAIKFEPRKT-----EAPQLRDEYKTYKILNGTP 123
           ++I + +G GSFG +    +  NG   A+K   + T     +     DE     +++  P
Sbjct: 59  FQILRTLGTGSFGRVHLIRSNHNGRFYALKVLKKHTIVKLKQVEHTNDERLMLSVVSH-P 117

Query: 124 NIPYAYYFGQEGLHNILVIDLL-GPSLEDLFDWCGRKFSVKTVVQVAVQMITLIEDLHAH 182
            +   +   Q+     +++D + G  L  L     ++F        A ++   +E LH+ 
Sbjct: 118 FLVRMWGTFQDFEQVFMIMDYIEGGELFSLLR-KSQRFPNPVAKFYAAEVCLALEYLHSM 176

Query: 183 DLIYRDIKPDNFLIGRPGQPDANNIHLIDFGMAKQYRDPKTKQHIPYREKKSLSGTARYM 242
           D+IYRD+KP+N L+ + G     +I + DFG AK   D      I Y    +L GT  Y+
Sbjct: 177 DIIYRDLKPENILLDKNG-----HIKITDFGFAKYVPD------ITY----TLCGTPDYI 221

Query: 243 SINTHLGREQSRRDDMEALGHVFFYFLRGHLPWQGLKAPNNKQKYEKI 290
           +      +  ++  D  + G + +  L G+ P+      N  + YE I
Sbjct: 222 APEVVSTKPYNKSVDWWSFGILIYEMLAGYTPFYD---SNTMKTYENI 266

>CAGL0K12562g 1234866..1239914 similar to sp|P43565 Saccharomyces
           cerevisiae YFL033c RIM15 protein kinase involved in
           expression of meiotic genes, hypothetical start
          Length = 1682

 Score = 50.4 bits (119), Expect = 3e-06,   Method: Compositional matrix adjust.
 Identities = 49/185 (26%), Positives = 84/185 (45%), Gaps = 15/185 (8%)

Query: 69  YKIGKKIGEGSFGVLFEGTNMINGVPVAIKFEPR-----KTEAPQLRDEYKTYKILNGTP 123
           Y I K I +G++G ++     + G   AIK   +     K +   ++ E     + +  P
Sbjct: 782 YDIIKPISKGAYGSVYLARKKLTGDYFAIKVLRKSDMIAKNQVTNVKSERAIMMVQSDKP 841

Query: 124 NIPYAYYFGQEGLHNILVIDLL-GPSLEDLFDWCGRKFSVKTVVQVAVQMITLIEDLHAH 182
            +   Y   Q   +  LV++ L G  L  L    G     + V Q   ++I  +ED+H +
Sbjct: 842 YVARLYATFQNKDNLFLVMEYLPGGDLATLLKMMG-CLPDEWVKQYLSEIIIGVEDMHNN 900

Query: 183 DLIYRDIKPDNFLIGRPGQPDANNIHLIDFGMAKQYRDPKTKQHIPYREKKSLSGTARYM 242
            +I+ D+KP+N LI   G      + L DFG+++     K  +HIP  +  SLS      
Sbjct: 901 GIIHHDLKPENLLIDVSGH-----LKLTDFGLSRAGL-VKRHRHIP--KPISLSNADTRS 952

Query: 243 SINTH 247
           +I++H
Sbjct: 953 NIDSH 957

>YOR061W (CKA2) [4869] chr15 (441535..442554) Casein kinase II
           (Protein kinase CK2), catalytic (alpha-prime) subunit
           [1020 bp, 339 aa]
          Length = 339

 Score = 49.7 bits (117), Expect = 3e-06,   Method: Compositional matrix adjust.
 Identities = 40/153 (26%), Positives = 73/153 (47%), Gaps = 10/153 (6%)

Query: 68  HYKIGKKIGEGSFGVLFEGTNMINGVPVAIK-FEPRKTEAPQLRDEYKTYKILNGTPNIP 126
           +Y+I  KIG G +  +F G  ++N     IK  +P K +  ++  E K    L G PN+ 
Sbjct: 49  NYEIINKIGRGKYSEVFSGRCIVNNQKCVIKVLKPVKMK--KIYRELKILTNLTGGPNVV 106

Query: 127 YAYYFGQEGLHNILVIDLLGPSLEDL-FDWCGRKFSVKTVVQVAVQMITLIEDLHAHDLI 185
             Y   Q+    I    L+   ++++ F      F +  +     Q++  ++  H+  ++
Sbjct: 107 GLYDIVQDADSKIPA--LIFEEIKNVDFRTLYPTFKLPDIQYYFTQLLIALDYCHSMGIM 164

Query: 186 YRDIKPDNFLIGRPGQPDANNIHLIDFGMAKQY 218
           +RD+KP N +I     P    + LID+G+A+ Y
Sbjct: 165 HRDVKPQNVMI----DPTERKLRLIDWGLAEFY 193

>CAGL0G02035g 179911..180930 highly similar to sp|P19454
           Saccharomyces cerevisiae YOR061w CKA2 casein kinase II
           alpha chain, start by similarity
          Length = 339

 Score = 49.7 bits (117), Expect = 3e-06,   Method: Compositional matrix adjust.
 Identities = 40/152 (26%), Positives = 70/152 (46%), Gaps = 8/152 (5%)

Query: 68  HYKIGKKIGEGSFGVLFEGTNMINGVPVAIK-FEPRKTEAPQLRDEYKTYKILNGTPNIP 126
           +Y+I  KIG G +  +F G  + N  P  IK  +P K +  ++  E K    L G PN+ 
Sbjct: 49  NYEIVTKIGRGKYSEVFSGKCITNDQPCVIKVLKPVKMK--KIYRELKILTNLTGGPNVI 106

Query: 127 YAYYFGQEGLHNILVIDLLGPSLEDLFDWCGRKFSVKTVVQVAVQMITLIEDLHAHDLIY 186
                 Q+    I  +        D F      F+++ +     Q++  ++  H+  +++
Sbjct: 107 GLLDIVQDQASKIPALIFEEVKNAD-FRTLYPSFTLQDLQYYFTQLLIALDYCHSMGIMH 165

Query: 187 RDIKPDNFLIGRPGQPDANNIHLIDFGMAKQY 218
           RD+KP N +I     P    + LID+G+A+ Y
Sbjct: 166 RDVKPQNVMI----DPAQKKLRLIDWGLAEFY 193

>Scas_700.34
          Length = 864

 Score = 50.4 bits (119), Expect = 3e-06,   Method: Compositional matrix adjust.
 Identities = 54/231 (23%), Positives = 100/231 (43%), Gaps = 43/231 (18%)

Query: 69  YKIGKKIGEGSFGVLFEGTNMINGVP-----------VAIKFEPRKTEAPQLRDEYKTYK 117
           Y IG  +GEG FG +  G    N +P           VAIK   R T +     E K Y+
Sbjct: 48  YIIGSTLGEGEFGKVKLGWPK-NSLPSSSSGIDVPKQVAIKLIRRDTISKDSSKEIKIYR 106

Query: 118 ILNGTPNIPYAYYFG-QEGLHNILVIDLLGPSLE-----DLFDWCGRKFSVKT--VVQVA 169
            +N   ++ +      +E L N   I ++   LE     + + +  RK  +K     ++ 
Sbjct: 107 EINALKHLTHPNIVKLEEVLQNSKYIGIV---LEYASGGEFYKYIQRKKRLKEGPACRLF 163

Query: 170 VQMITLIEDLHAHDLIYRDIKPDNFLIGRPGQPDANNIHLIDFGMAKQYRDPKTKQHIPY 229
            Q+I  +  +H+  L++RD+K +N L+ +       N+ + DFG   ++          Y
Sbjct: 164 AQLINGVHYIHSKGLVHRDLKLENLLLDK-----HENLIITDFGFVSEF----------Y 208

Query: 230 RE---KKSLSGTARYMSINTHLGRE--QSRRDDMEALGHVFFYFLRGHLPW 275
                 K+  G+  Y +    +  +  ++++ D+ + G + +  L G+LPW
Sbjct: 209 SHGELMKTSCGSPCYAAPELVVSTKPYEAKKADIWSCGVILYAMLAGYLPW 259

>YHL007C (STE20) [2279] chr8 complement(95113..97932)
           Serine/threonine protein kinase of the pheromone
           response pathway, also participates in the filamentous
           growth and STE vegetative growth pathways [2820 bp, 939
           aa]
          Length = 939

 Score = 50.4 bits (119), Expect = 3e-06,   Method: Compositional matrix adjust.
 Identities = 49/205 (23%), Positives = 93/205 (45%), Gaps = 18/205 (8%)

Query: 74  KIGEGSFGVLFEGTNMINGVPVAIKFEPRKTEAPQLRDEYKTYKILNGT--PNIP-YAYY 130
           KIG+G+ G ++    +   V VAIK +    + P+         ++ G+  PNI  +   
Sbjct: 625 KIGQGASGGVYTAYEIGTNVSVAIK-QMNLEKQPKKELIINEILVMKGSKHPNIVNFIDS 683

Query: 131 FGQEGLHNILVIDLLGPSLEDLFDWCGRKFSVKTVVQVAVQMITLIEDLHAHDLIYRDIK 190
           +  +G   +++  + G SL D+   C    +   +  V  + ++ +E LH+  +++RDIK
Sbjct: 684 YVLKGDLWVIMEYMEGGSLTDVVTHC--ILTEGQIGAVCRETLSGLEFLHSKGVLHRDIK 741

Query: 191 PDNFLIGRPGQPDANNIHLIDFGMAKQYRDPKTKQHIPYREKKSLSGTARYMSINTHLGR 250
            DN L+   G     +I L DFG   Q  +   K       + ++ GT  +M+      +
Sbjct: 742 SDNILLSMEG-----DIKLTDFGFCAQINELNLK-------RTTMVGTPYWMAPEVVSRK 789

Query: 251 EQSRRDDMEALGHVFFYFLRGHLPW 275
           E   + D+ +LG +    + G  P+
Sbjct: 790 EYGPKVDIWSLGIMIIEMIEGEPPY 814

>KLLA0B09790g complement(855327..856214) highly similar to sp|P00546
           Saccharomyces cerevisiae YBR160w CDC28 cyclin-dependent
           protein kinase, start by similarity
          Length = 295

 Score = 49.3 bits (116), Expect = 4e-06,   Method: Compositional matrix adjust.
 Identities = 55/207 (26%), Positives = 90/207 (43%), Gaps = 22/207 (10%)

Query: 68  HYKIGKKIGEGSFGVLFEGTNMINGVPVA----IKFEPRKTEAPQLR-DEYKTYKILNGT 122
           +YK  +K+GEG++GV+++  ++ +   V     I+ E      P     E    K L   
Sbjct: 6   NYKRLEKVGEGTYGVVYKAVDLRHQNRVVAMKKIRLESEDEGVPSTAIREISLLKELKDD 65

Query: 123 PNIPYAYYFGQEGLHNI-LVIDLLGPSLEDLFDWCGRK--FSVKTVVQVAVQMITLIEDL 179
            NI   Y       H + LV + L   L+   +   +        + +  +Q+   I   
Sbjct: 66  -NIVRLYDIVHSDAHKLYLVFEFLDLDLKRYMESIPKDQPLGGNIIKKFMMQLCKGIAYC 124

Query: 180 HAHDLIYRDIKPDNFLIGRPGQPDANNIHLIDFGMAKQYRDPKTKQHIPYREKKSLSGTA 239
           HAH +I+RD+KP N LI R G     N+ L DFG+A+ +        +P R       T 
Sbjct: 125 HAHRIIHRDLKPQNLLINRDG-----NLKLGDFGLARAF-------GVPLRAYTHEIVTL 172

Query: 240 RYMSINTHLGREQ-SRRDDMEALGHVF 265
            Y +    LG +Q S   D+ ++G +F
Sbjct: 173 WYRAPEVLLGGKQYSTGVDVWSIGCIF 199

>ABR014W [605] [Homologous to ScYHL007C (STE20) - SH]
           complement(417710..420625) [2916 bp, 971 aa]
          Length = 971

 Score = 50.1 bits (118), Expect = 4e-06,   Method: Compositional matrix adjust.
 Identities = 51/209 (24%), Positives = 89/209 (42%), Gaps = 26/209 (12%)

Query: 74  KIGEGSFGVLFEGTNMINGVPVAIKFEPRKTEAPQLRDEYKTYKIL-------NGTPNIP 126
           KIG+G+ G ++    +     VAIK   +     Q + E    +IL       N   N  
Sbjct: 688 KIGQGASGGVYTAYEIGTNASVAIK---QMNLEKQPKKELIINEILVMKGSRHNNIVNFI 744

Query: 127 YAYYFGQEGLHNILVIDLLGPSLEDLFDWCGRKFSVKTVVQVAVQMITLIEDLHAHDLIY 186
            +Y    +G   +++  + G SL D+   C    +   +  V+ + +  +  LH+  +I+
Sbjct: 745 DSYLL--KGDLWVIMEYMEGGSLTDVVTHC--ILTEGQIAAVSRETLRGLHFLHSKGVIH 800

Query: 187 RDIKPDNFLIGRPGQPDANNIHLIDFGMAKQYRDPKTKQHIPYREKKSLSGTARYMSINT 246
           RDIK DN L+   G     NI L DFG   Q  +   K       + ++ GT  +M+   
Sbjct: 801 RDIKSDNILLSMDG-----NIKLTDFGFCAQINETNLK-------RTTMVGTPYWMAPEV 848

Query: 247 HLGREQSRRDDMEALGHVFFYFLRGHLPW 275
              +E   + D+ +LG +    + G  P+
Sbjct: 849 VSRKEYGPKVDIWSLGIMIIEMIEGEPPY 877

>Scas_640.14*
          Length = 728

 Score = 50.1 bits (118), Expect = 4e-06,   Method: Compositional matrix adjust.
 Identities = 49/223 (21%), Positives = 97/223 (43%), Gaps = 28/223 (12%)

Query: 69  YKIGKKIGEGSFGVL---------FEGTNMINGVPVAIKFEPRKTEAPQLRDEYKTYKIL 119
           Y +G  +GEG FG +           G    +   VAIK   R         E K ++ +
Sbjct: 38  YIVGATLGEGEFGKVKMGWSTTSSSSGKITEDSKQVAIKLIRRDFIKKGSEKEMKIFREI 97

Query: 120 NGTPNIPYAYYFG-QEGLHNILVIDLLG--PSLEDLFDWCGRKFSVK--TVVQVAVQMIT 174
           N   ++ +      +E L N   I ++    S  + + +  RK  +K  T  ++  Q+I+
Sbjct: 98  NSLKHLTHPNIVRLEEVLQNSKYIGIVLEYASGGEFYKYVQRKRRLKEATACRLFAQLIS 157

Query: 175 LIEDLHAHDLIYRDIKPDNFLIGRPGQPDANNIHLIDFGMAKQYRDPKTKQHIPYREKKS 234
            +  +H+  +++RD+K +N L+ +       N+ + DFG   ++       +      K+
Sbjct: 158 GVSYMHSKGIVHRDLKLENLLLDK-----HENLIITDFGFVNEF-------YADNELMKT 205

Query: 235 LSGTARYMSINTHLGRE--QSRRDDMEALGHVFFYFLRGHLPW 275
             G+  Y +    +  E  ++R+ D+ + G + +  L G+LPW
Sbjct: 206 SCGSPCYAAPELVITTEPYKARKADIWSCGIILYGMLAGYLPW 248

>ACR249C [1296] [Homologous to ScYJL141C (YAK1) - SH]
           (797020..798951) [1932 bp, 643 aa]
          Length = 643

 Score = 49.7 bits (117), Expect = 4e-06,   Method: Compositional matrix adjust.
 Identities = 53/186 (28%), Positives = 84/186 (45%), Gaps = 32/186 (17%)

Query: 69  YKIGKKIGEGSFGVLFEGTNMINGVPVAIKFEPRKTE-APQLRDEYKTYKILNGTPNIPY 127
           Y I   +G+G+FG + +  NM     VA+K    KTE   Q   E K  ++LN   +   
Sbjct: 273 YLILDILGQGTFGQVVKCQNMQTKEIVAVKVVKSKTEYLNQSIMEAKILELLNKRIDPLN 332

Query: 128 AYYFGQEGLHN--------ILVIDLLGPSLEDLFDWCGRKF---SVKTVVQVAVQMITLI 176
            ++F +  LH+         LV +LL  +L +L      KF   S+  +     Q++  +
Sbjct: 333 QHHFLR--LHDSFVHKNHLCLVFELLSNNLYELLK--QNKFHGLSMNLIKNFCKQLLDSL 388

Query: 177 EDLHAHDLIYRDIKPDNFLIGRPGQPDANNIHLIDFGMAKQ-------------YRDPKT 223
             L    LI+ D+KP+N L+  P +P+   + +IDFG A +             YR P+ 
Sbjct: 389 CVLKESKLIHCDLKPENVLLVSPDRPE---LKVIDFGSACEEARTVYTYIQSRFYRAPEV 445

Query: 224 KQHIPY 229
              IPY
Sbjct: 446 LMGIPY 451

>ACR142W [1189] [Homologous to ScYPL153C (RAD53) - SH]
           complement(597519..600032) [2514 bp, 837 aa]
          Length = 837

 Score = 50.1 bits (118), Expect = 4e-06,   Method: Compositional matrix adjust.
 Identities = 55/231 (23%), Positives = 98/231 (42%), Gaps = 30/231 (12%)

Query: 75  IGEGSFGVLFEGTNMINGVPVAIKFEPRKTEAPQLRDEYKTYKILN--GTPNIPYAYYFG 132
           +G+G+F  + +      G   A+K   ++     +    +  ++L     P I     F 
Sbjct: 223 VGQGAFATVKKAVERNTGKTFAVKIINKRKVMGNVDGVTRELEVLRRLNHPRIVSLKGFY 282

Query: 133 QEGLHNILVIDLLGPSLEDLFDWCGRKFSVKTVV--QVAVQMITLIEDLHAHDLIYRDIK 190
           ++     L+++ +  S  DL D+     SV      ++  Q++  +  +H   + +RD+K
Sbjct: 283 EDDESYYLLMEFV--SGGDLMDFVAAHGSVGEDAGREITRQILEAVRYIHEQGISHRDLK 340

Query: 191 PDNFLIGRPGQPDANNIHLIDFGMAKQYRDPKTKQHIPYREKKSLSGTARYMSI------ 244
           PDN LI    Q D   + + DFG+AK  +D  T         K+  GT  Y++       
Sbjct: 341 PDNILI---EQDDPVLVKITDFGLAK-IQDNTTFM-------KTFCGTLAYVAPEVIGGK 389

Query: 245 ----NTHLGREQSRRDDMEALGHVFFYFLRGHLPWQGLKAPNNKQKYEKIG 291
               N   G   S   DM ++G + +  L GHLP+ G      +Q Y++I 
Sbjct: 390 NPEGNGANGNLYSSLVDMWSIGCLVYVILTGHLPFSG---STQEQLYKQIA 437

>ABL011C [581] [Homologous to ScYLR362W (STE11) - SH]
           (378259..380364) [2106 bp, 701 aa]
          Length = 701

 Score = 49.7 bits (117), Expect = 4e-06,   Method: Compositional matrix adjust.
 Identities = 60/235 (25%), Positives = 97/235 (41%), Gaps = 43/235 (18%)

Query: 72  GKKIGEGSFGVLFEGTNMINGVPVAIK---FEPRKTEAPQLRDEYKTY-------KILNG 121
           G +IG GSFG ++ G N   G  +A+K    EP    A    D+ K++       K L  
Sbjct: 418 GARIGSGSFGSVYLGMNAHTGELMAVKQVELEPTTVMASS--DDKKSHPSSNAVVKKLTD 475

Query: 122 TP--------------------NIPYAYYFGQEGLH-NILVIDLLGPSLEDLFDWCGRKF 160
            P                    NI   Y   QEG + NI +  + G S+  + +  G  F
Sbjct: 476 PPQDGGRASSTKMNLLKELHHENIVTYYGSSQEGGNLNIFLEYVPGGSVSSMLNSYG-PF 534

