Hit NameLength (aa)HSP LengthHSP ScoreHSP Significance
YHR133C29128714320.0
Sklu_1881.32542574395e-53
AFR043W2712624153e-49
KLLA0F27885g2562653962e-46
YNL156C2992893843e-44
CAGL0J05918g3231713635e-41
Kwal_33.146072612763441e-38
Scas_697.14*2942763346e-37
Scas_654.19*2022061113e-06
AFR197W47455635.5
BLASTP 2.2.26 [Sep-21-2011]

Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, 
Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), 
"Gapped BLAST and PSI-BLAST: a new generation of protein database search
programs",  Nucleic Acids Res. 25:3389-3402.

Reference for compositional score matrix adjustment: Altschul, Stephen F., 
John C. Wootton, E. Michael Gertz, Richa Agarwala, Aleksandr Morgulis,
Alejandro A. Schaffer, and Yi-Kuo Yu (2005) "Protein database searches
using compositionally adjusted substitution matrices", FEBS J. 272:5101-5109.

Query= YHR133C
         (287 letters)

Database: blastdb 
           34,618 sequences; 16,596,109 total letters

Searching..................................................done

                                                                 Score    E
Sequences producing significant alignments:                      (bits) Value

YHR133C (YHR133C) [2420] chr8 complement(370723..371598) Protein...   556   0.0  
Sklu_1881.3 YNL156C, Contig c1881 3706-4470                           173   5e-53
AFR043W [3235] [Homologous to ScYNL156C - SH; ScYHR133C - SH] co...   164   3e-49
KLLA0F27885g 2580668..2581438 similar to sp|P53898 Saccharomyces...   157   2e-46
YNL156C (YNL156C) [4441] chr14 complement(341069..341968) Protei...   152   3e-44
CAGL0J05918g complement(558615..559586) similar to sp|P53898 Sac...   144   5e-41
Kwal_33.14607                                                         137   1e-38
Scas_697.14*                                                          133   6e-37
Scas_654.19*                                                           47   3e-06
AFR197W [3389] [Homologous to ScYMR115W - SH; ScYKL133C - SH] co...    29   5.5  

>YHR133C (YHR133C) [2420] chr8 complement(370723..371598) Protein
           that contains four potential transmembrane segments [876
           bp, 291 aa]
          Length = 291

 Score =  556 bits (1432), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 273/287 (95%), Positives = 273/287 (95%)

Query: 1   MGKKKSKNQLNTGGVPNGVHNTKKEAALPPLGNKLGSASFTAINTLTKPALFSFYDDDIT 60
           MGKKKSKNQLNTGGVPNGVHNTKKEAALPPLGNKLGSASFTAINTLTKPALFSFYDDDIT
Sbjct: 1   MGKKKSKNQLNTGGVPNGVHNTKKEAALPPLGNKLGSASFTAINTLTKPALFSFYDDDIT 60

Query: 61  KNEGNVYDKALLSNASQLEMVPPSATARHERSLYAKIINTXXXXXXXXXXXXXXPMISEC 120
           KNEGNVYDKALLSNASQLEMVPPSATARHERSLYAKIINT              PMISEC
Sbjct: 61  KNEGNVYDKALLSNASQLEMVPPSATARHERSLYAKIINTIAAFFILFIAGILFPMISEC 120

Query: 121 LFDNDQLAKGDIVSFLKHGIEIKNKIVAEPDMVPDWAVFGTEGVIFGSIVPFIDSFVRYQ 180
           LFDNDQLAKGDIVSFLKHGIEIKNKIVAEPDMVPDWAVFGTEGVIFGSIVPFIDSFVRYQ
Sbjct: 121 LFDNDQLAKGDIVSFLKHGIEIKNKIVAEPDMVPDWAVFGTEGVIFGSIVPFIDSFVRYQ 180

