Hit NameLength (aa)HSP LengthHSP ScoreHSP Significance
YHR131C84078733540.0
Scas_697.176942376877e-79
YNL144C7403106512e-73
Kwal_33.146297192436441e-72
KLLA0E23056g8182406069e-67
CAGL0G06182g6812385471e-59
AFR049W7172965182e-55
Scas_654.225802474203e-43
CAGL0J05830g6072382444e-21
KLLA0A08206g23057890.010
ADR241C993117712.3
KLLA0B08976g30580659.7
BLASTP 2.2.26 [Sep-21-2011]

Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, 
Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), 
"Gapped BLAST and PSI-BLAST: a new generation of protein database search
programs",  Nucleic Acids Res. 25:3389-3402.

Reference for compositional score matrix adjustment: Altschul, Stephen F., 
John C. Wootton, E. Michael Gertz, Richa Agarwala, Aleksandr Morgulis,
Alejandro A. Schaffer, and Yi-Kuo Yu (2005) "Protein database searches
using compositionally adjusted substitution matrices", FEBS J. 272:5101-5109.

Query= YHR131C
         (826 letters)

Database: blastdb 
           34,618 sequences; 16,596,109 total letters

Searching..................................................done

                                                                 Score    E
Sequences producing significant alignments:                      (bits) Value

YHR131C (YHR131C) [2417] chr8 complement(365342..367864) Protein...  1296   0.0  
Scas_697.17                                                           269   7e-79
YNL144C (YNL144C) [4452] chr14 complement(352820..355042) Protei...   255   2e-73
Kwal_33.14629                                                         252   1e-72
KLLA0E23056g complement(2044323..2046779) weakly similar to sp|P...   238   9e-67
CAGL0G06182g 589050..591095 similar to sp|P38835 Saccharomyces c...   215   1e-59
AFR049W [3241] [Homologous to ScYNL144C - SH; ScYHR131C - SH] co...   204   2e-55
Scas_654.22                                                           166   3e-43
CAGL0J05830g complement(552107..553930) some similarities with s...    99   4e-21
KLLA0A08206g 730940..731632 no similarity, hypothetical start          39   0.010
ADR241C [1982] [Homologous to ScYLR039C (RIC1) - SH] (1123202..1...    32   2.3  
KLLA0B08976g complement(786122..787039) weakly similar to sp|P32...    30   9.7  

>YHR131C (YHR131C) [2417] chr8 complement(365342..367864) Protein
           containing a pleckstrin homology (PH) domain, which
           mediate protein-protein and protein-lipid interactions,
           has low similarity to uncharacterized S. cerevisiae
           Ynl144p [2523 bp, 840 aa]
          Length = 840

 Score = 1296 bits (3354), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 693/787 (88%), Positives = 693/787 (88%)

Query: 1   MANNRIERLKSPSSSSTCSMDEVLITSSNNSSSICLETMRQLPREGVSGQINIIKETAAS 60
           MANNRIERLKSPSSSSTCSMDEVLITSSNNSSSICLETMRQLPREGVSGQINIIKETAAS
Sbjct: 1   MANNRIERLKSPSSSSTCSMDEVLITSSNNSSSICLETMRQLPREGVSGQINIIKETAAS 60

Query: 61  SSSHAALFIKQDLYEHIDPLPAYPPSYDLVNPNKEVRFPIFGDTAPCPKSSLPPLYAPAV 120
           SSSHAALFIKQDLYEHIDPLPAYPPSYDLVNPNKEVRFPIFGDTAPCPKSSLPPLYAPAV
Sbjct: 61  SSSHAALFIKQDLYEHIDPLPAYPPSYDLVNPNKEVRFPIFGDTAPCPKSSLPPLYAPAV 120

Query: 121 YELTLISLKLERLSPYEISSNRSWRNFIIEINSTQLNFYHIDESLTKHIRNYSSGETKSE 180
           YELTLISLKLERLSPYEISSNRSWRNFIIEINSTQLNFYHIDESLTKHIRNYSSGETKSE
Sbjct: 121 YELTLISLKLERLSPYEISSNRSWRNFIIEINSTQLNFYHIDESLTKHIRNYSSGETKSE 180

Query: 181 KEDRIHSDLVHRSDQSQHLHHRLFTLPTRSASEFKKADQERISYRVKRDRSRYLTDEALY 240
           KEDRIHSDLVHRSDQSQHLHHRLFTLPTRSASEFKKADQERISYRVKRDRSRYLTDEALY
Sbjct: 181 KEDRIHSDLVHRSDQSQHLHHRLFTLPTRSASEFKKADQERISYRVKRDRSRYLTDEALY 240

Query: 241 KSFTLQNARFGIPTDYTKKSFVLRMSCESEQFLLRFSHIDDMIDWSMYLSIGISVSLDLE 300
           KSFTLQNARFGIPTDYTKKSFVLRMSCESEQFLLRFSHIDDMIDWSMYLSIGISVSLDLE
Sbjct: 241 KSFTLQNARFGIPTDYTKKSFVLRMSCESEQFLLRFSHIDDMIDWSMYLSIGISVSLDLE 300