Query: 161 SVKTVVQVAVQMITLIEDLHAHDLIYRDIKPDNFLIGRPGQPDANNIHLIDFGMAKQYRD 220
               V     Q +  +  LH  ++I+RDIK  N LI   G     ++ + DFG++K+   
Sbjct: 535 EEPLVKNFTRQTLVGLTYLHRKNIIHRDIKGANLLIDIKG-----SVKITDFGISKKLSP 589

Query: 221 PKTKQHIPYREKKSLSGTARYMSINTHLGREQSRRDDMEALGHVFFYFLRGHLPW 275
              KQ+    ++ SL G+  +M+         + + D+ ++G V      G  P+
Sbjct: 590 LNKKQN----KRASLQGSVYWMAPEVVKQVVTTEKADIWSVGCVVVEMFTGKHPF 640

>Kwal_56.24091
          Length = 381

 Score = 49.3 bits (116), Expect = 4e-06,   Method: Compositional matrix adjust.
 Identities = 33/117 (28%), Positives = 57/117 (48%), Gaps = 13/117 (11%)

Query: 160 FSVKTVVQVAVQMITLIEDLHAHDLIYRDIKPDNFLIGRPGQPDANNIHLIDFGMAKQYR 219
           F+  T      QM   +  +H+ ++++RDIKP+N L+G       N + L DFG +    
Sbjct: 218 FNDITASHFVHQMADALNYMHSKNILHRDIKPENILLGF-----QNTLKLTDFGWS---- 268

Query: 220 DPKTKQHIPYREKKSLSGTARYMSINTHLGREQSRRDDMEALGHVFFYFLRGHLPWQ 276
                 ++   ++K+L GT  Y+S      RE   + D+ ALG + +  L G  P++
Sbjct: 269 ----VSNVGNSKRKTLCGTMDYLSPELIKSREYDNKVDVWALGVLTYELLVGSPPFE 321

>AEL115C [2391] [Homologous to ScYKL166C (TPK3) - SH; ScYJL164C
           (TPK1) - SH] (405062..406222) [1161 bp, 386 aa]
          Length = 386

 Score = 49.3 bits (116), Expect = 4e-06,   Method: Compositional matrix adjust.
 Identities = 32/107 (29%), Positives = 54/107 (50%), Gaps = 15/107 (14%)

Query: 169 AVQMITLIEDLHAHDLIYRDIKPDNFLIGRPGQPDANNIHLIDFGMAKQYRDPKTKQHIP 228
           A ++   +E LH+ D+IYRD+KP+N L+ + G     +I L DFG AK   D      + 
Sbjct: 180 AAEVCLALEYLHSKDIIYRDLKPENILLDKNG-----HIKLTDFGFAKYVPD------VT 228

Query: 229 YREKKSLSGTARYMSINTHLGREQSRRDDMEALGHVFFYFLRGHLPW 275
           Y    +L GT  Y++      +  ++  D  + G + +  L G+ P+
Sbjct: 229 Y----TLCGTPDYIAPEVVSTKPYNKSVDWWSFGILIYEMLAGYTPF 271

>YKL171W (YKL171W) [3100] chr11 (127480..130266) Serine/threonine
           protein kinase of unknown function [2787 bp, 928 aa]
          Length = 928

 Score = 49.7 bits (117), Expect = 5e-06,   Method: Compositional matrix adjust.
 Identities = 38/166 (22%), Positives = 81/166 (48%), Gaps = 16/166 (9%)

Query: 67  LHYKIGKKIGEGSFGVLFEGTNMINGVPVAIK---FEPRKTEAPQLRDEYKTYKILNGTP 123
           L +++GK IG G++G++ E  ++  GV   IK   F+  +     +  E   ++ L    
Sbjct: 447 LGHRLGKIIGFGAWGIIRECFDIETGVGRVIKIVKFKGHQNIKKHVLREVAIWRTLKHNR 506

Query: 124 NIP---------YAYYFGQEGLHNILVIDLLGPSLEDLFDWCGRKFS--VKTVVQVAVQM 172
            +P         YA Y   E +++  + DL+     D F      F+   +  + +++Q+
Sbjct: 507 ILPLLDWKLDDNYAMYCLTERINDGTLYDLVIS--WDEFKRSKIPFAERCRLTIFLSLQL 564

Query: 173 ITLIEDLHAHDLIYRDIKPDNFLIGRPGQPDANNIHLIDFGMAKQY 218
           ++ ++ +H+  +++ DIK +N L+ + G+     + L DFGM+  +
Sbjct: 565 LSALKYMHSKTIVHGDIKLENCLLQKEGKKSDWKVFLCDFGMSCHF 610

>CAGL0J03828g 362722..364125 similar to sp|P32490 Saccharomyces
           cerevisiae YOR231w MKK1 ser/thr protein kinase or
           sp|P32491 Saccharomyces cerevisiae YPL140c MKK2, start
           by similarity
          Length = 467

 Score = 48.9 bits (115), Expect = 6e-06,   Method: Compositional matrix adjust.
 Identities = 50/217 (23%), Positives = 92/217 (42%), Gaps = 34/217 (15%)

Query: 64  IVGLHYKIGKKIGEGSFGVLFEGTNMINGVPVAIKFEPRKTEAPQLRDEYKTYKILNGTP 123
           +     + GKK+         +  N++NG P   +F+ +     Q    +K+  I+    
Sbjct: 194 VAKCKLRTGKKV------FALKTINILNGDP---EFQKQLLRELQFNKSFKSEYIVR--- 241

Query: 124 NIPYAYYFGQEGLHNILVID--LLGPSLEDLFDWC---GRKFSVKTVVQVAVQMITLIED 178
              Y   F  E   +I +    + G SLE ++      G + S K + +++  ++  +  
Sbjct: 242 ---YFGMFTDEQNSSIYIAMEYMGGKSLEAIYKELLSRGGRISEKVLGKISEAVLRGLSY 298

Query: 179 LHAHDLIYRDIKPDNFLIGRPGQPDANNIHLIDFGMAKQYRDPKTKQHIPYREKKSLSGT 238
           LH   +I+RDIKP N L+   GQ     + L DFG++ +  +             + +GT
Sbjct: 299 LHEKKVIHRDIKPQNILLNEDGQ-----VKLCDFGVSGEAVNSLA---------TTFTGT 344

Query: 239 ARYMSINTHLGREQSRRDDMEALGHVFFYFLRGHLPW 275
           + YM+     G+  S   D+ +LG       +GH P+
Sbjct: 345 SYYMAPERIQGQPYSVTCDVWSLGLTILEVAQGHFPF 381

>Kwal_23.3590
          Length = 499

 Score = 48.9 bits (115), Expect = 6e-06,   Method: Compositional matrix adjust.
 Identities = 56/240 (23%), Positives = 102/240 (42%), Gaps = 39/240 (16%)

Query: 69  YKIGKKIGEGSFGVLFEGTNMINGVPVAIKF-------EPRKTEAPQLRDEYKTYKILNG 121
           Y  GK++G G + ++ E  +  +G  VA+K        + +KT+  Q R+E K    +  
Sbjct: 186 YIAGKELGSGHYAIVKEAIDKDSGDVVAVKIFHAQHNDDQKKTK--QFREETKILMSIQH 243

Query: 122 TPNIPYAYYF----GQEGLHNILVIDLLGPSLEDLFDWCGRKFSVKTVVQVAV--QMITL 175
              +     F     +  +   LV++ +     +LFD   RK  ++     A+  Q++  
Sbjct: 244 KNIVKLIDRFVEPVSKAQIQTFLVLEKVSDG--ELFDRIVRKTRLREDETNAIFKQILNG 301

Query: 176 IEDLHAHDLIYRDIKPDNFLIGRPGQPDAN--------------NIHLIDFGMAKQYRDP 221
           +  LHA ++I+RDIKP+N L+    +  ++               I + DFG+AK   + 
Sbjct: 302 LRYLHAKNIIHRDIKPENILLSIRKRRHSDEQQLGPWDDDEIDITIKIADFGLAKFIGE- 360

Query: 222 KTKQHIPYREKKSLSGTARYMSINTHLGREQSRRDDMEALGHVFFYFLRGHLPWQGLKAP 281
                   +   +L GT  Y++         + R DM + G + +  L G  P+    AP
Sbjct: 361 -------MQFTNTLCGTPSYVAPEVLTKTGYTSRVDMWSAGVLLYVCLCGFPPFSEQLAP 413

>ACR218W [1265] [Homologous to ScYFL033C (RIM15) - SH]
           complement(731433..736142) [4710 bp, 1569 aa]
          Length = 1569

 Score = 49.7 bits (117), Expect = 6e-06,   Method: Compositional matrix adjust.
 Identities = 41/154 (26%), Positives = 69/154 (44%), Gaps = 12/154 (7%)

Query: 69  YKIGKKIGEGSFGVLFEGTNMINGVPVAIKFEPR-----KTEAPQLRDEYKTYKILNGTP 123
           Y I K I +G++G ++     I G   AIK   +     K +   ++ E     + +  P
Sbjct: 682 YDIIKPISKGAYGSVYLAYKRITGEYFAIKVLRKSDMIAKNQVTNVKSERVIMMVQSEKP 741

Query: 124 NIPYAYYFGQEGLHNILVIDLL-GPSLEDLFDWCGRKFSVKTVVQVAVQMITLIEDLHAH 182
            +   Y   Q   +  LV++ L G  L  L    G     K   Q   ++I  ++D+H  
Sbjct: 742 YVAKLYATFQNKENLFLVMEYLSGGDLATLIKMMG-NLPDKWAKQYITEVIIGVDDMHMS 800

Query: 183 DLIYRDIKPDNFLIGRPGQPDANNIHLIDFGMAK 216
            +I+ D+KPDN LI   G     ++ L DFG+++
Sbjct: 801 GIIHHDLKPDNLLIDSNG-----HVKLTDFGLSR 829

>KLLA0B13607g 1191592..1194561 weakly similar to sp|Q03497
           Saccharomyces cerevisiae YHL007c STE20 ser/thr protein
           kinase of the pheromone pathway, hypothetical start
          Length = 989

 Score = 49.3 bits (116), Expect = 6e-06,   Method: Compositional matrix adjust.
 Identities = 53/214 (24%), Positives = 92/214 (42%), Gaps = 26/214 (12%)

Query: 69  YKIGKKIGEGSFGVLFEGTNMINGVPVAIKFEPRKTEAPQLRDEYKTYKIL-------NG 121
           YK   KIG+G+ G ++    +     VAIK   +     Q + E    +IL       N 
Sbjct: 698 YKNLIKIGQGASGGVYTAYELGTNASVAIK---QMNLEKQPKKELIVNEILVMKGSKHNN 754

Query: 122 TPNIPYAYYFGQEGLHNILVIDLLGPSLEDLFDWCGRKFSVKTVVQVAVQMITLIEDLHA 181
             N   +Y F   G   +++  + G SL D+   C    +   +  V+ + +  ++ LH+
Sbjct: 755 IVNFIDSYLF--RGDLWVVMEYMEGGSLTDVVTHC--ILTEGQIGAVSRETLKGLQFLHS 810

Query: 182 HDLIYRDIKPDNFLIGRPGQPDANNIHLIDFGMAKQYRDPKTKQHIPYREKKSLSGTARY 241
             +I+RDIK DN L+   G     +I L DFG   Q  +   K       + ++ GT  +
Sbjct: 811 KGVIHRDIKSDNILLSMNG-----DIKLTDFGFCAQINEVNLK-------RTTMVGTPYW 858

Query: 242 MSINTHLGREQSRRDDMEALGHVFFYFLRGHLPW 275
           M+      +E   + D+ +LG +    + G  P+
Sbjct: 859 MAPEVVSRKEYGPKVDIWSLGIMIIEMIEGEPPY 892

>CAGL0J06072g complement(572377..574698) similar to sp|P53894
           Saccharomyces cerevisiae YNL161w CBK1, hypothetical
           start
          Length = 773

 Score = 49.3 bits (116), Expect = 6e-06,   Method: Compositional matrix adjust.
 Identities = 47/152 (30%), Positives = 69/152 (45%), Gaps = 17/152 (11%)

Query: 75  IGEGSFG----VLFEGTNMINGVPVAIKFEPRKTEAPQLRDEYKTYKILNGT--PNIPYA 128
           IG+G+FG    V  + T  I  +   +K E  K +  QL        +L GT  P I   
Sbjct: 376 IGKGAFGEVRLVQKKDTGKIYAMKTLLKSEMYKKD--QLAHVKAERDVLAGTDSPWIVSL 433

Query: 129 YYFGQEGLHNILVIDLL--GPSLEDLFDWCGRKFSVKTVVQVAVQMITLIEDLHAHDLIY 186
           YY  Q+  +  L+++ L  G  +  L  W  + F+         + I  IE +H    I+
Sbjct: 434 YYSFQDAQYLYLIMEFLPGGDLMTMLIRW--QLFTEDVTRFYMAECILAIETIHKLGFIH 491

Query: 187 RDIKPDNFLIGRPGQPDANNIHLIDFGMAKQY 218
           RDIKPDN LI   G     +I L DFG++  +
Sbjct: 492 RDIKPDNILIDIRG-----HIKLSDFGLSTGF 518

>Scas_201.1*
          Length = 274

 Score = 48.1 bits (113), Expect = 6e-06,   Method: Compositional matrix adjust.
 Identities = 50/204 (24%), Positives = 95/204 (46%), Gaps = 18/204 (8%)

Query: 79  SFGVLFEGTNMINGVPVAIKFEPR---KTEAPQLRDEYKTYKILNGT--PNIPYAYYFGQ 133
           +FGV+ +     +   VA+K   +   K    QL+  Y    IL     PNI  A+    
Sbjct: 45  TFGVVRQARQFFSQEAVAVKILLKNALKGNDVQLQMLYDELSILQRLHHPNI-VAFKDWF 103

Query: 134 EGLHNILVIDLLGPSLEDLFDWCGRK--FSVKTVVQVAVQMITLIEDLHAHDLIYRDIKP 191
           E      ++  L    E LFD   +K  F+    V + VQ++  ++ +H+ ++++RD+KP
Sbjct: 104 ESRDKFYIVTQLATGGE-LFDRIIKKGKFTEVDAVNIMVQLLDAVKYIHSQNIVHRDLKP 162

Query: 192 DNFLIGRPGQPDANNIHLIDFGMAKQYRDPKTKQHIPYREKKSLSGTARYMSINTHLGRE 251
           +N L   P   D + + + DFG+AK+    K+   + ++     +G+  Y++        
Sbjct: 163 ENVLYLDPS--DESQLVIADFGIAKEL---KSNDDLIFKG----AGSLGYVAPEVLTKEG 213

Query: 252 QSRRDDMEALGHVFFYFLRGHLPW 275
             +  D+ +LG + +  L G+ P+
Sbjct: 214 HGKPCDIWSLGVITYTLLSGYSPF 237

>KLLA0F11143g complement(1026129..1028570) similar to sp|P22216
           Saccharomyces cerevisiae YPL153c SPK1 ser/thr/tyr
           protein kinase, start by similarity
          Length = 813

 Score = 49.3 bits (116), Expect = 7e-06,   Method: Compositional matrix adjust.
 Identities = 54/229 (23%), Positives = 104/229 (45%), Gaps = 31/229 (13%)

Query: 66  GLH--YKIGKKI-GEGSFGVLFEGTNMINGVPVAIKFEPRKTEAPQ---LRDEYKTYKIL 119
           G+H  Y I   I G+G+F  + +      G   A+K   ++    +   ++ E    + L
Sbjct: 186 GIHKYYSISDSIVGQGAFATVKKAVERSTGKTFAVKIIHKRKVMDKFDGVKRELDVLQKL 245

Query: 120 NGTPNIPYAYYFGQEGLHNILVIDLLGPSLEDLFDWCGRKFSVKTVV--QVAVQMITLIE 177
           N  P I     F ++  +  ++++ +     DL D+     +V      ++  Q++  ++
Sbjct: 246 NH-PRIVKLKDFFEDNDNYYMLMEFVSGG--DLMDFVAAHGTVGEDAGREITRQVLEAVK 302

Query: 178 DLHAHDLIYRDIKPDNFLIGRPGQPDANNIHLIDFGMAKQYRDPKTKQHIPYREKKSLSG 237
            +H   + +RD+KPDN +I    Q D   I + DFG+AK  ++  T  +       +  G
Sbjct: 303 YMHDQGISHRDLKPDNIMI---EQDDPVLIKITDFGLAK-VQNQNTFLN-------TFCG 351

Query: 238 TARYMS---INTHLGREQSRRD------DMEALGHVFFYFLRGHLPWQG 277
           T  Y++   I+     +++ RD      DM ++G + +  L GHLP+ G
Sbjct: 352 TLAYVAPEVIDGKNAEDKTNRDLYSSLVDMWSIGCLVYVILTGHLPFSG 400

>YKL126W (YPK1) [3140] chr11 (205353..207395) Serine/threonine
           protein kinase involved in the cell integrity signaling
           pathway and required for endocytosis, possibly involved
           in a sphingolipid-mediated signaling pathway, has
           similarity to protein kinase C [2043 bp, 680 aa]
          Length = 680

 Score = 48.9 bits (115), Expect = 7e-06,   Method: Compositional matrix adjust.
 Identities = 35/124 (28%), Positives = 58/124 (46%), Gaps = 19/124 (15%)

Query: 169 AVQMITLIEDLHAHDLIYRDIKPDNFLIGRPGQPDANNIHLIDFGMAK--QYRDPKTKQH 226
             +++  +++LH  D++YRD+KP+N L+   G     +I L DFG+ K     D KT   
Sbjct: 451 TAELLCALDNLHKLDVVYRDLKPENILLDYQG-----HIALCDFGLCKLNMKDDDKT--- 502

Query: 227 IPYREKKSLSGTARYMSINTHLGREQSRRDDMEALGHVFFYFLRGHLPWQGLKAPNNKQK 286
                  +  GT  Y++    LG   ++  D   LG + +  L G  P+     P   + 
Sbjct: 503 ------DTFCGTPEYLAPELLLGLGYTKAVDWWTLGVLLYEMLTGLPPYYDEDVP---KM 553

Query: 287 YEKI 290
           Y+KI
Sbjct: 554 YKKI 557

>KLLA0D08415g 714473..716797 similar to sp|P22211 Saccharomyces
           cerevisiae YNL183c NPR1 ser/thr protein kinase, start by
           similarity
          Length = 774

 Score = 48.9 bits (115), Expect = 8e-06,   Method: Compositional matrix adjust.
 Identities = 38/139 (27%), Positives = 65/139 (46%), Gaps = 10/139 (7%)

Query: 151 DLFDWC-GRKFSVKTVVQVAVQMITLIEDLHAHDLIYRDIKPDNFLIGRPGQPDANNIHL 209
           DLF      K S + +     Q++T +E LH+  L +RD+K DN +I   G      + L
Sbjct: 508 DLFAIVMSNKMSYEEICCCFKQILTGVEYLHSIGLAHRDMKLDNCVINNQGI-----VKL 562

Query: 210 IDFGMAKQYRDPKTKQHIPYREKKSLSGTARYMSINTHL-GREQSRRDDMEALGHVFFYF 268
           IDFG A+ +  P +K  I   E   + G+  Y++    +  +   R  D+ ++  +F   
Sbjct: 563 IDFGAAEVFSYPHSKTLI---ESSGIVGSDPYLAPEVCIFTKYDPRPVDIWSVAILFACM 619

Query: 269 LRGHLPWQGLKAPNNKQKY 287
           +    PW+  K  +N  K+
Sbjct: 620 VLKKFPWKIPKLKDNSFKF 638

>YMR104C (YPK2) [4061] chr13 complement(473419..475452)
           Serine/threonine protein kinase with similarity to
           Ypk1p, involved in the cell integrity signaling pathway
           [2034 bp, 677 aa]
          Length = 677

 Score = 48.9 bits (115), Expect = 8e-06,   Method: Compositional matrix adjust.
 Identities = 32/123 (26%), Positives = 55/123 (44%), Gaps = 12/123 (9%)

Query: 159 KFSVKTVVQVAVQMITLIEDLHAHDLIYRDIKPDNFLIGRPGQPDANNIHLIDFGMAKQY 218
           +FS+        +++  ++ LH  D+IYRD+KP+N L+   G     +I L DFG+ K  
Sbjct: 438 RFSLARSRFYIAELLCALDSLHKLDVIYRDLKPENILLDYQG-----HIALCDFGLCKLN 492