Query: 181 HQPKTRSSVYKNTLGSFIRCANTLLGLIFGIRKLEWSSSLQAAGAWSLLNIVLWLFFDGT 240
           HQPKTRSSVYKNTLGSFIRCANTLLGLIFGIRKLEWSSSLQAAGAWSLLNIVLWLFFDGT
Sbjct: 181 HQPKTRSSVYKNTLGSFIRCANTLLGLIFGIRKLEWSSSLQAAGAWSLLNIVLWLFFDGT 240

Query: 241 LTVFFPGLVIGALSAFTCSQCFSQLSLALYFIDFYFFGFLMFSKLGR 287
           LTVFFPGLVIGALSAFTCSQCFSQLSLALYFIDFYFFGFLMFSKLGR
Sbjct: 241 LTVFFPGLVIGALSAFTCSQCFSQLSLALYFIDFYFFGFLMFSKLGR 287

>Sklu_1881.3 YNL156C, Contig c1881 3706-4470
          Length = 254

 Score =  173 bits (439), Expect = 5e-53,   Method: Compositional matrix adjust.
 Identities = 104/257 (40%), Positives = 145/257 (56%), Gaps = 17/257 (6%)

Query: 32  GNKLGSASFTAINTLTKPALFSFYDDDITKNEGN-VYDKALLSNASQLEMVPPSATARHE 90
           GN+L S S  +I TLTKP LF  YD++I K+E N +Y++A     S  ++ P     R  
Sbjct: 9   GNEL-SNSNESITTLTKPQLFGLYDEEIVKSEDNEIYEEA---KKSAGKLTPAGVMER-- 62

Query: 91  RSLYAKIINTXXXXXXXXXXXXXXPMISECLFDNDQLAKGDIVSFLKHGIEIKNKIVAEP 150
           RS++ K+++                 +S  L DN  L        L  G+++  K+    
Sbjct: 63  RSIFQKVVHLLFSWLVLGVAGIAYHELSRNLHDNHALHPELASKPLLLGVQLSQKL--SF 120

Query: 151 DMVPDWAVFGTEGVIFGSIVPFIDSFVRYQHQPKTRSSVYKNTLGSFIRCANTLLGLIFG 210
            MVP WA +  EG++FGS++P +D     +    + SSV        +R  N +LG+ FG
Sbjct: 121 GMVPTWAAYSLEGILFGSLLPLVDHLRGKKTASTSSSSV--------MRAINAMLGVEFG 172

Query: 211 IRKLEWSSSLQAAGAWSLLNIVLWLFFDGTLTVFFPGLVIGALSAFTCSQCFSQLSLALY 270
           IRK+EWSSSLQA+GAW LLNI+LW+FFDGTL++   G  IGA +  TC Q  ++ S  LY
Sbjct: 173 IRKIEWSSSLQASGAWFLLNIILWMFFDGTLSMLLIGAAIGAGTCITCYQDVTEYSQLLY 232

Query: 271 FIDFYFFGFLMFSKLGR 287
           F+DFYF G L F KLGR
Sbjct: 233 FMDFYFLGLLFFGKLGR 249

>AFR043W [3235] [Homologous to ScYNL156C - SH; ScYHR133C - SH]
           complement(511018..511833) [816 bp, 271 aa]
          Length = 271

 Score =  164 bits (415), Expect = 3e-49,   Method: Compositional matrix adjust.
 Identities = 96/262 (36%), Positives = 143/262 (54%), Gaps = 16/262 (6%)

Query: 32  GNKLGS-----ASFTAINTLTKPALFSFYDDDITKNEG-NVYDKALLSNASQLEMVPPSA 85
           G K+GS     AS  +++ LTKP LF  YD++I ++E   +Y++A  S    L+ +    
Sbjct: 15  GGKVGSPIVVAASTDSMSMLTKPQLFGIYDEEIVESEDTEIYEEAKKSAGRMLDDMGSVG 74

Query: 86  TARHERSLYAKIINTXXXXXXXXXXXXXXPMISECLFDNDQLAKGDIVSFLKHGIEIKNK 145
                R+   K ++                 +S  L DND L +      L  G+++  +
Sbjct: 75  ARSRVRTRSQKYMHLVSSLVILGISGIAYHQLSRNLHDNDLLHEDFTSRPLVLGVKLCQQ 134