Query: 301 VREYPDYRIVPXXXXXXXXXXXXXXHTHRSESSMGSFSQRFIRSNSRPDLIQRYXXXXXX 360
           VREYPDYRIVP              HTHRSESSMGSFSQRFIRSNSRPDLIQRY      
Sbjct: 301 VREYPDYRIVPRRRRRRRRRRRRRRHTHRSESSMGSFSQRFIRSNSRPDLIQRYSTGSST 360

Query: 361 XXXXXIRERSNTFTAGLLDHYCTGLSKTPTEXXXXXXXXXXXXXXXTLGSTRSLSGCSAS 420
                IRERSNTFTAGLLDHYCTGLSKTPTE               TLGSTRSLSGCSAS
Sbjct: 361 NNNTTIRERSNTFTAGLLDHYCTGLSKTPTEALISSAASGESSDNSTLGSTRSLSGCSAS 420

Query: 421 RSIASRSLKFKIKNFFRPKNSSRTEKLHXXXXXXXXXXXVIETXXXXXXXXXXXXXXPEP 480
           RSIASRSLKFKIKNFFRPKNSSRTEKLH           VIET              PEP
Sbjct: 421 RSIASRSLKFKIKNFFRPKNSSRTEKLHRLRSNSSNLNSVIETEEDDEHHESSGGDHPEP 480

Query: 481 GVPVNTTIKVERPMHRNRAISMPQRQSLRRAISEEVVPIKFPNSTVGESVHSPSPIEHLS 540
           GVPVNTTIKVERPMHRNRAISMPQRQSLRRAISEEVVPIKFPNSTVGESVHSPSPIEHLS
Sbjct: 481 GVPVNTTIKVERPMHRNRAISMPQRQSLRRAISEEVVPIKFPNSTVGESVHSPSPIEHLS 540

Query: 541 VDGCEIMLQSQNAVMKEELRSVASNLVANERDEASIRPKPQSSSIYLSGLAPNGESATDL 600
           VDGCEIMLQSQNAVMKEELRSVASNLVANERDEASIRPKPQSSSIYLSGLAPNGESATDL
Sbjct: 541 VDGCEIMLQSQNAVMKEELRSVASNLVANERDEASIRPKPQSSSIYLSGLAPNGESATDL 600

Query: 601 SQSSRSLCLTNRDAEIXXXXXXXXXXXXXXXXXXXXYAGXXXXXXXXXSNIGYAYGSESD 660
           SQSSRSLCLTNRDAEI                    YAG         SNIGYAYGSESD
Sbjct: 601 SQSSRSLCLTNRDAEINDDESATETDEDENDGETDEYAGDDTNDDTDDSNIGYAYGSESD 660

Query: 661 YSCLIEERIRNRRRASSTLSCFSNIPYGTDDIKWKPAIKEISRRRYLRDSLKCIKPFLDS 720
           YSCLIEERIRNRRRASSTLSCFSNIPYGTDDIKWKPAIKEISRRRYLRDSLKCIKPFLDS
Sbjct: 661 YSCLIEERIRNRRRASSTLSCFSNIPYGTDDIKWKPAIKEISRRRYLRDSLKCIKPFLDS 720

Query: 721 NDCLGKVIYIPVSGPTFETSNKIHFSNRQSLQKQKNHFLKGFIVGPTALIELNCKNKNAI 780
           NDCLGKVIYIPVSGPTFETSNKIHFSNRQSLQKQKNHFLKGFIVGPTALIELNCKNKNAI
Sbjct: 721 NDCLGKVIYIPVSGPTFETSNKIHFSNRQSLQKQKNHFLKGFIVGPTALIELNCKNKNAI 780

Query: 781 VGTTKDA 787
           VGTTKDA
Sbjct: 781 VGTTKDA 787

>Scas_697.17
          Length = 694

 Score =  269 bits (687), Expect = 7e-79,   Method: Compositional matrix adjust.
 Identities = 126/237 (53%), Positives = 171/237 (72%), Gaps = 16/237 (6%)

Query: 71  QDLYEHIDPLPAYPPSYDLVNPNKEVRFPIFGDTAPCPKSSLPPLYAPAVYELTLISLKL 130
            +  + ID  P  PP+Y+ +NPNK + FPI+  TAPCP + LPP Y PAV ELT++S+KL
Sbjct: 86  NEFLQCIDHKPVSPPNYNEMNPNKRINFPIWEHTAPCPINELPPSYKPAVEELTIVSMKL 145

Query: 131 ERLSPYEISSNRSWRNFIIEINSTQLNFYHIDESLTKHIRNYSSGETKSEKEDRIHSDLV 190
           E LSPY++S  R+W+N I+EINSTQLNFYHIDESLT HIRNYS+  + S    +  +   
Sbjct: 146 EWLSPYDVSPLRTWKNLIMEINSTQLNFYHIDESLTSHIRNYSNDSSSSSPSKQRST--- 202