Query: 219 RDPKTKQHIPYREKKSLSGTARYMSINTHLGREQSRRDDMEALGHVFFYFLRGHLPWQGL 278
                K         +  GT  Y++    LG+  ++  D   LG + +  + G  P+   
Sbjct: 493 MKDNDKTD-------TFCGTPEYLAPEILLGQGYTKTVDWWTLGILLYEMMTGLPPYYDE 545

Query: 279 KAP 281
             P
Sbjct: 546 NVP 548

>Scas_707.3
          Length = 1598

 Score = 48.9 bits (115), Expect = 9e-06,   Method: Compositional matrix adjust.
 Identities = 40/154 (25%), Positives = 70/154 (45%), Gaps = 12/154 (7%)

Query: 69  YKIGKKIGEGSFGVLFEGTNMINGVPVAIKFEPR-----KTEAPQLRDEYKTYKILNGTP 123
           Y I K I +G++G ++     I G   AIK   +     K +   ++ E     + +  P
Sbjct: 699 YTILKPISKGAYGSVYLARKKITGDYFAIKVLKKSDMIAKNQVTNVKSERAIMMVQSDKP 758

Query: 124 NIPYAYYFGQEGLHNILVIDLL-GPSLEDLFDWCGRKFSVKTVVQVAVQMITLIEDLHAH 182
            +   +   Q   +  LV++ L G  L  L    G     + V Q   ++I  ++D+H +
Sbjct: 759 YVARLFATFQNKENLFLVMEYLPGGDLATLIKMMGY-LPDQWVKQYLTEIIVGVDDMHRN 817

Query: 183 DLIYRDIKPDNFLIGRPGQPDANNIHLIDFGMAK 216
            +I+ D+KPDN LI   G      + L DFG+++
Sbjct: 818 WIIHHDLKPDNLLIDNLGH-----VKLTDFGLSR 846

>YNL161W (CBK1) [4436] chr14 (332597..334867) Serine/threonine
           protein kinase required for sporulation and production
           of daughter specific proteins [2271 bp, 756 aa]
          Length = 756

 Score = 48.5 bits (114), Expect = 1e-05,   Method: Compositional matrix adjust.
 Identities = 46/154 (29%), Positives = 70/154 (45%), Gaps = 17/154 (11%)

Query: 73  KKIGEGSFG----VLFEGTNMINGVPVAIKFEPRKTEAPQLRDEYKTYKILNGT--PNIP 126
           K IG+G+FG    V  + T  I  +   +K E  K +  QL        +L G+  P + 
Sbjct: 356 KVIGKGAFGEVRLVQKKDTGKIYAMKTLLKSEMYKKD--QLAHVKAERDVLAGSDSPWVV 413

Query: 127 YAYYFGQEGLHNILVIDLL--GPSLEDLFDWCGRKFSVKTVVQVAVQMITLIEDLHAHDL 184
             YY  Q+  +  L+++ L  G  +  L  W  + F+         + I  IE +H    
Sbjct: 414 SLYYSFQDAQYLYLIMEFLPGGDLMTMLIRW--QLFTEDVTRFYMAECILAIETIHKLGF 471

Query: 185 IYRDIKPDNFLIGRPGQPDANNIHLIDFGMAKQY 218
           I+RDIKPDN LI   G     +I L DFG++  +
Sbjct: 472 IHRDIKPDNILIDIRG-----HIKLSDFGLSTGF 500

>YOR231W (MKK1) [5022] chr15 (772601..774127) Serine/threonine
           protein kinase of the MAP kinase kinase (MEK) family
           involved in cell wall integrity (low-osmolarity) pathway
           [1527 bp, 508 aa]
          Length = 508

 Score = 48.5 bits (114), Expect = 1e-05,   Method: Compositional matrix adjust.
 Identities = 34/132 (25%), Positives = 57/132 (43%), Gaps = 14/132 (10%)

Query: 157 GRKFSVKTVVQVAVQMITLIEDLHAHDLIYRDIKPDNFLIGRPGQPDANNIHLIDFGMAK 216
           G + S K + ++A  ++  +  LH   +I+RDIKP N L+   GQ     + L DFG++ 
Sbjct: 318 GGRISEKVLGKIAEAVLRGLSYLHEKKVIHRDIKPQNILLNENGQ-----VKLCDFGVSG 372

Query: 217 QYRDPKTKQHIPYREKKSLSGTARYMSINTHLGREQSRRDDMEALGHVFFYFLRGHLPWQ 276
           +  +             + +GT+ YM+     G+  S   D+ +LG        G  P  
Sbjct: 373 EAVNSLA---------TTFTGTSFYMAPERIQGQPYSVTSDVWSLGLTILEVANGKFPCS 423

Query: 277 GLKAPNNKQKYE 288
             K   N   +E
Sbjct: 424 SEKMAANIAPFE 435

>Scas_683.12
          Length = 356

 Score = 48.1 bits (113), Expect = 1e-05,   Method: Compositional matrix adjust.
 Identities = 57/225 (25%), Positives = 102/225 (45%), Gaps = 35/225 (15%)

Query: 75  IGEGSFGVLFEGTNMINGVPVAIKFEPR-KTEAPQLRDEYKTYKILNGT-PNIPYAYYFG 132
           I  G+F  +++  +      VA+K  P+ K  +  + +E++  KIL  + PNI     F 
Sbjct: 9   IQTGTFSTVYKAWSSQRNEYVALKIMPKSKYSSGGMANEFEIMKILGRSHPNICSMLDFY 68

Query: 133 QEGLHNILVIDLLGPSLEDLFDWC------GRKFSVKTV----VQVAVQMITLIEDLHAH 182
           Q+  + +LV++       DL+D+       G +    T+     +V  Q+ + I   H+ 
Sbjct: 69  QDTNYYVLVLEYC--EYGDLYDFLSVAKRQGDQIHPSTIQLDFAKVLRQISSAIMYSHSL 126

Query: 183 DLIYRDIKPDNFLIGRPGQPDANNIHLIDFGMAKQYRDPKTKQ-HIP---YREKKSLSGT 238
            + +RDIKP+N L+ + G     +I L D+G A   RD  +K+ HI    YR  ++   T
Sbjct: 127 GIAHRDIKPENILLTKEG-----DIKLADWGHA--IRDSFSKESHIGTDNYRAPETFDCT 179

Query: 239 ARYMSINTHLGREQSRRDDMEALGHVFFYFLRGHLPWQGLKAPNN 283
             Y           + + D  +LG    Y + G  P++ L   ++
Sbjct: 180 IEY----------DTFKIDYWSLGVTSLYLIFGQAPFKNLTLSSD 214

>Scas_675.2
          Length = 527

 Score = 48.5 bits (114), Expect = 1e-05,   Method: Compositional matrix adjust.
 Identities = 53/217 (24%), Positives = 92/217 (42%), Gaps = 22/217 (10%)

Query: 71  IGKKIGEGSFGVLFEGTNMIN-GVPVAIKFEPRKT------EAPQLRDEYKTYKILNGTP 123
           +G  IG+GSFG +      ++  V +A+K+    T          +  E   +   +  P
Sbjct: 17  LGDTIGQGSFGCVMNAHLAVDPSVIIAVKYVHIPTCKKNGLTEKDISREVLLHSRCSKNP 76

Query: 124 NIPYAYYFGQEGLHNILVIDLLGPSLEDLFDWCGRKFSVKT-VVQVAVQ-MITLIEDLHA 181
           N+           +  +++++      DLFD       V + V Q   Q ++  I  LH 
Sbjct: 77  NVLRLIDCNIAKDYMWMIMEMADGG--DLFDKIEPDVGVDSEVAQFYFQQLVRAISYLHE 134

Query: 182 H-DLIYRDIKPDNFLIGRPGQPDANNIHLIDFGMAKQYRDPKTKQHIPYREKKSLSGTAR 240
              + +RDIKP+N L+ + G     N+ L DFG++ QYR       I   ++    G+  
Sbjct: 135 ECGVAHRDIKPENILLDKNG-----NLKLADFGLSSQYRRKDGTLRISTDQR----GSPP 185

Query: 241 YMSINT-HLGREQSRRDDMEALGHVFFYFLRGHLPWQ 276
           YM+    H     +   D+ ++G + F  L G  PW+
Sbjct: 186 YMAPEILHSRGYYAHSTDIWSIGILLFVLLTGETPWE 222

>YGL179C (TOS3) [1812] chr7 complement(163413..165095)
           Serine/threonine protein kinase with similarity to Elm1p
           and Kin82p [1683 bp, 560 aa]
          Length = 560

 Score = 48.1 bits (113), Expect = 1e-05,   Method: Compositional matrix adjust.
 Identities = 58/240 (24%), Positives = 95/240 (39%), Gaps = 40/240 (16%)

Query: 68  HYKIGKKIGEGSFGVLFEGTNMINGVPVAIK----FEPR-------KTEAPQLRDEYKTY 116
           +++I   +G G +G +    ++  G  VAIK    FE R       K E P++  E +  
Sbjct: 49  NFEILATLGNGQYGKVKLARDLGTGALVAIKILNRFEKRSGYSLQLKVENPRVNQEIEVM 108

Query: 117 KILNGTPNIP-YAYYFGQEGLHNILVIDLL--GPSLEDLFDWCGR-KFSVKTV------- 165
           K  +    +  Y      E     LV++    GP       WC   K  +K V       
Sbjct: 109 KRCHHENVVELYEILNDPESTKVYLVLEYCSRGP-----VKWCPENKMEIKAVGPSILTF 163

Query: 166 ---VQVAVQMITLIEDLHAHDLIYRDIKPDNFLIGRPGQPDANNIHLIDFGMAKQYRDPK 222
               +V + +++ +E LH+  + +RDIKP N LI   G      + + DFG+A       
Sbjct: 164 QQSRKVVLDVVSGLEYLHSQGITHRDIKPSNLLISSNG-----TVKISDFGVAMSTATGS 218

Query: 223 TKQHIPYRE--KKSLSGTARYMS---INTHLGREQSRRDDMEALGHVFFYFLRGHLPWQG 277
           T     + +  K    GT  + +    +T      S   D+ +LG   +  L G LP+  
Sbjct: 219 TNIQSSHEQLLKSRALGTPAFFAPELCSTEKEYSCSSAIDIWSLGVTIYCLLFGKLPFNA 278

>Sklu_2392.6 YNL161W, Contig c2392 12867-15293 reverse complement
          Length = 808

 Score = 48.1 bits (113), Expect = 1e-05,   Method: Compositional matrix adjust.
 Identities = 45/158 (28%), Positives = 72/158 (45%), Gaps = 17/158 (10%)

Query: 69  YKIGKKIGEGSFG----VLFEGTNMINGVPVAIKFEPRKTEAPQLRDEYKTYKILNGT-- 122
           ++  K IG+G+FG    V  + T  I  +   +K E  K +  QL        +L G+  
Sbjct: 401 FQTVKVIGKGAFGEVRLVQKKDTGKIYAMKTLLKSEMYKKD--QLAHVKAERDVLAGSDS 458

Query: 123 PNIPYAYYFGQEGLHNILVIDLL--GPSLEDLFDWCGRKFSVKTVVQVAVQMITLIEDLH 180
           P +   YY  Q+  +  L+++ L  G  +  L  W  + F+         + I  IE +H
Sbjct: 459 PWVVSLYYSFQDAQYLYLIMEFLPGGDLMTMLIRW--QIFTEDVTRFYMAECILAIEAIH 516

Query: 181 AHDLIYRDIKPDNFLIGRPGQPDANNIHLIDFGMAKQY 218
               I+RDIKPDN LI   G     ++ L DFG++  +
Sbjct: 517 KLGFIHRDIKPDNILIDIRG-----HVKLSDFGLSTGF 549

>AFR035W [3227] [Homologous to ScYNL161W (CBK1) - SH]
           complement(498529..500688) [2160 bp, 719 aa]
          Length = 719

 Score = 48.1 bits (113), Expect = 1e-05,   Method: Compositional matrix adjust.
 Identities = 46/154 (29%), Positives = 70/154 (45%), Gaps = 17/154 (11%)

Query: 73  KKIGEGSFG----VLFEGTNMINGVPVAIKFEPRKTEAPQLRDEYKTYKILNGT--PNIP 126
           K IG+G+FG    V  + T  I  +   +K E  K +  QL        +L G+  P + 
Sbjct: 314 KVIGKGAFGEVRLVQKKDTGKIYAMKTLLKSEMYKKD--QLAHVKAERDVLAGSDSPWVV 371

Query: 127 YAYYFGQEGLHNILVIDLL--GPSLEDLFDWCGRKFSVKTVVQVAVQMITLIEDLHAHDL 184
             YY  Q+  +  L+++ L  G  +  L  W  + F+         + I  IE +H    
Sbjct: 372 SLYYSFQDAQYLYLIMEFLPGGDLMTMLIRW--QIFTEDVTRFYMAECILAIEAIHKLGF 429

Query: 185 IYRDIKPDNFLIGRPGQPDANNIHLIDFGMAKQY 218
           I+RDIKPDN LI   G     +I L DFG++  +
Sbjct: 430 IHRDIKPDNILIDIRG-----HIKLSDFGLSTGF 458

>CAGL0E05720g 569028..570104 similar to sp|P38991 Saccharomyces
           cerevisiae YPL209c IPL1 ser/thr protein kinase, start by
           similarity
          Length = 358

 Score = 47.8 bits (112), Expect = 1e-05,   Method: Compositional matrix adjust.
 Identities = 54/215 (25%), Positives = 101/215 (46%), Gaps = 23/215 (10%)

Query: 69  YKIGKKIGEGSFGVLFEGTNMINGVPVAIKFEPRKTEAPQ---LRDEYKTYKILNGT--P 123
           +++G+K+G+G FG ++   +  +G   A+K    K E  Q   L+   +   I  G   P
Sbjct: 100 FEVGRKLGKGKFGKVYCVRHKKSGFICALK-AIEKNEILQFNLLKQLKREVDIQLGMDHP 158

Query: 124 NIP--YAYYFGQEGLHNILVIDLLGPSLEDLFDWCGRKFSVKTVVQVAVQMITLIEDLHA 181
           NI   YA++  ++ ++ ++   + G   + L +     F+         Q+   +  +H 
Sbjct: 159 NIIKLYAHFHDEKRVYLLMEHSINGELYKSLKN--NGPFNDVLASHYIYQIADALHYMHK 216

Query: 182 HDLIYRDIKPDNFLIGRPGQPDANNIHLIDFGMAKQYRDPKTKQHIPYREKKSLSGTARY 241
             +I+RD+KP+N LIG       N + L DFG +    +P+  +      +K+L GT  Y
Sbjct: 217 KRIIHRDVKPENVLIGF-----DNVVKLADFGWS--ILNPEGSK------RKTLCGTIDY 263

Query: 242 MSINTHLGREQSRRDDMEALGHVFFYFLRGHLPWQ 276
           +S      RE   + D+ ALG + +  + G  P++
Sbjct: 264 LSPEMITPREYDEQVDVWALGVLAYELVVGVPPFE 298

>AEL083W [2423] [Homologous to ScYBR028C - SH]
           complement(470964..472574) [1611 bp, 536 aa]
          Length = 536

 Score = 47.8 bits (112), Expect = 1e-05,   Method: Compositional matrix adjust.
 Identities = 38/135 (28%), Positives = 65/135 (48%), Gaps = 14/135 (10%)

Query: 164 TVVQVAVQMITLIEDLHAHDLIYRDIKPDNFLIGRPGQPDANNIHLIDFGMAK----QYR 219
           TV   A ++   ++ LH+  ++YRD+KP+N L+      D  ++ L DFG++K    Q  
Sbjct: 265 TVSFYAAEISCALKFLHSKGIVYRDLKPENCLLD-----DKGHLVLTDFGLSKRGVNQAD 319

Query: 220 DPKTKQHIPYREKKSLSGTARYMSINTHLGREQSRRDDMEALGHVFFYFLRGHLPWQGLK 279
            P   + +   E  S+ GT  Y +     G+  ++  D  +LG + +  L G  P+ G  
Sbjct: 320 SPLGGEQV--EELYSIIGTPEYCAPEILCGQPYTQNCDWYSLGSLTYDMLIGKPPFTG-- 375

Query: 280 APNNKQKYEKIGEKK 294
             N+K    KI + K
Sbjct: 376 -ANHKVILSKIKQDK 389

>YDL101C (DUN1) [768] chr4 complement(280307..281848) Protein kinase
           required for induction of Rnr3p and DNA repair genes
           after DNA damage [1542 bp, 513 aa]
          Length = 513

 Score = 47.8 bits (112), Expect = 1e-05,   Method: Compositional matrix adjust.
 Identities = 53/239 (22%), Positives = 103/239 (43%), Gaps = 37/239 (15%)

Query: 69  YKIGKKIGEGSFGVLFEGTNMINGVPVAIK-FEPRKTEA----PQLRDEYKTYKILNGTP 123
           Y +GK++G G + ++ E  N   G  VA+K F  ++ +      Q R+E      +   P
Sbjct: 200 YLLGKELGAGHYALVKEAKNKKTGQQVAVKIFHAQQNDDQKKNKQFREETNILMRVQH-P 258

Query: 124 NI-----PYAYYFGQEGLHNILVIDLLGPSLEDLFDWCGRKFSVKTVVQVAV--QMITLI 176
           NI      +     +  +   LV++ +     +LF+   RK  ++     A+  Q++T +
Sbjct: 259 NIVNLLDSFVEPISKSQIQKYLVLEKIDDG--ELFERIVRKTCLRQDESKALFKQLLTGL 316

Query: 177 EDLHAHDLIYRDIKPDNFLIGRPGQPDANNIHL--------------IDFGMAKQYRDPK 222
           + LH  ++I+RDIKP+N L+    + + + + L               DFG+AK   +  
Sbjct: 317 KYLHEQNIIHRDIKPENILLNITRRENPSQVQLGPWDEDEIDIQVKIADFGLAKFTGE-- 374

Query: 223 TKQHIPYREKKSLSGTARYMSINTHLGREQSRRDDMEALGHVFFYFLRGHLPWQGLKAP 281
                  +   +L GT  Y++      +  + + D+ + G + +  L G  P+     P
Sbjct: 375 ------MQFTNTLCGTPSYVAPEVLTKKGYTSKVDLWSAGVILYVCLCGFPPFSDQLGP 427

>CAGL0H10318g complement(1006299..1007222) highly similar to
           sp|P06242 Saccharomyces cerevisiae YDL108w KIN28
           cyclin-dependent ser/thr protein kinase, hypothetical
           start
          Length = 307

 Score = 47.4 bits (111), Expect = 1e-05,   Method: Compositional matrix adjust.
 Identities = 43/159 (27%), Positives = 71/159 (44%), Gaps = 12/159 (7%)

Query: 68  HYKIGKKIGEGSFGVLFEGTNMINGVPVAIKFEPRKTEAPQLRD-----EYKTYKILNGT 122
            Y   KK+GEG++ V++ GT    G  +A+K E + +E     D     E K  + +   
Sbjct: 5   EYTKEKKVGEGTYAVVYVGTKQSTGRRIAVK-EIKTSEFKDGLDMSAIREVKYLQEMQHV 63

Query: 123 PNIPYAYYFGQEGLHNILVIDLLGPSLEDLFDWCGRKFSVKTVVQVAVQMITLIEDLHAH 182
             I     F   G  N LV++ L   LE +       F+   +    +  +  +   H +
Sbjct: 64  NVIELVDIFMSYGNLN-LVLEYLPTDLEVVIKDKSILFTPADIKSWMLMSVRGVHHCHRN 122

Query: 183 DLIYRDIKPDNFLIGRPGQPDANNIHLIDFGMAKQYRDP 221
            +++RD+KP+N LI   GQ     I + DFG+A+    P
Sbjct: 123 FILHRDLKPNNLLIAPDGQ-----IKVADFGLARAVPSP 156

>CAGL0M10153g complement(1010688..1013291) some similarities with
           sp|Q03497 Saccharomyces cerevisiae YHL007c ser/thr
           protein kinase of the pheromone pathway, hypothetical
           start
          Length = 867

 Score = 48.1 bits (113), Expect = 2e-05,   Method: Compositional matrix adjust.
 Identities = 36/142 (25%), Positives = 66/142 (46%), Gaps = 15/142 (10%)