Query: 146 IVAEPDMVPDWAVFGTEGVIFGSIVPFIDSFVRYQHQPKTRSSVYKNTLGSFIRCANTLL 205
           +     M+P WA +  EG++FGS++P +D +         R SV K  L   +R  N +L
Sbjct: 135 L--SFGMLPTWAGYAVEGILFGSLLPAVDYW--------RRISVGKVNLSGVLRSINAML 184

Query: 206 GLIFGIRKLEWSSSLQAAGAWSLLNIVLWLFFDGTLTVFFPGLVIGALSAFTCSQCFSQL 265
           G+ FGIR++EWSSSLQA+GAW LL+ +LWLFFDG+ +VF  G  +G ++A TC +  +  
Sbjct: 185 GVSFGIRRVEWSSSLQASGAWFLLDGILWLFFDGSFSVFLLGFAVGLVTAVTCYEEITDF 244

Query: 266 SLALYFIDFYFFGFLMFSKLGR 287
           S  LYFIDFYF G L F +LGR
Sbjct: 245 SQLLYFIDFYFLGLLFFGRLGR 266

>KLLA0F27885g 2580668..2581438 similar to sp|P53898 Saccharomyces
           cerevisiae YNL156c, start by similarity
          Length = 256

 Score =  157 bits (396), Expect = 2e-46,   Method: Compositional matrix adjust.
 Identities = 98/265 (36%), Positives = 142/265 (53%), Gaps = 18/265 (6%)

Query: 25  EAALPPLGNKLGSASFTAINTLTKPALFSFYDDDITKNE-GNVYDKALLSNASQLEMVPP 83
           E+A    G+K GS+   + N LTKPAL+  YD D+ K+E   +Y++  +  AS  + +  
Sbjct: 3   ESASNSTGSKYGSSE--SSNLLTKPALYGLYDADVLKSEDSEIYEE--VKKASSGKELEN 58

Query: 84  SATARHERSLYAKIINTXXXXXXXXXXXXXXPMISECLFDNDQLAKGDIVSFLKHGIEIK 143
               R ++      +N                 +S+ L DN +L        L  G  I 
Sbjct: 59  GIVQRAKK--IPSSVNVALAWVVLSIAGIAYHELSKNLHDNHELHNDFTSRPLLLGATIA 116

Query: 144 NKIVAEPDMVPDWAVFGTEGVIFGSIVPFIDSFV-RYQHQPKTRSSVYKNTLGSFIRCAN 202
             +      +P W  +  EG++FGSIVPF++  +  +  QP T SSV        +R  N
Sbjct: 117 QSL--SFGYLPPWTFYAIEGILFGSIVPFVNWILGTFDRQPTTISSV--------LRSTN 166

Query: 203 TLLGLIFGIRKLEWSSSLQAAGAWSLLNIVLWLFFDGTLTVFFPGLVIGALSAFTCSQCF 262
            +LG+ FGIR++EWSSSLQA+GAW LLNI+LWLFFD + T+   GL IG ++  TC Q  
Sbjct: 167 AMLGVSFGIRRIEWSSSLQASGAWFLLNIILWLFFDSSFTMLASGLAIGLVTCVTCYQDI 226

Query: 263 SQLSLALYFIDFYFFGFLMFSKLGR 287
           +  +  LYFIDFYF G L F++LG+
Sbjct: 227 TDSAQLLYFIDFYFLGLLFFTRLGK 251

>YNL156C (YNL156C) [4441] chr14 complement(341069..341968) Protein
           of unknown function, has moderate similarity to
           uncharacterized S. cerevisiae Yhr133p [900 bp, 299 aa]
          Length = 299

 Score =  152 bits (384), Expect = 3e-44,   Method: Compositional matrix adjust.
 Identities = 98/289 (33%), Positives = 149/289 (51%), Gaps = 46/289 (15%)