Query: 135 GLHNILVIDLL-GPSLEDLFDWCGRKFSVKTVVQVAVQMITLIEDLHAHDLIYRDIKPDN 193
           GL   +V++ + G  L D+  +C    +   +  V  +++  +E LH+  +++RDIK DN
Sbjct: 634 GLDLWVVMEYMEGGCLTDVVTYCV--LTEGQIGAVCREVLQGLEFLHSKGVLHRDIKSDN 691

Query: 194 FLIGRPGQPDANNIHLIDFGMAKQYRDPKTKQHIPYREKKSLSGTARYMSINTHLGREQS 253
            L+   G     +I L DFG   Q  D   K       + ++ GT  +M+      +E  
Sbjct: 692 VLLSMNG-----DIKLTDFGFCAQVNDTVIK-------RTTMVGTPYWMAPEIVSRKEYG 739

Query: 254 RRDDMEALGHVFFYFLRGHLPW 275
            + D+ +LG +    + G  P+
Sbjct: 740 PKVDIWSLGIMIIEMIEGEPPY 761

>Kwal_33.14554
          Length = 714

 Score = 47.8 bits (112), Expect = 2e-05,   Method: Compositional matrix adjust.
 Identities = 46/158 (29%), Positives = 72/158 (45%), Gaps = 17/158 (10%)

Query: 69  YKIGKKIGEGSFG----VLFEGTNMINGVPVAIKFEPRKTEAPQLRDEYKTYKILNGT-- 122
           ++  K IG+G+FG    V  + T  I  +   +K E  K +  QL        +L G+  
Sbjct: 303 FQTVKVIGKGAFGEVRLVQKKDTGKIYAMKTLLKSEMYKKD--QLAHVKAERDVLAGSDS 360

Query: 123 PNIPYAYYFGQEGLHNILVIDLL--GPSLEDLFDWCGRKFSVKTVVQVAVQMITLIEDLH 180
           P +   YY  Q+  +  L+++ L  G  +  L  W  + F+         + I  IE +H
Sbjct: 361 PWVVSLYYSFQDTQYLYLIMEFLPGGDLMTMLIRW--QIFTEDVTRFYMAECILAIEAIH 418

Query: 181 AHDLIYRDIKPDNFLIGRPGQPDANNIHLIDFGMAKQY 218
               I+RDIKPDN LI   G     +I L DFG++  +
Sbjct: 419 KLGFIHRDIKPDNILIDIRG-----HIKLSDFGLSTGF 451

>KLLA0E14828g complement(1323743..1324675)
           gi|27526973|emb|CAD36964.1 Kluyveromyces lactis
           serine/threonine-protein kinase KIN28, start by
           similarity
          Length = 310

 Score = 47.0 bits (110), Expect = 2e-05,   Method: Compositional matrix adjust.
 Identities = 48/188 (25%), Positives = 79/188 (42%), Gaps = 23/188 (12%)

Query: 69  YKIGKKIGEGSFGVLFEGTNMINGVPVAIKFEPRKTEAPQLRD--------EYKTYKILN 120
           Y   KK GEG++ V++ GT    G  +A+K    + +  Q +D        E K  + L 
Sbjct: 10  YTKEKKAGEGTYAVVYLGTKKSTGRSIAVK----EIKTSQFKDGLDMSALREVKFLQELK 65

Query: 121 GTPNIPYAYYFGQEGLHNILVIDLLGPSLEDLFDWCGRKFSVKTVVQVAVQMITLIEDLH 180
               I     F      N LV++ L   LE +       FS   +    +  +  +   H
Sbjct: 66  HVNVIELVDVFMANDNLN-LVLEFLPADLEIIIKDTSIMFSPADIKSWILMTLRGVHHCH 124

Query: 181 AHDLIYRDIKPDNFLIGRPGQPDANNIHLIDFGMAKQYRDPK---TKQHIP--YREKKSL 235
            + +++RD+KP+N L+   GQ     + + DFG+A+    P+   T   +   YR  + L
Sbjct: 125 RNFILHRDLKPNNLLLAPDGQ-----LKIADFGLARLMASPQEILTSNVVTRWYRAPELL 179

Query: 236 SGTARYMS 243
            G   Y S
Sbjct: 180 FGAKHYTS 187

>KLLA0A05819g 541545..543659 similar to sp|P14680 Saccharomyces
           cerevisiae YJL141c YAK1 ser/thr protein kinase, start by
           similarity
          Length = 704

 Score = 47.8 bits (112), Expect = 2e-05,   Method: Compositional matrix adjust.
 Identities = 49/184 (26%), Positives = 84/184 (45%), Gaps = 28/184 (15%)

Query: 69  YKIGKKIGEGSFGVLFEGTNMINGVPVAIKFEPRKTE-APQLRDEYKTYKILNGT--PNI 125
           Y +   +G+G+FG + +  N+I    +A+K    K+E   Q   E K  ++LN    PN 
Sbjct: 332 YLVLDLLGQGTFGQVVKCQNLITKEILAVKVVKSKSEYLNQSVTEAKVLELLNRQIDPNN 391

Query: 126 PYAYYFGQEGL----HNILVIDLLGPSLEDLF---DWCGRKFSVKTVVQVAVQMITLIED 178
            + +    +      H  LV +LL  +L +L    ++ G   S+  +   + Q++  +  
Sbjct: 392 EHHFLRLHDTFVHKHHLCLVFELLSNNLYELLKLNEFHG--LSMTLIKTFSKQLLDSLCV 449

Query: 179 LHAHDLIYRDIKPDNFLIGRPGQPDANNIHLIDFGMAKQ-------------YRDPKTKQ 225
           L    LI+ D+KP+N L+    +PD   + +IDFG A +             YR P+   
Sbjct: 450 LKDSKLIHCDLKPENILLVSNDRPD---LKVIDFGSACEETRTIYTYIQSRFYRAPEVLL 506

Query: 226 HIPY 229
            IPY
Sbjct: 507 GIPY 510

>CAGL0B02739g complement(262590..264620) similar to sp|P23561
           Saccharomyces cerevisiae YLR362w STE11 ser/thr protein
           kinase of the MEKK family, hypothetical start
          Length = 676

 Score = 47.8 bits (112), Expect = 2e-05,   Method: Compositional matrix adjust.
 Identities = 60/235 (25%), Positives = 94/235 (40%), Gaps = 41/235 (17%)

Query: 72  GKKIGEGSFGVLFEGTNMINGVPVAIK--------------------FEPRKTEAPQ--- 108
           G +IG GSFG ++ G N   G  +A+K                     E    +AP    
Sbjct: 392 GARIGSGSFGTVYLGMNAQTGELMAVKQVEIKPAIAATADANVEDKNAEKNVAKAPSTNL 451

Query: 109 -------LRDEYKTYKILNGTPNIPYAYYFGQEGLH-NILVIDLLGPSLEDLFDWCGRKF 160
                  L+ E    K L    NI   Y   QEG + NI +  + G S+  +    G  F
Sbjct: 452 HRKMIDALQHEMSLLKELQH-ENIVTYYGSSQEGGNLNIFLEYVPGGSVSSMLSNYG-PF 509

Query: 161 SVKTVVQVAVQMITLIEDLHAHDLIYRDIKPDNFLIGRPGQPDANNIHLIDFGMAKQYRD 220
               +V    Q++  +  LH  ++I+RDIK  N LI   G      + + DFG++K+   
Sbjct: 510 EEPLIVNFTRQILIGVAYLHRKNIIHRDIKGANILIDIKG-----CVKITDFGISKKL-S 563

Query: 221 PKTKQHIPYREKKSLSGTARYMSINTHLGREQSRRDDMEALGHVFFYFLRGHLPW 275
           P  +++   R   SL G+  +MS         + + D+ + G V      G  P+
Sbjct: 564 PLNQENQDKR--TSLQGSVYWMSPEVVKQTATTSKADIWSTGCVVIEMFTGKHPY 616

>YDL214C (PRR2) [660] chr4 complement(74447..76546) Serine/threonine
           protein kinase potentially involved in pheromone
           response [2100 bp, 699 aa]
          Length = 699

 Score = 47.4 bits (111), Expect = 2e-05,   Method: Compositional matrix adjust.
 Identities = 36/128 (28%), Positives = 59/128 (46%), Gaps = 10/128 (7%)

Query: 151 DLFDWC-GRKFSVKTVVQVAVQMITLIEDLHAHDLIYRDIKPDNFLIGRPGQPDANNIHL 209
           DLF      K   + +  +  Q+I  ++ LH   L +RD+K DN ++ R G      + L
Sbjct: 446 DLFSLVMSEKMHYEEICCLFKQLINGVKYLHDIGLSHRDLKLDNCVVTRRGI-----LKL 500

Query: 210 IDFGMAKQYRDPKTKQHIPYREKKSLSGTARYMSINTHLGREQS-RRDDMEALGHVFFYF 268
           IDFG +  +  P + Q I   E   + G+  Y+S       E   R  D+ ++G +FF  
Sbjct: 501 IDFGASSVFHYPLSSQMI---EANGIVGSDPYLSPEVFYFNEYDPRALDVWSVGIIFFCM 557

Query: 269 LRGHLPWQ 276
           +    PW+
Sbjct: 558 ITRRFPWK 565

>Scas_648.17
          Length = 340

 Score = 47.0 bits (110), Expect = 2e-05,   Method: Compositional matrix adjust.
 Identities = 40/152 (26%), Positives = 71/152 (46%), Gaps = 10/152 (6%)

Query: 69  YKIGKKIGEGSFGVLFEGTNMINGVPVAIK-FEPRKTEAPQLRDEYKTYKILNGTPNIPY 127
           Y+I  KIG G +  +F G  + N  P  IK  +P K +  ++  E K    L G PN+  
Sbjct: 50  YEIITKIGRGKYSEVFSGECVNNETPCVIKVLKPVKMK--KIYRELKILTNLTGGPNVIE 107

Query: 128 AYYFGQEGLHNILVIDLLGPSLEDL-FDWCGRKFSVKTVVQVAVQMITLIEDLHAHDLIY 186
                Q+    I    L+   ++++ F      F++  +     Q++  +   H+  +++
Sbjct: 108 LLDIVQDPGSKIPA--LIFEEVKNMDFRQLYPTFTLPDIQFYFTQLLIALNYCHSMGIMH 165

Query: 187 RDIKPDNFLIGRPGQPDANNIHLIDFGMAKQY 218
           RD+KP N +I     P    + LID+G+A+ Y
Sbjct: 166 RDVKPQNVMI----DPKERKLRLIDWGLAEFY 193

>Kwal_55.21709
          Length = 340

 Score = 47.0 bits (110), Expect = 2e-05,   Method: Compositional matrix adjust.
 Identities = 40/152 (26%), Positives = 69/152 (45%), Gaps = 8/152 (5%)

Query: 68  HYKIGKKIGEGSFGVLFEGTNMINGVPVAIKFEPRKTEAPQLRDEYKTYKILNGTPNIPY 127
           HY+I  KIG G +  +F G  ++N     IK           R E K    L G PN+  
Sbjct: 49  HYEIVNKIGRGKYSEVFRGKCVVNDEYCVIKVLKPVKLKKIYR-ELKILTNLTGGPNVIA 107

Query: 128 AYYFGQEGLHNILVIDLLGPSLEDL-FDWCGRKFSVKTVVQVAVQMITLIEDLHAHDLIY 186
                Q+    I    L+   ++++ F     KF++  +     Q++  ++  H+  +++
Sbjct: 108 LLDIVQDSGSKIPA--LIFEEVKNVDFRTLYLKFTLPDIQYYFSQLLIALDYCHSMGIMH 165

Query: 187 RDIKPDNFLIGRPGQPDANNIHLIDFGMAKQY 218
           RD+KP N +I     P    + LID+G+A+ Y
Sbjct: 166 RDVKPQNVMI----DPVERKLRLIDWGLAEFY 193

>CAGL0M02519g complement(290723..292993) highly similar to tr|Q03002
           Saccharomyces cerevisiae YPL141c or sp|Q01919
           Saccharomyces cerevisiae YOR233w KIN4, hypothetical
           start
          Length = 756

 Score = 47.4 bits (111), Expect = 2e-05,   Method: Compositional matrix adjust.
 Identities = 56/237 (23%), Positives = 96/237 (40%), Gaps = 45/237 (18%)

Query: 69  YKIGKKIGEGSFGVL--------------FEGTN----MINGVP--VAIKFEPRKTEAPQ 108
           Y IG  +GEG FG +               EG      M   VP  VAIK   R      
Sbjct: 48  YVIGATLGEGEFGKVKLAWSKSAYQQCDNTEGNAGNKPMTFKVPKQVAIKLIKRDFITKD 107

Query: 109 LRDEYKTYKILNGTPNIPYAYYFG-QEGLHNILVIDLLGPSLE-----DLFDWCGRKFSV 162
              E K Y+ +N   ++ +      +E L N   I ++   LE     + + +  RK  +
Sbjct: 108 PSKETKIYREINALKHLSHPNIVKLEEVLQNSKYIGIV---LEYAAGGEFYKFIQRKRRL 164

Query: 163 KT--VVQVAVQMITLIEDLHAHDLIYRDIKPDNFLIGRPGQPDANNIHLIDFGMAKQYRD 220
           K     ++  Q+I+ +  +H+  L++RD+K +N L+      +  N+ + DFG   ++  
Sbjct: 165 KENHACRLFSQLISAVHYIHSKGLVHRDLKLENLLLD-----NEENLIITDFGFVNEFLR 219

Query: 221 PKTKQHIPYREKKSLSGTARYMSINTHLGRE--QSRRDDMEALGHVFFYFLRGHLPW 275
                       K+  G+  Y +    +      +R+ D  + G + F  L G+LPW
Sbjct: 220 QNGMM-------KTSCGSPCYAAPELVVSNRPYDARKADTWSCGIILFAMLAGYLPW 269

>Kwal_55.20326
          Length = 750

 Score = 47.4 bits (111), Expect = 2e-05,   Method: Compositional matrix adjust.
 Identities = 58/240 (24%), Positives = 98/240 (40%), Gaps = 46/240 (19%)

Query: 72  GKKIGEGSFGVLFEGTNMINGVPVAIK---FEPRKTEAPQLR--DEYKTY--KILNGTP- 123
           G +IG GSFG ++ G N   G  +A+K    +P    A  +   DE K    +  NG+  
Sbjct: 461 GARIGSGSFGSVYLGMNAQTGELMAVKQVELQPTAVAAGVVSVPDEVKKQYNQNANGSAV 520

Query: 124 ---------------------------NIPYAYYFGQEGLH-NILVIDLLGPSLEDLFDW 155
                                      NI   Y   QEG + NI +  + G S+  + + 
Sbjct: 521 KNSSQVHRKMVDALQHEMGLLKELQHENIVTYYGSSQEGGNLNIFLEYVPGGSVSSMLNS 580

Query: 156 CGRKFSVKTVVQVAVQMITLIEDLHAHDLIYRDIKPDNFLIGRPGQPDANNIHLIDFGMA 215
            G  F    +     Q++  +  LH  D+I+RDIK  N LI   G      + + DFG++
Sbjct: 581 YG-PFEEPLIRNFTRQILIGLSYLHRKDIIHRDIKGANILIDIKG-----CVKITDFGIS 634

Query: 216 KQYRDPKTKQHIPYREKKSLSGTARYMSINTHLGREQSRRDDMEALGHVFFYFLRGHLPW 275
           K+      +Q+    ++ SL G+  +M+         +++ D+ ++G V      G  P+
Sbjct: 635 KKLSPLNQQQN----KRASLQGSVYWMAPEVVKQVVTTKKADIWSVGCVIIEMFTGKHPF 690

>ACR117W [1164] [Homologous to ScYOR231W (MKK1) - SH; ScYPL140C
           (MKK2) - SH] complement(557738..559312) [1575 bp, 524
           aa]
          Length = 524

 Score = 47.0 bits (110), Expect = 2e-05,   Method: Compositional matrix adjust.
 Identities = 32/127 (25%), Positives = 56/127 (44%), Gaps = 14/127 (11%)

Query: 157 GRKFSVKTVVQVAVQMITLIEDLHAHDLIYRDIKPDNFLIGRPGQPDANNIHLIDFGMAK 216
           G +   K + ++A  ++  +  LH   +I+RDIKP N L+   GQ     + L DFG++ 
Sbjct: 333 GGRVGEKVLGKIAESVLRGLSYLHQRKIIHRDIKPQNILLNEAGQ-----VKLCDFGVSG 387

Query: 217 QYRDPKTKQHIPYREKKSLSGTARYMSINTHLGREQSRRDDMEALGHVFFYFLRGHLPWQ 276
           +  +             + +GT+ YM+     G+  S   D+ +LG       + H P+ 
Sbjct: 388 EAVNSLA---------TTFTGTSYYMAPERIQGQPYSVTSDVWSLGLTLLEVAQAHFPFD 438

Query: 277 GLKAPNN 283
             K   N
Sbjct: 439 SGKFAAN 445

>YDL159W (STE7) [712] chr4 (172482..174029)
           Serine/threonine/tyrosine protein kinase of MAP kinase
           kinase (MAPKK or MEK) family, component of pheromone
           response, filamentous growth, and STE vegetative growth
           pathways [1548 bp, 515 aa]
          Length = 515

 Score = 47.0 bits (110), Expect = 3e-05,   Method: Compositional matrix adjust.
 Identities = 34/119 (28%), Positives = 57/119 (47%), Gaps = 15/119 (12%)

Query: 160 FSVKTVVQVAVQMITLIEDLH-AHDLIYRDIKPDNFLIGRPGQPDANNIHLIDFGMAKQY 218
           F+  T+ ++A  ++  ++ L+  + +I+RDIKP N LI   GQ     I L DFG++K+ 
Sbjct: 302 FNELTISKIAYGVLNGLDHLYRQYKIIHRDIKPSNVLINSKGQ-----IKLCDFGVSKKL 356

Query: 219 RDPKTKQHIPYREKKSLSGTARYMSINTHLGREQSRRDDMEALGHVFFYFLRGHLPWQG 277
            +      +         GT+ YMS     G   S + D+ +LG +    + G  P  G
Sbjct: 357 INSIADTFV---------GTSTYMSPERIQGNVYSIKGDVWSLGLMIIELVTGEFPLGG 406

>AEL120W [2386] [Homologous to ScYKL171W - SH]
           complement(396394..398715) [2322 bp, 773 aa]
          Length = 773

 Score = 47.4 bits (111), Expect = 3e-05,   Method: Compositional matrix adjust.
 Identities = 39/182 (21%), Positives = 84/182 (46%), Gaps = 26/182 (14%)

Query: 65  VGLHYKIGKKIGEGSFGVLFEGTNMINGVPVA--------------IKFEPRKTEAPQLR 110
           + L +++GK IG G++G++ +  ++     ++              ++F+  +       
Sbjct: 357 IVLGHRLGKIIGFGAWGMIRDCYDVKQSFVISPSESQPPASHAMKIVRFKNNQKVKEHAL 416

Query: 111 DEYKTYKILNGTPNI----------PYAYYFGQEGLHNILVIDLLGPSLEDLFDWCGRKF 160
            E   +K L+  PNI           YA Y+  E + +  + DL+    E          
Sbjct: 417 REIAIWKKLH-HPNILELINWKQEEDYAAYYLTEKIQDGTLYDLVSTWGESDGSTIPLDQ 475

Query: 161 SVKTVVQVAVQMITLIEDLHAHDLIYRDIKPDNFLIGRPGQPDANNIHLIDFGMAKQYRD 220
             K  + +A+Q+I+ ++ +H+  +++ D+K +N L+ + G   +  ++L DFGM+ QY  
Sbjct: 476 RCKLTIALALQLISALKYMHSKYIVHADVKLENCLLEKTGS-QSWKLYLCDFGMSCQYGK 534

Query: 221 PK 222
           P+
Sbjct: 535 PR 536

>Scas_698.37
          Length = 347

 Score = 46.6 bits (109), Expect = 3e-05,   Method: Compositional matrix adjust.
 Identities = 40/154 (25%), Positives = 70/154 (45%), Gaps = 14/154 (9%)

Query: 69  YKIGKKIGEGSFGVLFEGTNMINGVPVAIK-FEPRKTEAPQLRDEYKTYKILNGTPNIPY 127
           Y+I  KIG G +  +F G +++N V   IK  +P K    ++  E K    L G PNI  
Sbjct: 58  YEIINKIGRGKYSEVFRGKHILNDVSCVIKVLKPVKLR--KIHRELKILWNLTGGPNIVE 115

Query: 128 ---AYYFGQEGLHNILVIDLLGPSLEDLFDWCGRKFSVKTVVQVAVQMITLIEDLHAHDL 184
                +  +  +   +  D+      +L+      F +  V     Q++  +   H+  +
Sbjct: 116 LLDVVHDEKTRVPAFIFEDVKNVDFRELYP----TFKLSDVQYYFKQLLIALNYAHSMGI 171

Query: 185 IYRDIKPDNFLIGRPGQPDANNIHLIDFGMAKQY 218
           ++RD+KP N +I     P    + LID+G+A+ Y
Sbjct: 172 MHRDVKPQNVMI----DPVQRKLRLIDWGLAEFY 201

>Kwal_33.14434
          Length = 759

 Score = 47.0 bits (110), Expect = 3e-05,   Method: Compositional matrix adjust.
 Identities = 36/138 (26%), Positives = 64/138 (46%), Gaps = 10/138 (7%)

Query: 151 DLFDWC-GRKFSVKTVVQVAVQMITLIEDLHAHDLIYRDIKPDNFLIGRPGQPDANNIHL 209
           DLF      K S + +     Q++T ++ LH+  L +RD+K DN +I + G      + L
Sbjct: 489 DLFAIVMSNKMSYEEICCCFKQILTGVQYLHSMGLAHRDLKLDNCVINKHGV-----VKL 543

Query: 210 IDFGMAKQYRDPKTKQHIPYREKKSLSGTARYMSINTHL-GREQSRRDDMEALGHVFFYF 268
           IDFG A  +  P +K  +   E   + G+  Y++    +  +   R  D+ ++  +F   
Sbjct: 544 IDFGAAAVFSYPFSKTLV---ESSGIVGSDPYLAPEVCIFSKYDPRPVDVWSVAIIFACM 600

Query: 269 LRGHLPWQGLKAPNNKQK 286
           +    PW+  K  +N  K
Sbjct: 601 VLKKFPWKIPKLKDNSFK 618

>CAGL0K02673g complement(240509..243256) similar to sp|Q03497
           Saccharomyces cerevisiae YHL007c STE20
           Serine/threonine-protein kinase, hypothetical start
          Length = 915

 Score = 47.0 bits (110), Expect = 3e-05,   Method: Compositional matrix adjust.
 Identities = 34/130 (26%), Positives = 58/130 (44%), Gaps = 14/130 (10%)

Query: 146 GPSLEDLFDWCGRKFSVKTVVQVAVQMITLIEDLHAHDLIYRDIKPDNFLIGRPGQPDAN 205
           G SL D+   C    S   +  V  + +  ++ LH+  +++RDIK DN L+   G     
Sbjct: 699 GGSLTDVVTHC--LLSEGQIGAVCRETLKGLQFLHSKGVLHRDIKSDNILLSLKG----- 751

Query: 206 NIHLIDFGMAKQYRDPKTKQHIPYREKKSLSGTARYMSINTHLGREQSRRDDMEALGHVF 265
           NI L DFG   Q  +   K       + ++ GT  +M+      +E   + D+ +LG + 
Sbjct: 752 NIKLTDFGFCAQINENNLK-------RTTMVGTPYWMAPEVVSRKEYGPKVDIWSLGIMI 804

Query: 266 FYFLRGHLPW 275
              + G  P+
Sbjct: 805 IEMIEGEPPY 814

>KLLA0E12177g 1080245..1081612 gi|4096112|gb|AAC99804.1
           Kluyveromyces lactis CTD kinase largest subunit,
           hypothetical start
          Length = 455

 Score = 46.6 bits (109), Expect = 3e-05,   Method: Compositional matrix adjust.
 Identities = 45/164 (27%), Positives = 74/164 (45%), Gaps = 35/164 (21%)

Query: 74  KIGEGSFGVLFEGTNMINGVPVAIKFEPRKTEAPQLRD--------EYKTYKILNGTPNI 125
           ++GEG++G +++  N+  G  +A+K    +    Q RD        E K  + LN  PNI
Sbjct: 134 QVGEGTYGKVYKAENVHTGKLIALK----RLRLEQERDGFPITSIREIKLLQQLN-HPNI 188

Query: 126 PYAYYFGQEGLHNILVIDLLGPSLEDLF---DWCGR------KFSVKTVVQVAVQMITLI 176
                     +H I+V D    S+   +   D  G       +FS   +  +  Q+   +
Sbjct: 189 SL--------IHEIIVSDKNTISMGFQYMENDLSGMLMDKSIQFSDSNIKHLMKQLFVGL 240

Query: 177 EDLHAHDLIYRDIKPDNFLIGRPGQPDANNIHLIDFGMAKQYRD 220
           + LH   +++RDIK  N LI   G     N+ + DFG+AK+  D
Sbjct: 241 QYLHQQQIVHRDIKGSNLLIDNRG-----NLKITDFGLAKKLTD 279

>Kwal_26.7861
          Length = 955

 Score = 47.0 bits (110), Expect = 3e-05,   Method: Compositional matrix adjust.
 Identities = 49/212 (23%), Positives = 91/212 (42%), Gaps = 22/212 (10%)

Query: 69  YKIGKKIGEGSFGVLFEGTNMINGVPVAIK-----FEPRKTEAPQLRDEYKTYKILNGTP 123
           YK   KIG+G+ G ++    +     VAIK      +P+K     + +E    K      
Sbjct: 667 YKNLIKIGQGASGGVYTAYEVGTNASVAIKQMNLEKQPKKE---LIINEILVMKASKHAN 723

Query: 124 NIPYAYYFGQEGLHNILVIDLLGPSLEDLFDWCGRKFSVKTVVQVAVQMITLIEDLHAHD 183
            + +   +   G   +++  + G SL D+   C    +   +  V+ + +  ++ LH+  
Sbjct: 724 IVNFIDSYLLRGDLWVVMEYMEGGSLTDVVTHC--ILTEGQIGAVSRETLKGLQFLHSKG 781

Query: 184 LIYRDIKPDNFLIGRPGQPDANNIHLIDFGMAKQYRDPKTKQHIPYREKKSLSGTARYMS 243
           +I+RDIK DN L+   G+     I L DFG   Q  +   K       + ++ GT  +M+
Sbjct: 782 VIHRDIKSDNVLLSMSGE-----IKLTDFGFCAQINEINLK-------RTTMVGTPYWMA 829

Query: 244 INTHLGREQSRRDDMEALGHVFFYFLRGHLPW 275
                 +E   + D+ +LG +    + G  P+
Sbjct: 830 PEVVSRKEYGPKVDIWSLGIMIIEMIEGEPPY 861

>ACR133C [1180] [Homologous to ScYPL150W - SH] (581468..584023)
           [2556 bp, 851 aa]
          Length = 851

 Score = 47.0 bits (110), Expect = 4e-05,   Method: Compositional matrix adjust.
 Identities = 55/225 (24%), Positives = 100/225 (44%), Gaps = 49/225 (21%)

Query: 68  HYKIGKKIGEGSFGVLFEGTNMINGVPVAIK-------------FEPRKTEAPQLRDEYK 114
           +Y+I K++GEGSFG ++  T+ +    V +K             F  R+ E P +    K
Sbjct: 36  NYRIVKQVGEGSFGKVYLATHKLTHQKVVLKTGAKSDPNVVREVFYHRQFEYPFI---TK 92

Query: 115 TYKILNGTPNIPYA--YYFGQEGLHNILVIDLLGPSLEDLFDWCGRKFSVKTVVQVAVQM 172
            Y+++     +  A  Y  G E L++ L++    P      D   R F+         Q+
Sbjct: 93  LYEVIVTETRVWMALEYCPGNE-LYDYLLLKQRIP-----LDETRRLFA---------QI 137

Query: 173 ITLIEDLHAHDLIYRDIKPDNFLIGRPGQPDANNIHLIDFGMAKQYRDPKTKQHIPYREK 232
           ++ +   H+   ++RD+K +N L+ + G        L DFG     R+  TK  +     
Sbjct: 138 VSAVFYAHSLQCVHRDLKLENILLDKNGYA-----MLTDFGFT---RECATKTQL----- 184

Query: 233 KSLSGTARYMSINTHLGREQ--SRRDDMEALGHVFFYFLRGHLPW 275
           +++ GT  YM+    + RE     + D  +LG + +  L G++P+
Sbjct: 185 ETVCGTTVYMAPEL-IKREAYDGYKVDTWSLGIILYTMLHGYMPF 228

>CAGL0M02299g 273725..276406 similar to tr|Q12152 Saccharomyces
           cerevisiae YPL150w, start by similarity
          Length = 893

 Score = 47.0 bits (110), Expect = 4e-05,   Method: Compositional matrix adjust.
 Identities = 57/224 (25%), Positives = 97/224 (43%), Gaps = 47/224 (20%)

Query: 68  HYKIGKKIGEGSFGVLFEGTNMINGVPVAIK-------------FEPRKTEAPQLRDEYK 114
           +YKI K+IGEGSFG ++  T+      V +K             F  R+ + P +    K
Sbjct: 41  NYKIQKQIGEGSFGKVYLATHRPTKQKVVLKTGDKSDPNVVREVFYHRQFDYPYI---TK 97

Query: 115 TYKILNGTPNIPYA--YYFGQEGLHNILVIDLLGPSLEDLFDWCGRKFSVKTVVQVAVQM 172
            Y+++     +  A  Y  G+E   ++L    L P+LE     C   F+         Q+
Sbjct: 98  LYEVIVTETKVWMALEYCPGKELYDHLLSKSRL-PTLE-----CAELFA---------QI 142

Query: 173 ITLIEDLHAHDLIYRDIKPDNFLIGRPGQPDANNIHLIDFGMAKQYRDPKTKQHIPYREK 232
              +   H  + ++RD+K +N L+ + G     N  L DFG     R+  TK  +     
Sbjct: 143 TGAVHYAHTLNCVHRDLKLENVLLDKNG-----NAKLTDFGFT---RESMTKAVL----- 189

Query: 233 KSLSGTARYMSINTHLGRE-QSRRDDMEALGHVFFYFLRGHLPW 275
           +++ GT  YM+      +     + D+ +LG + +  L G LP+
Sbjct: 190 ETVCGTTVYMAPEMIQHKPYDGFKVDIWSLGVILYTLLCGCLPF 233

>Sklu_1995.2 YLR362W, Contig c1995 1578-3767
          Length = 729

 Score = 46.6 bits (109), Expect = 4e-05,   Method: Compositional matrix adjust.
 Identities = 58/241 (24%), Positives = 97/241 (40%), Gaps = 47/241 (19%)

Query: 72  GKKIGEGSFGVLFEGTNMINGVPVAIK---FEPRKTEAPQLRDEYKTYK----ILNGTP- 123
           G +IG GSFG ++ G N   G  +A+K    +P    A  +    +T K    + NGT  
Sbjct: 439 GARIGSGSFGSVYLGMNAQTGELMAVKQVELQPSAVTAGVMPASEETKKQQIQVANGTAA 498

Query: 124 ----------------------------NIPYAYYFGQEGLH-NILVIDLLGPSLEDLFD 154
                                       NI   Y   QEG + NI +  + G S+  + +
Sbjct: 499 AKNTSQIHKKMIDALQHEMNLLKELHHENIVTYYGSSQEGGNLNIFLEYVPGGSVSSMLN 558

Query: 155 WCGRKFSVKTVVQVAVQMITLIEDLHAHDLIYRDIKPDNFLIGRPGQPDANNIHLIDFGM 214
             G  F    +     Q++  +  LH  ++I+RDIK  N LI   G      + + DFG+
Sbjct: 559 NYG-PFEEPLIKNFTRQILIGLAYLHRKNIIHRDIKGANVLIDIKG-----CVKITDFGI 612

Query: 215 AKQYRDPKTKQHIPYREKKSLSGTARYMSINTHLGREQSRRDDMEALGHVFFYFLRGHLP 274
           +K+   P  KQ     ++ SL G+  +M+         + + D+ ++G +      G  P
Sbjct: 613 SKKL-SPLNKQQ---NKRASLQGSVYWMAPEVVKQVVTTEKADIWSVGCLVVEMFTGKHP 668

Query: 275 W 275
           +
Sbjct: 669 F 669

>YMR139W (RIM11) [4096] chr13 (546124..547236) Member of the GSK3
           subfamily of protein kinases, required for induction of
           IME2 by Ime1p [1113 bp, 370 aa]
          Length = 370

 Score = 46.2 bits (108), Expect = 4e-05,   Method: Compositional matrix adjust.
 Identities = 41/164 (25%), Positives = 77/164 (46%), Gaps = 16/164 (9%)

Query: 65  VGLHYKIGKKIGEGSFGVLFEGTNMINGVPVAIKFEPRKTEAPQLRD-EYKTYKILNGTP 123
           V + +   + +G GSFGV+F          VAIK   +  +  + ++ E +  K+L+   
Sbjct: 35  VQISFPTTEVVGHGSFGVVFATVIQETNEKVAIK---KVLQDKRFKNRELEIMKMLSHIN 91

Query: 124 NIPYAYYF----GQEGLHNILVIDLLGPSLEDLFDWCGRKFSVKTVVQVAVQMITLIEDL 179
            I   Y+F     Q+ ++  L+++ +  SL         + +  + +++   M  L + L
Sbjct: 92  IIDLKYFFYERDSQDEIYLNLILEYMPQSLYQRLRHFVHQRTPMSRLEIKYYMFQLFKSL 151

Query: 180 ----HAHDLIYRDIKPDNFLIGRPGQPDANNIHLIDFGMAKQYR 219
               H  ++ +RDIKP N L+     P+  ++ L DFG AKQ +
Sbjct: 152 NYLHHFANVCHRDIKPQNLLVD----PETWSLKLCDFGSAKQLK 191

>YPL140C (MKK2) [5306] chr16 complement(287513..289033) MAP kinase
           kinase (MEK) serine/threonine protein kinase, involved
           in cell wall integrity (low-osmolarity) pathway [1521
           bp, 506 aa]
          Length = 506

 Score = 46.6 bits (109), Expect = 4e-05,   Method: Compositional matrix adjust.
 Identities = 32/127 (25%), Positives = 57/127 (44%), Gaps = 14/127 (11%)

Query: 157 GRKFSVKTVVQVAVQMITLIEDLHAHDLIYRDIKPDNFLIGRPGQPDANNIHLIDFGMAK 216
           G + S + + ++A  ++  +  LH   +I+RDIKP N L+   G+     I L DFG++ 
Sbjct: 311 GGRISERVIGKIAESVLRGLSYLHERKVIHRDIKPQNILLNEKGE-----IKLCDFGVSG 365

Query: 217 QYRDPKTKQHIPYREKKSLSGTARYMSINTHLGREQSRRDDMEALGHVFFYFLRGHLPWQ 276
           +  +             + +GT+ YM+     G+  S   D+ +LG        G  P++
Sbjct: 366 EAVNSLA---------MTFTGTSFYMAPERIQGQPYSVTCDVWSLGLTLLEVAGGRFPFE 416

Query: 277 GLKAPNN 283
             K   N
Sbjct: 417 SDKITQN 423

>YBR160W (CDC28) [345] chr2 (560034..560930) Cyclin-dependent
           protein kinase essential for completion of START and for
           mitosis, associates with Cks1p and cyclins [897 bp, 298
           aa]
          Length = 298

 Score = 45.8 bits (107), Expect = 4e-05,   Method: Compositional matrix adjust.
 Identities = 52/210 (24%), Positives = 91/210 (43%), Gaps = 26/210 (12%)

Query: 68  HYKIGKKIGEGSFGVLF--------EGTNMINGVPVAIKFEPRKTEAPQLRDEYKTYKIL 119
           +YK  +K+GEG++GV++        +G  ++    + ++ E     +  +R E    K L
Sbjct: 7   NYKRLEKVGEGTYGVVYKALDLRPGQGQRVVALKKIRLESEDEGVPSTAIR-EISLLKEL 65

Query: 120 NGTPNIPYAYYFGQEGLHNI-LVIDLLGPSLEDLFDWCGRK--FSVKTVVQVAVQMITLI 176
               NI   Y       H + LV + L   L+   +   +        V +  +Q+   I
Sbjct: 66  KDD-NIVRLYDIVHSDAHKLYLVFEFLDLDLKRYMEGIPKDQPLGADIVKKFMMQLCKGI 124

Query: 177 EDLHAHDLIYRDIKPDNFLIGRPGQPDANNIHLIDFGMAKQYRDPKTKQHIPYREKKSLS 236
              H+H +++RD+KP N LI + G     N+ L DFG+A+ +        +P R      
Sbjct: 125 AYCHSHRILHRDLKPQNLLINKDG-----NLKLGDFGLARAF-------GVPLRAYTHEI 172

Query: 237 GTARYMSINTHLGREQ-SRRDDMEALGHVF 265
            T  Y +    LG +Q S   D  ++G +F
Sbjct: 173 VTLWYRAPEVLLGGKQYSTGVDTWSIGCIF 202

>CAGL0F03245g complement(316924..320034) similar to sp|P32361
           Saccharomyces cerevisiae YHR079c IRE1, hypothetical
           start
          Length = 1036

 Score = 47.0 bits (110), Expect = 4e-05,   Method: Compositional matrix adjust.
 Identities = 59/250 (23%), Positives = 104/250 (41%), Gaps = 67/250 (26%)

Query: 73  KKIGEGSFG-VLFEGTNMINGVPVAIKFEPRKTEAPQLRDEY-----KTYKILNGT---P 123
           K +G GS G V++EG           KF+ R     ++  ++     K  ++L+ +   P
Sbjct: 605 KVLGYGSSGTVVYEG-----------KFQERSVAVKRMLVDFYDIASKEIELLSESDEHP 653

Query: 124 NIPYAYYFGQEGLHNILVIDLLGPSLEDLFDWCG-----RKFSVKTVVQVAVQMITLIED 178
           N+   Y   +      + ++L   +LE L +        ++     +V +  Q+   I  
Sbjct: 654 NVVRYYCSEETSKFLYIALELCDSNLEQLIETNNVMRHEQRLKDYELVDILAQITQGIAY 713

Query: 179 LHAHDLIYRDIKPDNFLIG-------RPGQPDANN---IHLIDFGMAKQ--YRDPKTKQH 226
           LH+ ++I+RDIKP N LI        +P   + NN   I L DFG+ K+  +     K +
Sbjct: 714 LHSLNIIHRDIKPQNILISKSKKRLQKPTTGNGNNKTRIMLSDFGLCKKLDFEQSSFKTN 773

Query: 227 IPYREKKSLSGTARYMS-------------------------INTHLGREQSRRDDMEAL 261
           I     K+ +GT  +M+                          + +L R  ++  D+ +L
Sbjct: 774 I-----KNAAGTVGWMAPELLIEDENSNKISVSQEIEKIDEVYDPYLRRRLTKAIDIFSL 828

Query: 262 GHVFFYFLRG 271
           G VF+Y L G
Sbjct: 829 GCVFYYVLSG 838

>Scas_667.18
          Length = 437

 Score = 46.2 bits (108), Expect = 4e-05,   Method: Compositional matrix adjust.
 Identities = 42/170 (24%), Positives = 80/170 (47%), Gaps = 38/170 (22%)

Query: 69  YKIGKKIGEGSFGVL---FEGTNMINGVPVAIKFEPRKTEAPQ----LRDEYKTYKILNG 121
           YKI K +G+GS+GV+    +  N  N  PVAIK   + T   Q    L+   +  K +N 
Sbjct: 78  YKIIKVLGKGSYGVVCSAMDNKNPANAYPVAIK---KVTNIFQKEILLKRAIRELKFMN- 133

Query: 122 TPNIPYAYYFGQEGLHNILVIDLLGP--------SLEDLFDW-------CGRKFSVKTVV 166
                  ++ G + + N++ ++++            ++L D+          K +   + 
Sbjct: 134 -------FFQGHKNIVNLIDLEIINENSPYDGLYCYQELIDYDLAKVIHSSIKLTEFHIQ 186