Query: 39  SFTAINTLTKPALFSFYDDDITKNEGN-VYDKALLS------------------------ 73
           S  +I +LTKP L+S YDDD+ ++E N +Y++   S                        
Sbjct: 12  STESICSLTKPQLYSLYDDDVVRSEDNEIYEELKRSVSIDSTKYSRDQTIDSTFYLAHKV 71

Query: 74  ---------NASQLEMVPPSATARHE------RSLYAKIINTXXXXXXXXXXXXXXPMIS 118
                    +++ LE +  SA++ HE      R     I++                 +S
Sbjct: 72  GGSLPRNTVSSNNLERIL-SASSIHENFPSRTRQTRQNILHYLQAVLILSLSGFAYHELS 130

Query: 119 ECLFDNDQLAKGDIVSFLKHGIEIKNKIVAEPDMVPDWAVFGTEGVIFGSIVPFIDSFVR 178
             L DN  L        L  G+++ N +     ++P+W  +G EG++FGS+VP +D+  +
Sbjct: 131 RNLHDNHLLHPDFASRPLLLGVKLCNWL--SNGVLPNWLGYGVEGLLFGSVVPILDNIFQ 188

Query: 179 YQHQPKTRSSVYKNTLGSFIRCANTLLGLIFGIRKLEWSSSLQAAGAWSLLNIVLWLFFD 238
            +     +SSV+ ++L S IR  N +LG+ FGIRK++W+SSLQAAGAW LLNI+LWLFFD
Sbjct: 189 TE---VVKSSVHHDSLTSVIRSINAMLGVTFGIRKIQWNSSLQAAGAWGLLNIILWLFFD 245

Query: 239 GTLTVFFPGLVIGALSAFTCSQCFSQLSLALYFIDFYFFGFLMFSKLGR 287
           G++++    + IG     +C +     S  LYF+DFYF G LMF KLGR
Sbjct: 246 GSISMLMSCICIGVGCCISCYKDIIDGSQFLYFMDFYFLGSLMFGKLGR 294

>CAGL0J05918g complement(558615..559586) similar to sp|P53898
           Saccharomyces cerevisiae YNL156c or sp|P38837
           Saccharomyces cerevisiae YHR133c, hypothetical start
          Length = 323

 Score =  144 bits (363), Expect = 5e-41,   Method: Compositional matrix adjust.
 Identities = 76/171 (44%), Positives = 106/171 (61%), Gaps = 8/171 (4%)

Query: 117 ISECLFDNDQLAKGDIVSFLKHGIEIKNKIVAEPDMVPDWAVFGTEGVIFGSIVPFIDSF 176
           +S  L DN  L +      L  G+ I+ K+     ++PDW  +  EG+IFGSI+P +D  
Sbjct: 156 LSRNLHDNHLLHEDFASRPLLWGVTIQQKLSC--GILPDWFGYALEGIIFGSIIPLMDHI 213

Query: 177 VRYQHQPKTRSSVYKNTLGSFIRCANTLLGLIFGIRKLEWSSSLQAAGAWSLLNIVLWLF 236
            + + +P + S      L S IR  N +LG+ FGIRK++W+SS QAAGAW LLN++LWLF
Sbjct: 214 TKVKLRPTSYS------LSSVIRSINAMLGVTFGIRKIQWASSGQAAGAWGLLNVILWLF 267

Query: 237 FDGTLTVFFPGLVIGALSAFTCSQCFSQLSLALYFIDFYFFGFLMFSKLGR 287
           FDGTL++F    V+G L   +C    + +S  LYF+DFYF G LMF K+GR
Sbjct: 268 FDGTLSMFSNCSVLGLLCCASCFHEITDVSQFLYFMDFYFLGSLMFGKIGR 318

 Score = 31.6 bits (70), Expect = 0.62,   Method: Compositional matrix adjust.
 Identities = 14/32 (43%), Positives = 22/32 (68%), Gaps = 1/32 (3%)

Query: 39 SFTAINTLTKPALFSFYDDDITKNE-GNVYDK 69
          S  +I++LT P L+S YD DI K+E   +Y++
Sbjct: 15 SSESISSLTTPQLYSIYDQDIVKSEDAEIYEE 46

>Kwal_33.14607
          Length = 261

 Score =  137 bits (344), Expect = 1e-38,   Method: Compositional matrix adjust.
 Identities = 95/276 (34%), Positives = 138/276 (50%), Gaps = 35/276 (12%)

Query: 1   MGKKKSKNQLNTGGVPNGVHNTKKEAALPPLGNKLGSASFTAINTLTKPALFSFYDDDIT 60
           M +KKSK       + NG ++T  E+                I+ LT+P L+  YD DIT
Sbjct: 1   MARKKSK-------MANGNYSTSNES----------------ISNLTRPQLYGIYDADIT 37

Query: 61  KNE-GNVYDKALLSNASQLEMVPPSATARHERSLYAKIINTXXXXXXXXXXXXXXPMISE 119
            +E    Y++A  S     + V   +  RH RS + K  +                 +S+
Sbjct: 38  HSEDAEAYEQAKKSVGKFPDEVLNKSKHRH-RSWFQKGTHLLFSLCVLGVAGISYNELSK 96

Query: 120 CLFDNDQLAKGDIVSFLKHGIEIKNKIVAEPDMVPDWAVFGTEGVIFGSIVPFIDSFVRY 179
            L DN +L        L  G+EI   +     +VP W  +  EGV+FG+ +P +D+   +
Sbjct: 97  QLHDNHELHAEFASRPLALGVEICRTL--SFGVVPGWMAYALEGVLFGAFLPLLDTL--W 152

Query: 180 QHQPKTRSSVYKNTLGSFIRCANTLLGLIFGIRKLEWSSSLQAAGAWSLLNIVLWLFFDG 239
               KT       T  SF+R  + +LG+ FGIRK++WSSSLQA+GAW LLNIVLWLFFDG
Sbjct: 153 GGPMKT------TTFTSFLRSTHAMLGVAFGIRKIQWSSSLQASGAWFLLNIVLWLFFDG 206

Query: 240 TLTVFFPGLVIGALSAFTCSQCFSQLSLALYFIDFY 275
           T +     L IG +++ T  +  ++ S  LYF+DFY
Sbjct: 207 TPSTLLGCLGIGTIASVTSYRDVTEFSQTLYFMDFY 242

>Scas_697.14*
          Length = 294

 Score =  133 bits (334), Expect = 6e-37,   Method: Compositional matrix adjust.
 Identities = 87/276 (31%), Positives = 142/276 (51%), Gaps = 24/276 (8%)

Query: 32  GNKLGSASFTAINTLTKPALFSFYDDDITK-NE---GNVYDKA-----------LLSNAS 76
           GN    AS  +I+TLTKPAL+S Y +D+ K NE     +Y +A           +  ++ 
Sbjct: 19  GNIKTMASTDSISTLTKPALYSLYSNDVLKSNEDKTSQLYKQANNRWRRKGGDFMDPSSE 78

Query: 77  QLEMVPPSAT-----ARHERSLYAKIINTXXXXXXXXXXXXXXPMISECLFDNDQLAKGD 131
            L+ +    T            Y ++I+                 ++E LFDND+L KG 
Sbjct: 79  DLDELDEDHTDVDMDVEFNGKWYVRLIHLTYSFFILFTCGIVFGELAENLFDNDKLYKGM 138

Query: 132 IVSFLKHGIEIKNKIVAEPDMVPDWAVFGTEGVIFGSIVPFIDSFVRYQHQPKTRSSVYK 191
               L+ G+++ +K+V +   V ++  FG EG++   ++   D  +R       +S   K
Sbjct: 139 TAVILEDGVKLIDKVVPKSS-VTNYIGFGIEGILLSLVLRVSDYLIRPNKDKIGQSK--K 195

Query: 192 NTLGSFIRCANTLLGLIFGIRKLEWSSSLQAAGAWSLLNIVLWLFFDGTLTVFFPGLVIG 251
           N+  S +R +N +LG+  G+R+L W+SSLQ +  W L+N+++WLFFDGTL++   G++  
Sbjct: 196 NSFRSIVRISNAILGISLGVRRLPWTSSLQGSMLWLLVNVIVWLFFDGTLSILTSGVIQA 255