Query: 167 QVAVQMITLIEDLHAHDLIYRDIKPDNFLIGRPGQPDANNIHLIDFGMAK 216
               Q+++ ++ +H+ D+I+RD+KP N L    G     N+ + DFG+A+
Sbjct: 187 YFMYQILSGLKYIHSADVIHRDLKPGNILCTLNG-----NLKICDFGLAR 231

>Kwal_14.2497
          Length = 418

 Score = 46.2 bits (108), Expect = 5e-05,   Method: Compositional matrix adjust.
 Identities = 33/123 (26%), Positives = 58/123 (47%), Gaps = 12/123 (9%)

Query: 171 QMITLIEDLHAH-DLIYRDIKPDNFLIGRPGQPDANNIHLIDFGMAKQYRDPKTKQHIPY 229
           Q+I  I+ LH    + +RDIKP+N L+   G     N+ L DFG+A Q++     + I  
Sbjct: 30  QLINAIDHLHNRCGVAHRDIKPENLLLDERG-----NLKLADFGLASQFKRKDGSKRIMS 84

Query: 230 REKKSLSGTARYMSINTHLGREQSRRDDMEALGHVFFYFLRGHLPWQGLKAPNNKQKYEK 289
             + SL   A  +  +     + +   D+ + G + F  L G  PW    +P++  +++ 
Sbjct: 85  DTRGSLPYMAPEIVYSKSYYADST---DIWSCGVLVFVLLTGETPWD---SPSDDSRFDD 138

Query: 290 IGE 292
             E
Sbjct: 139 FLE 141

>YOR351C (MEK1) [5128] chr15 complement(995013..996506)
           Serine/threonine protein kinase required for meiotic
           recombination [1494 bp, 497 aa]
          Length = 497

 Score = 46.2 bits (108), Expect = 5e-05,   Method: Compositional matrix adjust.
 Identities = 49/200 (24%), Positives = 84/200 (42%), Gaps = 26/200 (13%)

Query: 123 PNIPYAYY-FGQEGLHNILVIDLLGPSLEDLFDW-----CGRKFSVKTVVQVAVQMITLI 176
           PNI   Y+ F     H  +  DL+     DLF +     C    S    + +  Q++  +
Sbjct: 221 PNIIKVYHTFCDRNNHLYIFQDLIPGG--DLFSYLAKGDCLTSMSETESLLIVFQILQAL 278

Query: 177 EDLHAHDLIYRDIKPDNFLIGRPGQPDANNIHLIDFGMAKQYRDPKTKQH---------- 226
             LH  D+++RD+K DN L+  P +P    I L DFG+AK     K + H          
Sbjct: 279 NYLHDQDIVHRDLKLDNILLCTP-EP-CTRIVLADFGIAKDLNSNKERMHTVVGTPEYCA 336

Query: 227 --IPYR-EKKSLSGTARYMSINTHLGREQSRRDDMEALGHVFFYFLRGHLPWQGLKAPNN 283
             + +R  +K+    +R  ++     R    + D+ +LG +    L G  P+ G  +  +
Sbjct: 337 PEVGFRANRKAYQSFSRAATLEQ---RGYDSKCDLWSLGVITHIMLTGISPFYGDGSERS 393

Query: 284 KQKYEKIGEKKRSTNVYDLA 303
             +  KIG+       +D+ 
Sbjct: 394 IIQNAKIGKLNFKLKQWDIV 413

>Scas_668.22
          Length = 893

 Score = 46.2 bits (108), Expect = 5e-05,   Method: Compositional matrix adjust.
 Identities = 47/205 (22%), Positives = 93/205 (45%), Gaps = 18/205 (8%)

Query: 74  KIGEGSFGVLFEGTNMINGVPVAIKFEPRKTEAPQLRDEYKTYKILNGT--PNIP-YAYY 130
           KIG+G+ G ++    + +   VAIK +    + P+         ++ G+  PNI  +   
Sbjct: 616 KIGQGASGGVYIANEIGSNESVAIK-QMNLEKQPKKELIINEILVMKGSRHPNIVNFIDS 674

Query: 131 FGQEGLHNILVIDLLGPSLEDLFDWCGRKFSVKTVVQVAVQMITLIEDLHAHDLIYRDIK 190
           +  +G   +++  + G SL D+   C    +   +  V  + ++ ++ LH+  +++RDIK
Sbjct: 675 YLLDGDLWVIMEYMEGGSLTDVVTHC--ILTEGQIGAVCRETLSGLQFLHSKGVLHRDIK 732

Query: 191 PDNFLIGRPGQPDANNIHLIDFGMAKQYRDPKTKQHIPYREKKSLSGTARYMSINTHLGR 250
            DN L+   G     +I L DFG   Q  +   K       + ++ GT  +M+      +
Sbjct: 733 SDNILLSISG-----DIKLTDFGFCAQINEINLK-------RTTMVGTPYWMAPEVVSRK 780

Query: 251 EQSRRDDMEALGHVFFYFLRGHLPW 275
           E   + D+ +LG +    + G  P+
Sbjct: 781 EYGPKVDIWSLGIMIIEMIEGEPPY 805

>Scas_623.11
          Length = 378

 Score = 45.8 bits (107), Expect = 5e-05,   Method: Compositional matrix adjust.
 Identities = 43/165 (26%), Positives = 79/165 (47%), Gaps = 18/165 (10%)

Query: 65  VGLHYKIGKKIGEGSFGVLFEGTNMINGVPVAIK--FEPRKTEAPQLRDEYKTYKILNGT 122
           + + +   + IG+GSFG++F  T       VAIK   + R+ +  +L    +  K++   
Sbjct: 43  ITITFPTTEIIGKGSFGLVFCTTIRETDEVVAIKKVLQDRRFKNREL----EIMKLIQHP 98

Query: 123 PNIPYAYYFGQEGLHNI----LVIDLLGPSLEDLFDWCGRKFSVKTVVQVAVQMITLIED 178
             I   YYF ++ + +     L++D +  SL         +    + +++   M  L + 
Sbjct: 99  NVINLKYYFYEKDVDDEVYLNLILDYMPQSLYQRLRHFVHQRQSMSRLEIKFYMFQLFKS 158

Query: 179 LH----AHDLIYRDIKPDNFLIGRPGQPDANNIHLIDFGMAKQYR 219
           L+    A ++ +RDIKP N L+     P++ N+ L DFG AKQ +
Sbjct: 159 LNYLHNAKNVCHRDIKPQNILVD----PNSWNLKLCDFGSAKQLK 199

>KLLA0D07304g 623352..624749 some similarities with sp|P32491
           Saccharomyces cerevisiae YPL140c MKK2 protein kinase of
           the map kinase kinase (MEK) family, hypothetical start
          Length = 465

 Score = 45.8 bits (107), Expect = 5e-05,   Method: Compositional matrix adjust.
 Identities = 34/127 (26%), Positives = 56/127 (44%), Gaps = 14/127 (11%)

Query: 157 GRKFSVKTVVQVAVQMITLIEDLHAHDLIYRDIKPDNFLIGRPGQPDANNIHLIDFGMAK 216
           G +   K + ++A  ++  +  LH   +I+RDIKP N L    GQ     I L DFG++ 
Sbjct: 275 GGRIGEKVLGKIAESVLRGLFYLHERKIIHRDIKPQNILFNEIGQ-----IKLCDFGVSG 329

Query: 217 QYRDPKTKQHIPYREKKSLSGTARYMSINTHLGREQSRRDDMEALGHVFFYFLRGHLPWQ 276
           +  +             + +GT+ YM+     G+  S   D+ +LG       +GH P+ 
Sbjct: 330 EAVNSLA---------TTFTGTSYYMAPERIQGQPYSVTSDVWSLGLTLLEVAQGHSPFD 380

Query: 277 GLKAPNN 283
             K   N
Sbjct: 381 TDKLAAN 387

>Scas_654.12
          Length = 737

 Score = 46.2 bits (108), Expect = 6e-05,   Method: Compositional matrix adjust.
 Identities = 46/154 (29%), Positives = 69/154 (44%), Gaps = 17/154 (11%)

Query: 73  KKIGEGSFG----VLFEGTNMINGVPVAIKFEPRKTEAPQLRDEYKTYKILNGT--PNIP 126
           K IG+G+FG    V    T  I  +   +K E  K +  QL        +L G+  P + 
Sbjct: 323 KVIGKGAFGEVRLVQKIDTGKIYAMKTLLKSEMYKKD--QLAHVKAERDVLAGSDSPWVV 380

Query: 127 YAYYFGQEGLHNILVIDLL--GPSLEDLFDWCGRKFSVKTVVQVAVQMITLIEDLHAHDL 184
             YY  Q+  +  L+++ L  G  +  L  W  + F+         + I  IE +H    
Sbjct: 381 SLYYSFQDTQYLYLIMEFLPGGDLMTMLIRW--QLFTEDVTRFYMAECILAIETIHKLGF 438

Query: 185 IYRDIKPDNFLIGRPGQPDANNIHLIDFGMAKQY 218
           I+RDIKPDN LI   G     +I L DFG++  +
Sbjct: 439 IHRDIKPDNILIDIRG-----HIKLSDFGLSTGF 467

>ACL104C [945] [Homologous to ScYHR102W (KIC1) - SH]
           (157357..160200) [2844 bp, 947 aa]
          Length = 947

 Score = 46.2 bits (108), Expect = 6e-05,   Method: Compositional matrix adjust.
 Identities = 53/219 (24%), Positives = 96/219 (43%), Gaps = 23/219 (10%)

Query: 69  YKIGKKIGEGSFGVLFEG----TNMINGVPVAIKFEPRKTEAPQLRDEYKTYKILNGTPN 124
           +K  + IG G FGV+++     T  +  V V +  +  + E   ++ E +    L   PN
Sbjct: 25  FKRTEVIGRGKFGVVYKAYHAKTKQVYAVKV-LNLDCPEDEVEDVQKEIQFLASLKQVPN 83

Query: 125 IP--YAYYFGQEGLHNILVIDLLGPSLEDLFDWCGRKFSVKTVVQVAVQMITLIEDLHAH 182
           I   Y  Y     L  I+     G SL  L      K   K +  +  +++  +  +H  
Sbjct: 84  ITRYYGSYLYDTKLWVIMEY-CAGGSLRTLLR--PGKIDEKYLGVIVRKLLIALVYIHKD 140

Query: 183 DLIYRDIKPDNFLIGRPGQPDANNIHLIDFGMAKQYRDPKTKQHIPYREKKSLSGTARYM 242
           ++I+RDIK  N LI   G     ++ L DFG+A Q      K       +++++GT  +M
Sbjct: 141 NVIHRDIKAANVLITNEG-----HVKLCDFGVAAQLTAANHK-------RQTMAGTPYWM 188

Query: 243 SINTHL-GREQSRRDDMEALGHVFFYFLRGHLPWQGLKA 280
           +    + G   + + D+ +LG   +    G+ P+  ++A
Sbjct: 189 APEVIMEGVYYNTKADIWSLGITAYEIATGNPPYCDVEA 227

>YFL033C (RIM15) [1651] chr6 complement(69113..74425)
           Serine/threonine protein kinase, positive regulator of
           IME2 expression and of sporulation [5313 bp, 1770 aa]
          Length = 1770

 Score = 46.2 bits (108), Expect = 6e-05,   Method: Compositional matrix adjust.
 Identities = 42/178 (23%), Positives = 79/178 (44%), Gaps = 17/178 (9%)

Query: 69  YKIGKKIGEGSFGVLFEGTNMINGVPVAIKFEPR-----KTEAPQLRDEYKTYKILNGTP 123
           Y I K I +G++G ++     + G   AIK   +     K +   ++ E     + +  P
Sbjct: 794 YDILKPISKGAYGSVYLARKKLTGDYFAIKVLRKSDMIAKNQVTNVKSERAIMMVQSDKP 853

Query: 124 NIPYAYYFGQEGLHNILVIDLL-GPSLEDLFDWCGRKFSVKTVVQVAVQMITLIEDLHAH 182
            +   +   Q   +  LV++ L G  L  L    G     +   Q   +++  + D+H +
Sbjct: 854 YVARLFASFQNKDNLFLVMEYLPGGDLATLIKMMGY-LPDQWAKQYLTEIVVGVNDMHQN 912

Query: 183 DLIYRDIKPDNFLIGRPGQPDANNIHLIDFGMAKQYRDPKTKQH--IPYREKKSLSGT 238
            +I+ D+KP+N LI   G      + L DFG++   R    ++H  +P++   S+S T
Sbjct: 913 GIIHHDLKPENLLIDNAGH-----VKLTDFGLS---RAGLIRRHKFVPHKSSLSISST 962

>KLLA0B13112g complement(1146006..1148198) similar to sp|P23561
           Saccharomyces cerevisiae YLR362w STE11 ser/thr protein
           kinase of the MEKK family, start by similarity
          Length = 730

 Score = 45.8 bits (107), Expect = 6e-05,   Method: Compositional matrix adjust.
 Identities = 60/241 (24%), Positives = 97/241 (40%), Gaps = 48/241 (19%)

Query: 72  GKKIGEGSFGVLFEGTNMINGVPVAIKF-----------------EPRKTEAP------- 107
           G +IG GSFG ++ G N   G  +A+K                  E +K  +P       
Sbjct: 442 GARIGSGSFGSVYLGMNAETGELMAVKQVELKPTAVTAGVVSIADESKKAHSPGGGNTAV 501

Query: 108 ------------QLRDEYKTYKILNGTPNIPYAYYFGQEGLH-NILVIDLLGPSLEDLFD 154
                        L+ E    K L+   NI   Y   QEG + NI +  + G S+  + +
Sbjct: 502 KNTSQIHRKMIDALQHEMNILKELHH-ENIVTYYGSSQEGGNLNIFLEYVPGGSVSSMLN 560

Query: 155 WCGRKFSVKTVVQVAVQMITLIEDLHAHDLIYRDIKPDNFLIGRPGQPDANNIHLIDFGM 214
             G  F    V     Q++  +  LH  ++I+RDIK  N LI   G      + + DFG+
Sbjct: 561 NYG-PFDEPLVKNFTRQILIGLAYLHKRNIIHRDIKGANILIDIKG-----GVKITDFGI 614

Query: 215 AKQYRDPKTKQHIPYREKKSLSGTARYMSINTHLGREQSRRDDMEALGHVFFYFLRGHLP 274
           +K+   P  KQ     ++ SL G+  +M+         + + D+ ++G V      G  P
Sbjct: 615 SKKL-SPLNKQQ---NKRASLQGSVYWMAPEVVKQVVTTEKADIWSVGCVIVEMFTGKHP 670

Query: 275 W 275
           +
Sbjct: 671 F 671

>ACR119W [1166] [Homologous to ScYPL141C - SH; ScYOR233W (KIN4) -
           SH] complement(560761..563556) [2796 bp, 931 aa]
          Length = 931

 Score = 46.2 bits (108), Expect = 7e-05,   Method: Compositional matrix adjust.
 Identities = 54/222 (24%), Positives = 96/222 (43%), Gaps = 32/222 (14%)

Query: 69  YKIGKKIGEGSFGVLFEGTNMI----NGVPVAIKFEPRKTEAPQLRDEYKTYKILNGT-- 122
           Y IG  +GEG FG +  G +      +   VAIK   R T       E K Y+ LN    
Sbjct: 45  YIIGPTLGEGEFGKVKLGWSKARLDGDSRNVAIKLIRRDTVPKNSEKEIKIYRELNALKL 104

Query: 123 ---PNIPYAYYFGQEGLHN--ILVIDLLGPSLEDLFDWCGRKFSVKT--VVQVAVQMITL 175
              PNI       +E L N   + I L   S  + + +  +K  +K     ++  Q+I+ 
Sbjct: 105 LSHPNI----VRLEEVLQNSKYIGIVLQYASGGEFYKYIQKKRRLKEPPACRLFAQLISG 160

Query: 176 IEDLHAHDLIYRDIKPDNFLIGRPGQPDANNIHLIDFGMAKQYRDPKTKQHIPYREKKSL 235
           +  +H   L +RD+K +N L+      +  N+ + DFG   ++     K  +     ++ 
Sbjct: 161 VHYIHYKGLAHRDLKLENLLLD-----EHENLIITDFGFVNEFH----KNDL----MRTS 207

Query: 236 SGTARYMSINTHLGRE--QSRRDDMEALGHVFFYFLRGHLPW 275
            G+  Y +    +  +   +++ D+ + G + +  L G+LPW
Sbjct: 208 CGSPCYAAPELVVSSKPYSAQKADVWSCGVILYAMLAGYLPW 249

>Sklu_2366.5 YBR274W, Contig c2366 12866-14266 reverse complement
          Length = 466

 Score = 45.8 bits (107), Expect = 7e-05,   Method: Compositional matrix adjust.
 Identities = 31/108 (28%), Positives = 52/108 (48%), Gaps = 11/108 (10%)

Query: 171 QMITLIEDLH-AHDLIYRDIKPDNFLIGRPGQPDANNIHLIDFGMAKQYRDPKTKQHIPY 229
           Q++  I  LH    + +RDIKP+N L+ + G     N+ L DFG+A Q+R     + +  
Sbjct: 68  QLLRAIHHLHEVCGIAHRDIKPENILLDKNG-----NLKLADFGLASQFRRKDGTKRLAR 122

Query: 230 REKKSLSGTARYMSINTHLGRE-QSRRDDMEALGHVFFYFLRGHLPWQ 276
            ++    G+  YM+       E  +   D+ + G + F  L G  PW+
Sbjct: 123 DQR----GSPPYMAPEIIYSSEYYADTTDIWSCGILVFVLLTGETPWE 166

>ADL315C [1426] [Homologous to ScYPR054W (SMK1) - SH]
           (146098..147402) [1305 bp, 434 aa]
          Length = 434

 Score = 45.4 bits (106), Expect = 8e-05,   Method: Compositional matrix adjust.
 Identities = 47/231 (20%), Positives = 102/231 (44%), Gaps = 55/231 (23%)

Query: 68  HYKIGKKIGEGSFGVLFEGTNMING---VPVAIKFEPRKTEAPQLRDEYKTYKILN-GTP 123
           HY++ + +G+GS+G +    + +N    + +AIK         ++ + ++   +L     
Sbjct: 72  HYEVLQMLGKGSYGTVVSAIDNLNANYPIRIAIK---------KITNIFQREVLLKRAIR 122

Query: 124 NIPYAYYF-GQEGLHNILVIDLLGP-------SLEDLFDW-------CGRKFSVKTVVQV 168
            + + +YF G + + +++ ++++           ++L D+          +FS   +   
Sbjct: 123 ELKFMHYFKGHKNIVSLINLEIVNEKPYDGLYCYQELIDYDLARVIHSNVQFSEFHIKHF 182

Query: 169 AVQMITLIEDLHAHDLIYRDIKPDNFLIGRPGQPDANNIHLIDFGMAK----QYRDPKTK 224
             Q++  ++ +H+ D+I+RD+KP N L    GQ     + + DFG+A+     + + KT 
Sbjct: 183 TYQILCGVKYIHSADVIHRDLKPGNILCSISGQ-----LKICDFGLARGISPLFTNTKTS 237

Query: 225 QHIP-------YREKKSLSGTARYMSINTHLGREQSRRDDMEALGHVFFYF 268
            HI        YR  + +    RY           ++  DM A+G +   F
Sbjct: 238 NHITNYVATRWYRAPELILSHKRY-----------NKSIDMWAIGCILAEF 277

>KLLA0D07810g complement(669095..671251)
           gi|401646|sp|P31034|YL44_KLULA Kluyveromyces lactis
           Hypothetical 31.8 kDa protein in L44/L41 3 region, start
           by similarity
          Length = 718

 Score = 45.8 bits (107), Expect = 8e-05,   Method: Compositional matrix adjust.
 Identities = 45/151 (29%), Positives = 68/151 (45%), Gaps = 17/151 (11%)

Query: 73  KKIGEGSFG----VLFEGTNMINGVPVAIKFEPRKTEAPQLRDEYKTYKILNGT--PNIP 126
           K IG+G+FG    V  + T  I  +   +K E    +  QL        +L G+  P + 
Sbjct: 307 KVIGKGAFGEVRLVQKKDTGKIYAMKTLLKSEMYNKD--QLAHVKAERDVLAGSDSPWVV 364