Query: 252 ALSAFTCSQCFSQLSLALYFIDFYFFGFLMFSKLGR 287
            L   T S+   + S  LY I+F+F G L+F KL R
Sbjct: 256 LLICLTYSRGI-ETSQTLYLINFHFLGLLIFGKLSR 290

>Scas_654.19*
          Length = 202

 Score = 47.4 bits (111), Expect = 3e-06,   Method: Compositional matrix adjust.
 Identities = 57/206 (27%), Positives = 89/206 (43%), Gaps = 46/206 (22%)

Query: 39  SFTAINTLTKPALFSFYDDDITKNEGNV------YDKALLSNASQLEMVPPSATARHERS 92
            F A   LT+P LFS YDDDI ++ G+V        K +L    + +      TAR    
Sbjct: 21  QFRAFQVLTRPTLFSIYDDDIIRSSGDVDSRIGGIRKRVLRGKRRWKYRRRQGTAR---- 76

Query: 93  LYAKIINTXXXXXXXXXXXXXXPMISECLFDNDQLAKGDIVSFLKHGIEIKNKIVAEPDM 152
              K+ N                +I   LF    +A  ++  +L     I NK+     M
Sbjct: 77  ---KLFN----------------LIVLSLFG---IAYNELAFYLYQST-IINKMSPLRFM 113

Query: 153 V----PDWAVFGTEGVIFGSIVPFIDSFVRYQ----HQPKTRSSV-----YKNTLGSFIR 199
           +    P W  +  EGV  G +VP +D  +  +      P+T + +     +    G  + 
Sbjct: 114 MFYGLPRWMNYSLEGVSLGFLVPLLDVLLFKKTVTVEYPETETEIGIGTEFDYGWGFMLA 173

Query: 200 CANTLLGLIFGIRKLEWSSSLQAAGA 225
             N ++G+I+GIRKLEW S++Q+A A
Sbjct: 174 IINIIMGIIYGIRKLEWDSAMQSAEA 199

>AFR197W [3389] [Homologous to ScYMR115W - SH; ScYKL133C - SH]
           complement(795847..797271) [1425 bp, 474 aa]
          Length = 474

 Score = 28.9 bits (63), Expect = 5.5,   Method: Compositional matrix adjust.
 Identities = 19/55 (34%), Positives = 28/55 (50%), Gaps = 5/55 (9%)

Query: 183 PKTRSSVYKNTLGSFIRCANTLLGLIFGIRKLEWSSSLQAAGAWSLLNIVLWLFF 237
           P  R+ V + TL    R  NT    +   R   W S++ AAG  S+L++ LW F+
Sbjct: 14  PVRRAHVPRMTLAP-TRAYNT----VSQQRSNRWKSAVLAAGGLSILSLGLWWFY 63

  Database: blastdb
    Posted date:  Apr 3, 2006  3:33 PM
  Number of letters in database: 16,596,109
  Number of sequences in database:  34,618
  
Lambda     K      H
   0.322    0.138    0.417 

Gapped
Lambda     K      H
   0.267   0.0410    0.140 

Matrix: BLOSUM62
Gap Penalties: Existence: 11, Extension: 1
Number of Sequences: 34618
Number of Hits to DB: 8,763,180
Number of extensions: 343015
Number of successful extensions: 949
Number of sequences better than 10.0: 14
Number of HSP's gapped: 934
Number of HSP's successfully gapped: 18
Length of query: 287
Length of database: 16,596,109
Length adjustment: 101
Effective length of query: 186
Effective length of database: 13,099,691
Effective search space: 2436542526
Effective search space used: 2436542526
Neighboring words threshold: 11
Window for multiple hits: 40
X1: 16 ( 7.4 bits)
X2: 38 (14.6 bits)
X3: 64 (24.7 bits)
S1: 41 (21.9 bits)
S2: 61 (28.1 bits)