Query: 127 YAYYFGQEGLHNILVIDLL--GPSLEDLFDWCGRKFSVKTVVQVAVQMITLIEDLHAHDL 184
             YY  Q+  +  L+++ L  G  +  L  W  + F+         + I  IE +H    
Sbjct: 365 SLYYSFQDSQYLYLIMEFLPGGDLMTMLIRW--QIFTEDVTRFYMAECILAIEVIHKLGF 422

Query: 185 IYRDIKPDNFLIGRPGQPDANNIHLIDFGMA 215
           I+RDIKPDN LI   G     +I L DFG++
Sbjct: 423 IHRDIKPDNILIDIRG-----HIKLSDFGLS 448

>KLLA0D07348g 626999..629728 weakly similar to sgd|S0006062
           Saccharomyces cerevisiae YPL141c, start by similarity
          Length = 909

 Score = 45.8 bits (107), Expect = 8e-05,   Method: Compositional matrix adjust.
 Identities = 51/217 (23%), Positives = 91/217 (41%), Gaps = 26/217 (11%)

Query: 69  YKIGKKIGEGSFGVLFEG---TNMINGVPVAIKFEPRKTEAPQLRDEYKTYKILNGTPNI 125
           Y IG  +GEG FG +  G   +N      VAIK   R T       E K Y+ +N   ++
Sbjct: 56  YIIGPTLGEGEFGKVKLGWSKSNSDESKNVAIKLIRRDTIPKNSEKEVKIYREINALKHL 115

Query: 126 PYAYYFG-QEGLHNILVIDLLG--PSLEDLFDWCGRKFSVK--TVVQVAVQMITLIEDLH 180
            +      +E L N   I ++    S  + + +  +K  +K     ++  Q+I+ +  +H
Sbjct: 116 AHPNIVTLEEVLQNSKYIGIVLHYASGGEFYKYIQKKRRLKEPAACRLFAQLISGVHYMH 175

Query: 181 AHDLIYRDIKPDNFLIGRPGQPDANNIHLIDFGMAKQYRDP----KTKQHIPYREKKSLS 236
              L +RD+K +N L+      +  N+ + DFG   ++       KT    P      L 
Sbjct: 176 HKGLAHRDLKLENLLLD-----EHENLIITDFGFVNEFSSRNDLMKTSCGSPCYAAPELV 230

Query: 237 GTARYMSINTHLGREQSRRDDMEALGHVFFYFLRGHL 273
            T +           ++R+ D+ + G + +  L G+L
Sbjct: 231 VTTKAY---------EARKADVWSCGVILYAMLAGYL 258

>Scas_640.16
          Length = 505

 Score = 45.4 bits (106), Expect = 9e-05,   Method: Compositional matrix adjust.
 Identities = 34/133 (25%), Positives = 60/133 (45%), Gaps = 17/133 (12%)

Query: 146 GPSLEDLFDWC---GRKFSVKTVVQVAVQMITLIEDLHAHDLIYRDIKPDNFLIGRPGQP 202
           G SLE ++      G + S K + +++  ++  +  LH   +I+RDIKP N L    GQ 
Sbjct: 293 GKSLEAVYKNLLSRGGRISEKVLGKISESVLRGLSYLHEQKVIHRDIKPQNILFNEKGQ- 351

Query: 203 DANNIHLIDFGMAKQYRDPKTKQHIPYREKKSLSGTARYMSINTHLGREQSRRDDMEALG 262
               + L DFG++ +  +             + +GT+ YM+     G+  S   D+ +LG
Sbjct: 352 ----VKLCDFGVSGEAVNSLA---------TTFTGTSFYMAPERIQGQPYSVTCDIWSLG 398

Query: 263 HVFFYFLRGHLPW 275
                  +G  P+
Sbjct: 399 LTILEVAQGRFPF 411

>Kwal_23.6458
          Length = 868

 Score = 45.8 bits (107), Expect = 9e-05,   Method: Compositional matrix adjust.
 Identities = 34/123 (27%), Positives = 53/123 (43%), Gaps = 19/123 (15%)

Query: 169 AVQMITLIEDLHAHDLIYRDIKPDNFLIGRPGQPDANNIHLIDFGMAKQYRDPK------ 222
           + +++  IE LH    IYRD+KP+N L+ + G     +I L DF ++ Q +D K      
Sbjct: 570 SSEVVAAIEYLHLMGFIYRDLKPENILLHKSG-----HIMLSDFDLSVQAKDTKNPVVKG 624

Query: 223 --------TKQHIPYREKKSLSGTARYMSINTHLGREQSRRDDMEALGHVFFYFLRGHLP 274
                   TK         S  GT  Y++     G   +   D   LG + +  L G  P
Sbjct: 625 SAQSSLLDTKICSDGFRTNSFVGTEEYIAPEVIRGNGHTAAVDWWTLGILIYEMLFGFTP 684

Query: 275 WQG 277
           ++G
Sbjct: 685 YKG 687

>Kwal_14.1416
          Length = 365

 Score = 45.1 bits (105), Expect = 9e-05,   Method: Compositional matrix adjust.
 Identities = 38/156 (24%), Positives = 70/156 (44%), Gaps = 13/156 (8%)

Query: 69  YKIGKKIGEGSFGVLFEGTNMINGVPVAIK-FEPRKTEAPQLRD--EYKTYKILNGTPNI 125
           Y++ + +GEG++G +    +  +G  VAIK  +P   E    R   E K  K+ +   NI
Sbjct: 13  YQLVELVGEGAYGTVCSAVHKPSGTKVAIKKIQPFSKEMFVTRTLRELKLLKLFHSHENI 72

Query: 126 PYAYYF----GQEGLHNI-LVIDLLGPSLEDLFDWCGRKFSVKTVVQVAVQMITLIEDLH 180
                       +    + LV +L+   L  +    G   S   +     Q++  ++ +H
Sbjct: 73  ISVLDVVRPTSMDKFQAVYLVQELMETDLHKVISSGGASLSDDHIQYFTYQILRALKAIH 132

Query: 181 AHDLIYRDIKPDNFLIGRPGQPDANNIHLIDFGMAK 216
           +  +I+RDIKP N L+         ++ + DFG+A+
Sbjct: 133 SAQVIHRDIKPSNLLLN-----SNCDLKVCDFGLAR 163

>Sklu_2417.13 YMR139W, Contig c2417 24824-25915 reverse complement
          Length = 363

 Score = 45.1 bits (105), Expect = 9e-05,   Method: Compositional matrix adjust.
 Identities = 44/165 (26%), Positives = 74/165 (44%), Gaps = 17/165 (10%)

Query: 65  VGLHYKIGKKIGEGSFGVLFEGTNMINGVPVAIKFEPRKTEAPQLRD-EYKTYKILNGTP 123
           + + Y   + +G GSFGV+F  T       VAIK   +  +  + ++ E +  K+L+   
Sbjct: 28  INISYPATEVVGHGSFGVVFTTTICETDQVVAIK---KVLQDKRFKNRELEIMKLLSHPQ 84

Query: 124 NIPYAYYFGQ-----EGLHNILVIDLLGPSLEDLFDWCGRKFSVKTVVQVAVQMITLIED 178
            I   YYF +       ++  LV++ +  SL           S    ++V + M  L + 
Sbjct: 85  IIGLKYYFYETDSTTSDVYLNLVLEYMPSSLYQRLRHFVTHRSNMPAIEVKLYMYQLFKS 144

Query: 179 LH----AHDLIYRDIKPDNFLIGRPGQPDANNIHLIDFGMAKQYR 219
           L+       + +RDIKP N L+     P   ++ L DFG AKQ +
Sbjct: 145 LNYLHTCARVCHRDIKPQNLLVD----PTTFSLKLCDFGSAKQLK 185

>KLLA0F01276g complement(120001..121560) similar to sp|P38147
           Saccharomyces cerevisiae YBR274w CHK1 regulats
           inhibitory Cdk phosphorylation of PDS1, start by
           similarity
          Length = 519

 Score = 45.4 bits (106), Expect = 1e-04,   Method: Compositional matrix adjust.
 Identities = 51/215 (23%), Positives = 90/215 (41%), Gaps = 16/215 (7%)

Query: 70  KIGKKIGEGSFGVLFEGTNMIN-GVPVAIKF---EPRKTEAPQLRDEYKTYKILNGTPNI 125
           ++G+ IG+GSF  +   +  ++    +A+KF      + +     D  +  K+ +   N 
Sbjct: 16  QLGRTIGKGSFAFVKRASLEVDPSTVIAVKFIHLPSCEKQGMSQEDVLREVKLHSRCSNF 75

Query: 126 PYAYYFGQEGLHN-ILVIDLLGPSLEDLFDWCGRKFSVKTVVQVAV--QMITLIEDLH-A 181
                     L +  L I +      DLFD       V + V      Q+I  I  LH  
Sbjct: 76  VNVLKVIDCNLSDPFLWIAMELAEGGDLFDKIEPDIGVDSEVAQFYYKQLIKAISYLHDT 135

Query: 182 HDLIYRDIKPDNFLIGRPGQPDANNIHLIDFGMAKQYRDPKTKQHIPYREKKSLSGTARY 241
             + +RDIKP+N L+ + G     N+ L DFG+A  ++     + I   ++ SL   A  
Sbjct: 136 CGVAHRDIKPENILLDKDG-----NLKLADFGLASLFKRKDGSKRISRDQRGSLPYMAPE 190

Query: 242 MSINTHLGREQSRRDDMEALGHVFFYFLRGHLPWQ 276
           +    +     +   D+ ++G + F  L G  PW+
Sbjct: 191 I---IYCDGYYADMTDIWSIGVLLFVLLTGETPWE 222

>Sklu_2186.4 YHR030C, Contig c2186 5713-7278 reverse complement
          Length = 521

 Score = 45.4 bits (106), Expect = 1e-04,   Method: Compositional matrix adjust.
 Identities = 42/165 (25%), Positives = 75/165 (45%), Gaps = 20/165 (12%)

Query: 69  YKIGKKIGEGSFGVLFEG--TNMINGVPVAIK-----FEPRKTEAPQLRDEYKTYKILNG 121
           +++ K+IG G++G++     T  +    VAIK     F         LR E K  +   G
Sbjct: 23  FQLIKEIGHGAYGIVCSARFTEAVEETTVAIKKVTNVFSKTLLCKRSLR-ELKLLRHFRG 81

Query: 122 TPNIPYAY----YFGQEGLHNILVI--DLLGPSLEDLFDWCGRKFSVKTVVQVAVQMITL 175
             NI   Y     FG +G  N L +  +L+   +  +    G+  S         Q++  
Sbjct: 82  HKNITCLYDMDIVFGIDGSFNGLYLYEELMECDMHQIIK-SGQPLSDAHYQSFIYQILCG 140

Query: 176 IEDLHAHDLIYRDIKPDNFLIGRPGQPDANNIHLIDFGMAKQYRD 220
           ++ +H+ D+++RD+KP N L+    Q     + + DFG+A+ Y +
Sbjct: 141 LKYIHSADVLHRDLKPGNLLVNADCQ-----LKICDFGLARGYSE 180

>ABL143C [449] [Homologous to ScYNL183C (NPR1) - SH; ScYDL214C
           (PRR2) - SH] (128217..130394) [2178 bp, 725 aa]
          Length = 725

 Score = 45.4 bits (106), Expect = 1e-04,   Method: Compositional matrix adjust.
 Identities = 50/223 (22%), Positives = 94/223 (42%), Gaps = 21/223 (9%)

Query: 68  HYKIGKKIGEGSFGVLFEGTNMINGVPVAIK-FEPRKTEAPQLRDEYKTYKILNGTPNIP 126
           + + G+K+G G+ G +     + + V  A+K F P K E    RD  K          I 
Sbjct: 389 YSRTGEKLGAGAGGSVKLVRRLKDNVVFAVKEFRP-KHENETKRDYIK---------KIT 438

Query: 127 YAYYFGQEGLHNILVIDLLGPSLEDLFDWC-GRKFSVKTVVQVAVQMITLIEDLHAHDLI 185
             Y  G    H+ +++ ++     DLF      + S + +     Q++  I  LH+  L 
Sbjct: 439 SEYCIGSTLRHSNIILQVMEYCDYDLFAIVMSNRMSYEEICCCLKQILIGIGYLHSLGLA 498

Query: 186 YRDIKPDNFLIGRPGQPDANNIHLIDFGMAKQYRDPKTKQHIPYREKKSLSGTARYMSIN 245
           +RD+K DN ++   G      + +IDFG A  +  P +   +   E   + G+  Y++  
Sbjct: 499 HRDLKLDNCVLNSQGI-----VKIIDFGAAVVFTYPHSGTLV---EASGIVGSDPYLAPE 550

Query: 246 THL-GREQSRRDDMEALGHVFFYFLRGHLPWQGLKAPNNKQKY 287
             +  +   R  D+ +   ++   +    PW+  K  +N  K+
Sbjct: 551 VCIFSKYDPRPVDIWSAAIIYACMILKKFPWKIPKLKDNSFKF 593

>CAGL0L06820g 767038..768138 highly similar to sp|P38615
           Saccharomyces cerevisiae YMR139w MDS1
           Serine/threonine-protein kinase, start by similarity
          Length = 366

 Score = 45.1 bits (105), Expect = 1e-04,   Method: Compositional matrix adjust.
 Identities = 42/164 (25%), Positives = 75/164 (45%), Gaps = 16/164 (9%)

Query: 65  VGLHYKIGKKIGEGSFGVLFEGTNMINGVPVAIKFEPRKTEAPQLRD-EYKTYKILNGTP 123
           + + +   + +G GSFGV+F          VAIK   +  +  + ++ E +  K+L    
Sbjct: 33  ITISFPATEVVGHGSFGVVFTTVIQETNEKVAIK---KVLQDKRFKNRELEIMKMLQHRN 89

Query: 124 NIPYAYYF----GQEGLHNILVIDLLGPSLEDLFDWCGRKFSVKTVVQVAVQMITLIEDL 179
            I   YYF     +E +   L++D +  SL         + +    +++ + M  L + L
Sbjct: 90  IIDLKYYFYEIDEREDVFLNLILDYMPQSLYQRLRHFVHQRTPMPRLEIKIYMYQLFKAL 149

Query: 180 ----HAHDLIYRDIKPDNFLIGRPGQPDANNIHLIDFGMAKQYR 219
               H  ++ +RDIKP N L+     P++  + L DFG AKQ +
Sbjct: 150 NYLHHTANVCHRDIKPQNLLVD----PNSWCLRLCDFGSAKQLK 189

>YAR019C (CDC15) [74] chr1 complement(172211..175135) MAP kinase
           kinase kinase essential for late nuclear division [2925
           bp, 974 aa]
          Length = 974

 Score = 45.4 bits (106), Expect = 1e-04,   Method: Compositional matrix adjust.
 Identities = 53/219 (24%), Positives = 82/219 (37%), Gaps = 17/219 (7%)

Query: 66  GLHYKIGKKIGEGSFGVLFEGTNMINGVPVAIK--FEPRKTEAPQLRDEYKTYKILNGTP 123
            + Y + + IG GS+GV+++  N      VAIK        E   +  E    K LN   
Sbjct: 22  SVQYHLKQVIGRGSYGVVYKAINKHTDQVVAIKEVVYENDEELNDIMAEISLLKNLNHNN 81

Query: 124 NIPYAYYFGQEGLHNILVIDLLGPSLEDLFDWCGRKFSVKTVVQVAVQMITLIEDLHAHD 183
            + Y  +  +     IL+      SL  L        S         Q +  ++ LH   
Sbjct: 82  IVKYHGFIRKSYELYILLEYCANGSLRRLISRSSTGLSENESKTYVTQTLLGLKYLHGEG 141

Query: 184 LIYRDIKPDNFLIGRPGQPDANNIHLIDFGMAKQYRDPKTKQHIPYREKKSLSGTARYMS 243
           +I+RDIK  N L+        N + L DFG++           I      +L+GT  +M+
Sbjct: 142 VIHRDIKAANILLSAD-----NTVKLADFGVST----------IVNSSALTLAGTLNWMA 186

Query: 244 INTHLGREQSRRDDMEALGHVFFYFLRGHLPWQGLKAPN 282
                 R  S   D+ +LG      L  + P+  L   N
Sbjct: 187 PEILGNRGASTLSDIWSLGATVVEMLTKNPPYHNLTDAN 225

>Scas_713.21
          Length = 641

 Score = 45.1 bits (105), Expect = 1e-04,   Method: Compositional matrix adjust.
 Identities = 32/138 (23%), Positives = 60/138 (43%), Gaps = 22/138 (15%)

Query: 152 LFDWCGRKFSVKTVVQVAVQMITLIEDLHAHDLIYRDIKPDNFLIGRPGQPDANNIHLID 211
           L +   R F +  V  ++ +MI  I+ +H  D+++ D+KP NF+  +        + LID
Sbjct: 408 LHERVNRPFDINFVRLMSKEMIECIKAVHDSDIVHSDLKPANFIFVK------GTLKLID 461

Query: 212 FGMAKQYRDPKTKQHIPYREKKSLSGTARYMSINTHLGREQS-----------RRDDMEA 260
           FG+A +  D     +     + +  GT  YM+  T + +  S           +  D+ +
Sbjct: 462 FGIANKIADNTLNVY-----RNTQMGTPNYMAPETLISQNYSNNNNNLLWKIGKPSDIWS 516

Query: 261 LGHVFFYFLRGHLPWQGL 278
            G + +    GH P+   
Sbjct: 517 YGCILYQMTYGHPPYSSF 534

>Scas_651.3
          Length = 793

 Score = 45.1 bits (105), Expect = 1e-04,   Method: Compositional matrix adjust.
 Identities = 44/182 (24%), Positives = 80/182 (43%), Gaps = 24/182 (13%)

Query: 69  YKIGKKIGEGSFGVLFEGTNMINGVPVAIKFEPRKTE-APQLRDEYKTYKILNGTPNIPY 127
           Y +   +G+G+FG + +  N+     +A+K    ++E   Q   E K  +++N   +   
Sbjct: 380 YLVLDILGQGTFGQVVKCQNLTTKEILAVKVIKSRSEYLNQSITEAKILELINNKIDPEN 439

Query: 128 AYYFGQ------EGLHNILVIDLLGPSLEDLFDWCG-RKFSVKTVVQVAVQMITLIEDLH 180
            ++F +         H  LV +LL  +L +L         S++ +     QM+  +  L 
Sbjct: 440 KHHFLRMYDSFIHKNHLCLVFELLSNNLYELLKQNQFHGLSIQLIRIFTKQMLESLCVLK 499

Query: 181 AHDLIYRDIKPDNFLIGRPGQPDANNIHLIDFGMAKQ-------------YRDPKTKQHI 227
              LI+ D+KP+N L+  P +P    + +IDFG + +             YR P+    I
Sbjct: 500 DSKLIHCDLKPENILLCSPDKPA---LKIIDFGSSCEETRTVYTYIQSRFYRAPEIILGI 556

Query: 228 PY 229
           PY
Sbjct: 557 PY 558

>KLLA0F01507g 144356..145774 some similarities with sp|P47042
           Saccharomyces cerevisiae YJL057c IKS1 singleton,
           hypothetical start
          Length = 472

 Score = 45.1 bits (105), Expect = 1e-04,   Method: Compositional matrix adjust.
 Identities = 28/120 (23%), Positives = 56/120 (46%), Gaps = 12/120 (10%)

Query: 160 FSVKTVVQVAVQMITLIEDLHAHDLIYRDIKPDNFLI----GRPGQPDANNIHLIDFGMA 215
            + + +V +A  + T ++ LH+  +I+RD+KP N L+     R          + DFG +
Sbjct: 211 LTTRQIVSIANDIATGLKQLHSLRIIHRDLKPSNCLLLEEFDRSDTDKFPKCVIGDFGES 270

Query: 216 KQYRDPKTKQHIPYREKKSLSGTARYMSINTHLGREQSRRDDMEALGHVFFYFLRGHLPW 275
           + Y           R+    +GT  +++     G + S + D+ A G + ++ + G LP+
Sbjct: 271 QLYGQ--------LRDATGSTGTVEFVAPELTKGAQFSFKSDIYAFGMILYFVIMGQLPF 322

>Scas_689.22
          Length = 901

 Score = 45.1 bits (105), Expect = 1e-04,   Method: Compositional matrix adjust.
 Identities = 36/166 (21%), Positives = 78/166 (46%), Gaps = 12/166 (7%)

Query: 65  VGLHYKIGKKIGEGSFGVLFEGTNMINGVPVAIK---FEPRKTEAPQLRDEYKTYKILNG 121
           V L +K+G+ IG G++G + E +++ +G   A+K   F+        +R E   ++ L  
Sbjct: 434 VILDHKLGRAIGAGAWGSIRECSDIQSGTRRAMKIVRFKENLNVKKHVRREVSIWEQLKH 493

Query: 122 TPNIPYAYYFGQEGLHNILVIDLLGP-SLEDL-FDWC---GRKFSVKTVVQVAV----QM 172
              +P   Y  +E      + + +   +L DL   W      K S+    ++ +    Q+
Sbjct: 494 ENILPLLNYKFEESYAMYCLTEFINDGNLYDLAVSWSHMSNSKISLSKRCELTIFLGLQV 553

Query: 173 ITLIEDLHAHDLIYRDIKPDNFLIGRPGQPDANNIHLIDFGMAKQY 218
           ++ ++ +H+  + + D+K +N L+ +        + L DFGM++ +
Sbjct: 554 VSALQYMHSKSICHGDVKLENCLLKKDKAVGNWKVLLCDFGMSRNF 599

>Scas_593.14d
          Length = 495

 Score = 45.1 bits (105), Expect = 1e-04,   Method: Compositional matrix adjust.
 Identities = 41/154 (26%), Positives = 73/154 (47%), Gaps = 19/154 (12%)

Query: 164 TVVQVAVQMITLIEDLHAHDLIYRDIKPDNFLIGRPGQPDANNIHLIDFGMAKQ-----Y 218
           TV   A ++   ++ LH   ++YRD+KP+N L+      D  ++ L DFG++K+      
Sbjct: 249 TVAFYAAEISCALKFLHDKGIVYRDLKPENCLLN-----DKGHLVLTDFGLSKKSVTQNS 303

Query: 219 RDPK--TKQHIPYREKKSLS---GTARYMSINTHLGREQSRRDDMEALGHVFFYFLRGHL 273
            +P   T  + P  +  +L    GT  Y +     G   ++  D  +LG + +  L G  
Sbjct: 304 ANPSEVTSLNEPSEDLSTLHSIIGTPEYCAPEILQGLPYNKNCDWYSLGCLIYDMLSGKP 363

Query: 274 PWQGLKAPNNKQKYEKIGEKKRSTNV-YDLAQGL 306
           P+ G    N+K    KI + K+   + Y L++G+
Sbjct: 364 PYTG---ANHKVILNKIQKDKQGPKIPYYLSEGM 394

>Scas_627.7
          Length = 349

 Score = 44.7 bits (104), Expect = 1e-04,   Method: Compositional matrix adjust.
 Identities = 33/110 (30%), Positives = 54/110 (49%), Gaps = 13/110 (11%)

Query: 167 QVAVQMITLIEDLHAHDLIYRDIKPDNFLIGRPGQPDANNIHLIDFGMAKQYRDPKTKQH 226
           +   Q+   +  LH   +I+RD+KP+N LIG       N I L DFG +    +P+  + 
Sbjct: 193 RFVFQIADALNYLHDKQIIHRDLKPENILIGF-----NNVIKLTDFGWS--IINPRGVK- 244

Query: 227 IPYREKKSLSGTARYMSINTHLGREQSRRDDMEALGHVFFYFLRGHLPWQ 276
                +K+L GT  Y+S      RE   + D+ ALG + +  + G  P++
Sbjct: 245 -----RKTLCGTIDYLSPEMIRSREYDDKVDVWALGVLTYELIVGSPPFE 289

>CAGL0I03498g 297344..298699 similar to sp|P06784 Saccharomyces
           cerevisiae YDL159w STE7 ser/thr/tyr protein kinase of
           MAP kinase kinase family, hypothetical start
          Length = 451

 Score = 44.7 bits (104), Expect = 1e-04,   Method: Compositional matrix adjust.
 Identities = 28/94 (29%), Positives = 44/94 (46%), Gaps = 14/94 (14%)

Query: 184 LIYRDIKPDNFLIGRPGQPDANNIHLIDFGMAKQYRDPKTKQHIPYREKKSLSGTARYMS 243
           +I+RDIKP N LI   G+     I L DFG++++  +      +         GT+ YMS
Sbjct: 250 IIHRDIKPSNVLINSKGR-----IKLCDFGVSRKLNNSIADTFV---------GTSTYMS 295

Query: 244 INTHLGREQSRRDDMEALGHVFFYFLRGHLPWQG 277
                G + + + D+ +LG +    L G  P  G
Sbjct: 296 PERIQGNKYTTKGDVWSLGLMLIELLTGEFPLGG 329

>KLLA0F20053g 1867209..1868543 highly similar to sp|P32485
           Saccharomyces cerevisiae YLR113w HOG1 ser/thr protein
           kinase of MAP kinase (MAPK) family, start by similarity
          Length = 444

 Score = 44.7 bits (104), Expect = 1e-04,   Method: Compositional matrix adjust.
 Identities = 48/202 (23%), Positives = 88/202 (43%), Gaps = 22/202 (10%)

Query: 75  IGEGSFGVLFEGTNMINGVPVAIK--FEPRKTEAPQLRDEYKTYKILNGT--PNIPYAYY 130
           +G G+FG++   T+ +   PVAIK   +P  T     R  Y+  K+L      N+     
Sbjct: 28  VGMGAFGLVCSATDTLTSQPVAIKKIMKPFSTSVLAKR-TYRELKLLKHLRHENLICLED 86

Query: 131 FGQEGLHNI-LVIDLLGPSLEDLFDWCGRKFSVKTVVQVAVQMITLIEDLHAHDLIYRDI 189
                L +I  V +L G  L  L     R    + V     Q++  ++ +H+  +I+RD+
Sbjct: 87  IFLSPLEDIYFVTELQGTDLHRLLQ--TRPLEKQFVQYFLYQILRGLKYVHSAGVIHRDL 144

Query: 190 KPDNFLIGRPGQPDANNIHLIDFGMAKQYRDPKTKQHIPYREKKSLSGTARYMSINTHLG 249
           KP N LI      +  ++ + DFG+A+  +DP+   ++  R  ++      +   N  + 
Sbjct: 145 KPSNILIN-----ENCDLKICDFGLAR-IQDPQMTGYVSTRYYRAPEIMLTWQKYNVEV- 197

Query: 250 REQSRRDDMEALGHVFFYFLRG 271
                  D+ + G +F   + G
Sbjct: 198 -------DIWSAGCIFAEMIEG 212

>YPL031C (PHO85) [5407] chr16
           complement(492014..492914,493017..493033)
           Cyclin-dependent protein kinase that interacts with
           cyclin Pho80p to regulate phosphate pathway and with
           cyclin Pcl5p to regulate Gcn4p stability, also interacts
           with other Pho80p-like cyclins [918 bp, 305 aa]
          Length = 305

 Score = 44.3 bits (103), Expect = 1e-04,   Method: Compositional matrix adjust.
 Identities = 48/212 (22%), Positives = 85/212 (40%), Gaps = 20/212 (9%)

Query: 68  HYKIGKKIGEGSFGVLFEGTNMINGVPVAIKFEPRKTEAPQLRDEYKTYKILNGT--PNI 125
            +K  +K+G G++  +++G N   GV VA+K     +E        +   ++      NI
Sbjct: 6   QFKQLEKLGNGTYATVYKGLNKTTGVYVALKEVKLDSEEGTPSTAIREISLMKELKHENI 65

Query: 126 PYAYYFGQEGLHNILVIDLLGPSLEDLFDW-----CGRKFSVKTVVQVAVQMITLIEDLH 180
              Y          LV + +   L+   D        R   +  V     Q++  +   H
Sbjct: 66  VRLYDVIHTENKLTLVFEFMDNDLKKYMDSRTVGNTPRGLELNLVKYFQWQLLQGLAFCH 125

Query: 181 AHDLIYRDIKPDNFLIGRPGQPDANNIHLIDFGMAKQYRDPKTKQHIPYREKKSLSGTAR 240
            + +++RD+KP N LI + GQ     + L DFG+A+ +        IP     S   T  
Sbjct: 126 ENKILHRDLKPQNLLINKRGQ-----LKLGDFGLARAF-------GIPVNTFSSEVVTLW 173

Query: 241 YMSINTHLG-REQSRRDDMEALGHVFFYFLRG 271
           Y + +  +G R  S   D+ + G +    + G
Sbjct: 174 YRAPDVLMGSRTYSTSIDIWSCGCILAEMITG 205

>Kwal_27.9804
          Length = 473

 Score = 44.7 bits (104), Expect = 2e-04,   Method: Compositional matrix adjust.
 Identities = 44/175 (25%), Positives = 74/175 (42%), Gaps = 27/175 (15%)

Query: 69  YKIGKKIGEGSFGVLFEGTNMINGVPVAIKFEPRK---------------TEAPQ-LRDE 112
           YK+  KIGEG+F  +++  ++   V  A      K               T +PQ + +E
Sbjct: 26  YKLLDKIGEGTFSSVYKAEDLTGSVTSAFSSHFWKSAGKKRYVALKRIYVTSSPQRIYNE 85

Query: 113 YKTYKILNGTPNIPYAYYFGQEGLHNILVIDLLGPSLEDLFDWCGRKFSVKTVVQVAVQM 172
                +L G+  +           H   VI +L     + F    R   +K + +   ++
Sbjct: 86  LNLLYMLCGSTRVAP---LCDALRHQDQVIAVLPWYPHEEFRNFYRDLPIKGIKKYMSEL 142

Query: 173 ITLIEDLHAHDLIYRDIKPDNFLIGRPGQPDANNIHLIDFGMAK----QYRDPKT 223
           +  +  +H+  +I+RDIKP NFL      P      L+DFG+A+      RDP+T
Sbjct: 143 LQALSFVHSKAIIHRDIKPTNFLY----SPQLGRGVLVDFGLAETEVSHARDPET 193

>ADR379C [2120] [Homologous to ScYOR351C (MEK1) - SH]
           (1386601..1388079) [1479 bp, 492 aa]
          Length = 492

 Score = 44.7 bits (104), Expect = 2e-04,   Method: Compositional matrix adjust.
 Identities = 50/203 (24%), Positives = 88/203 (43%), Gaps = 40/203 (19%)

Query: 151 DLFDWCGRK-----FSVKTVVQVAVQMITLIEDLHAHDLIYRDIKPDNFLIGRPGQPDAN 205
           DLF +  +K      S    + +  Q++  ++ LH+  +++RD+K DN L+  P +P  +
Sbjct: 243 DLFSYLAKKDCLAPISETEALVIVYQILQALKFLHSKGIVHRDLKLDNILLCTP-EP-CS 300

Query: 206 NIHLIDFGMAKQYRDPKTKQHIPYREKKSLSGTARYMS------INTHLGREQSRRDDME 259
            I L DFG+AK     + + H       ++ GT  Y +      ++ +  R  SR   ME
Sbjct: 301 RIVLADFGIAKDLPSTRVRMH-------TIVGTPEYCAPEVGFRVDRNSYRNFSRTASME 353

Query: 260 -----------ALGHVFFYFLRGHLPWQGLKAPNNKQKYEKIGE----KKRSTNVYDLAQ 304
                      +LG +    L G  P+ G     +  +  KIG+     K+   V D A+
Sbjct: 354 QQGYDFKCDLWSLGVMTHIMLTGISPFYGDGTEASIIRNVKIGKLNFGTKQWVGVSDTAK 413

Query: 305 GLPVQFGRYLEI--VRSLSFEEC 325
               Q    LE+   + +S ++C
Sbjct: 414 SFVRQL---LEVNAEKRMSVQDC 433

>Scas_655.2
          Length = 800

 Score = 44.7 bits (104), Expect = 2e-04,   Method: Compositional matrix adjust.
 Identities = 36/138 (26%), Positives = 62/138 (44%), Gaps = 10/138 (7%)

Query: 151 DLFDWC-GRKFSVKTVVQVAVQMITLIEDLHAHDLIYRDIKPDNFLIGRPGQPDANNIHL 209
           DLF      K S + +     Q++T ++ LH+  L +RD+K DN +I   G      + L
Sbjct: 528 DLFAIVMSNKMSYEEICCCFKQILTGVQYLHSIGLAHRDLKLDNCVINEKGI-----VKL 582

Query: 210 IDFGMAKQYRDPKTKQHIPYREKKSLSGTARYMSINTHL-GREQSRRDDMEALGHVFFYF 268
           IDFG A  +  P +K  +   E   + G+  Y++    +  +   R  D+ +   +F   
Sbjct: 583 IDFGAAVVFSYPFSKTLV---EASGIVGSDPYLAPEVCIFSKYDPRPVDIWSTAIIFACM 639

Query: 269 LRGHLPWQGLKAPNNKQK 286
           +    PW+  K  +N  K
Sbjct: 640 ILKKFPWKIPKLRDNSFK 657

>Sklu_2323.3 YPL209C, Contig c2323 5241-6443
          Length = 400

 Score = 44.3 bits (103), Expect = 2e-04,   Method: Compositional matrix adjust.
 Identities = 32/106 (30%), Positives = 51/106 (48%), Gaps = 13/106 (12%)

Query: 171 QMITLIEDLHAHDLIYRDIKPDNFLIGRPGQPDANNIHLIDFGMAKQYRDPKTKQHIPYR 230
           QM   +  +H  ++++RDIKP+N LIG       N + L DFG +               
Sbjct: 246 QMADALNYMHDRNVLHRDIKPENILIGF-----QNTLKLTDFGWS--------VISTTGA 292

Query: 231 EKKSLSGTARYMSINTHLGREQSRRDDMEALGHVFFYFLRGHLPWQ 276
           ++K+L GT  Y+S      RE   + D+ ALG + +  L G  P++
Sbjct: 293 KRKTLCGTLDYLSPELVKYREYDEKVDVWALGVLAYELLVGTPPFE 338

>YLR113W (HOG1) [3526] chr12 (371621..372928) MAP kinase (MAPK),
           principal component of the high-osmolarity signal
           transduction pathway [1308 bp, 435 aa]
          Length = 435

 Score = 44.3 bits (103), Expect = 2e-04,   Method: Compositional matrix adjust.
 Identities = 43/161 (26%), Positives = 75/161 (46%), Gaps = 14/161 (8%)

Query: 75  IGEGSFGVLFEGTNMINGVPVAIK--FEPRKTEAPQLRDEYKTYKILNGT--PNIPYAYY 130
           +G G+FG++   T+ +   PVAIK   +P  T     R  Y+  K+L      N+     
Sbjct: 29  VGMGAFGLVCSATDTLTSQPVAIKKIMKPFSTAVLAKR-TYRELKLLKHLRHENLICLQD 87

Query: 131 FGQEGLHNI-LVIDLLGPSLEDLFDWCGRKFSVKTVVQVAVQMITLIEDLHAHDLIYRDI 189
                L +I  V +L G  L  L     R    + V     Q++  ++ +H+  +I+RD+
Sbjct: 88  IFLSPLEDIYFVTELQGTDLHRLLQ--TRPLEKQFVQYFLYQILRGLKYVHSAGVIHRDL 145

Query: 190 KPDNFLIGRPGQPDANNIHLIDFGMAKQYRDPKTKQHIPYR 230
           KP N LI      +  ++ + DFG+A+  +DP+   ++  R
Sbjct: 146 KPSNILIN-----ENCDLKICDFGLAR-IQDPQMTGYVSTR 180

>YMR216C (SKY1) [4172] chr13 complement(698810..701038)
           Serine/threonine protein kinase that regulates polyamine
           transport and ion homeostasis [2229 bp, 742 aa]
          Length = 742

 Score = 44.7 bits (104), Expect = 2e-04,   Method: Compositional matrix adjust.
 Identities = 47/178 (26%), Positives = 83/178 (46%), Gaps = 28/178 (15%)

Query: 69  YKIGKKIGEGSFGVLFEGTNMINGVPVAIKF---EPRKTEAPQLRDEYKTYKILNGTPN- 124
           Y + +K+G G F  ++   +M+N   VA+K    +   TEA +  DE K  + +N   N 
Sbjct: 158 YILVRKLGWGHFSTVWLAKDMVNNTHVAMKIVRGDKVYTEAAE--DEIKLLQRVNDADNT 215

Query: 125 -------------IPYAYYFGQEGLHNILVIDLLGPSLEDLF-DWCGRKFSVKTVVQVAV 170
                        + +  + G  G+H ++V ++LG +L  L   +  R   +  V Q++ 
Sbjct: 216 KEDSMGANHILKLLDHFNHKGPNGVHVVMVFEVLGENLLALIKKYEHRGIPLIYVKQISK 275

Query: 171 QMITLIEDLHAH-DLIYRDIKPDNFL--IGRPGQPDANNIHLIDFGMAKQYRDPKTKQ 225
           Q++  ++ +H    +I+ DIKP+N L  IG     D   I  +   + KQ R+ K  Q
Sbjct: 276 QLLLGLDYMHRRCGIIHTDIKPENVLMEIG-----DVEGIVQMVEALDKQKREAKRLQ 328

>Kwal_0.155
          Length = 587

 Score = 44.3 bits (103), Expect = 2e-04,   Method: Compositional matrix adjust.
 Identities = 57/260 (21%), Positives = 96/260 (36%), Gaps = 64/260 (24%)

Query: 69  YKIGKKIGEGSFGVLFEGTNMINGVP---------VAIKFEPRK-------------TEA 106
           YK+  KIGEG+F  ++ G    +            VA+K   +K             T  
Sbjct: 157 YKLIAKIGEGAFSKVYRGVPQEHSSKSFLSRAFKQVAVKVISKKHLSSTHKDAKSKATSR 216

Query: 107 PQLRDEYKTYKILNGTPNIPYAYYFGQEGLHNILVIDLLGPSLEDLFDWCGRK--FSVKT 164
            Q+  E   ++ ++ + N+     F +   +  +V +LL     ++F    R   FS   
Sbjct: 217 EQVLKEVAIHRTVSASENVVSFVDFQESHNYYFIVQELLAGG--EIFGEIVRLTYFSEDL 274

Query: 165 VVQVAVQMITLIEDLHAHDLIYRDIKPDNFL-------------IGRPGQPDAN------ 205
              V  Q+   ++ +HA  +++RDIKP+N L             + +   P A       
Sbjct: 275 SRHVIRQLALAVKHMHAMGIVHRDIKPENLLFEHVDYEPSPSPVLRKSDDPKAKQDEGIF 334

Query: 206 ----------NIHLIDFGMAKQYRDPKTKQHIPYREKKSLSGTARYMSINTHLGREQSRR 255
                      + L DFG++KQ     T         K+  GT  Y +         S +
Sbjct: 335 RPGIGGGGIGTVKLADFGLSKQIYSTNT---------KTPCGTVGYTAPEVVKDERYSMQ 385

Query: 256 DDMEALGHVFFYFLRGHLPW 275
            DM  +G V +  L G  P+
Sbjct: 386 VDMWGIGCVLYTVLCGFPPF 405

  Database: blastdb
    Posted date:  Apr 3, 2006  3:33 PM
  Number of letters in database: 16,596,109
  Number of sequences in database:  34,618
  
Lambda     K      H
   0.317    0.136    0.410 

Gapped
Lambda     K      H
   0.267   0.0410    0.140 

Matrix: BLOSUM62
Gap Penalties: Existence: 11, Extension: 1
Number of Sequences: 34618
Number of Hits to DB: 15,290,405
Number of extensions: 625594
Number of successful extensions: 2426
Number of sequences better than 10.0: 579
Number of HSP's gapped: 2168
Number of HSP's successfully gapped: 588
Length of query: 529
Length of database: 16,596,109
Length adjustment: 106
Effective length of query: 423
Effective length of database: 12,926,601
Effective search space: 5467952223
Effective search space used: 5467952223
Neighboring words threshold: 11
Window for multiple hits: 40
X1: 16 ( 7.3 bits)
X2: 38 (14.6 bits)
X3: 64 (24.7 bits)
S1: 41 (21.6 bits)
S2: 64 (29.3 bits)