Query: 191 HRSDQSQHLHHRLFTLPTRSASEFKKADQERISYRVKRDRSRYLTDEALYKSFTLQNARF 250
                        F+   R+  EF K DQE+I++R+KR++  YL+++ LYKS++LQ A+F
Sbjct: 203 -------------FSFGNRTTYEFNKNDQEQIAFRIKRNKKLYLSNDKLYKSYSLQFAKF 249

Query: 251 GIPTDYTKKSFVLRMSCESEQFLLRFSHIDDMIDWSMYLSIGISVSLDLEVREYPDY 307
           G+P DY KK++VLR+ CESEQFLL F+H+DDMI W+MYL++GISV+LDLE+R  PDY
Sbjct: 250 GLPIDYKKKTYVLRLRCESEQFLLNFAHVDDMIMWTMYLNMGISVALDLELRALPDY 306

 Score = 89.0 bits (219), Expect = 6e-18,   Method: Compositional matrix adjust.
 Identities = 41/120 (34%), Positives = 66/120 (55%), Gaps = 18/120 (15%)

Query: 672 RRRASSTLSCFSNIPYGTDDIKWKPAIKEISRRRYLRDSLKCIKPFLDSNDCLGKVIYIP 731
           RRR SS +S  S++PY +D+IKW P +K   RR+Y+R+SL+CI PF++  + +  ++  P
Sbjct: 559 RRRTSSLISTMSSVPYSSDEIKWTPPLKITPRRKYIRNSLRCIVPFIEETNWIDNIVVKP 618

Query: 732 VSGPTFETSNK------------------IHFSNRQSLQKQKNHFLKGFIVGPTALIELN 773
            +GP F+T+N                      ++   L + KNH+LK ++VGP      N
Sbjct: 619 TAGPKFKTNNSPIAGSLDSTCTSYRKKLLAGCTSGSDLNRVKNHYLKAYVVGPAKFKRAN 678

>YNL144C (YNL144C) [4452] chr14 complement(352820..355042) Protein
           of unknown function, has low similarity to
           uncharacterized S. cerevisiae Yhr131p [2223 bp, 740 aa]
          Length = 740

 Score =  255 bits (651), Expect = 2e-73,   Method: Compositional matrix adjust.
 Identities = 130/310 (41%), Positives = 190/310 (61%), Gaps = 17/310 (5%)

Query: 9   LKSPSSSSTCSMDEVLITSSNNSSSICLETMRQLPREGVSG----QINIIKETAASSSSH 64
           LK   ++S+ SM +  + SS  S+SI    + ++    +        NI+ E     S  
Sbjct: 20  LKLSQTASSISMGDEFLCSSTTSNSILDSPLPKVTFNHIDSITDINTNIMNEIVEPQSGV 79

Query: 65  AALFIKQDLYEHIDPLPAYPPSYDLVNPNKEVRFPIFGDTAPCPKSSLPPLYAPAVYELT 124
                 +++   IDP P  PP YD  NP+K +R+PI+    PC  S  PP Y P+V   T
Sbjct: 80  DVDVADKNVLYCIDPYPVEPPCYDFANPSKVIRYPIYEHCRPCLTSVKPPSYTPSVEHYT 139

Query: 125 LISLKLERLSPYEISSNRSWRNFIIEINSTQLNFYHIDESLTKHIRNYSSGETKSEKEDR 184
           ++S+K+E+LSP+E +S+R W NFI++INSTQ+NFY ID+SLT+HI+NY  G+        
Sbjct: 140 VVSMKMEKLSPFENASSRLWNNFILQINSTQINFYSIDDSLTRHIKNYRGGDM------- 192

Query: 185 IHSDLVHRSDQSQHLHHR----LFTLPTRSASEFKKADQERISYRVKRDRSRYLTDEALY 240
              D  H S  +   HH     L    T+S  +F K D+ERI   + RD  ++L+DE L+
Sbjct: 193 --FDHSHHSKTASDRHHSARSLLNAFTTKSTYQFDKYDKERICGEIARDEHKFLSDERLF 250

Query: 241 KSFTLQNARFGIPTDYTKKSFVLRMSCESEQFLLRFSHIDDMIDWSMYLSIGISVSLDLE 300
           KS++LQ A+ G+P DY+ + FVLRM CE +QFL++FSH+D++I W+MYL++GIS+SLDLE
Sbjct: 251 KSYSLQCAKVGLPIDYSSRDFVLRMRCEGQQFLVQFSHVDELIYWAMYLNMGISLSLDLE 310

Query: 301 VREYPDYRIV 310
           +RE P YR V
Sbjct: 311 LREMPTYRSV 320

 Score = 76.3 bits (186), Expect = 5e-14,   Method: Compositional matrix adjust.
 Identities = 38/102 (37%), Positives = 61/102 (59%), Gaps = 5/102 (4%)

Query: 678 TLSCFSNIPYGTDDIKWKPAIKEISRRRYLRDSLKCIKPFLDSNDCLGKVIYIPVSGPTF 737
           +L C  N    ++D KW PA + +SR+RY++DSL+CIKP  + +  +GK+I+ P   P F
Sbjct: 626 SLKC-GNKNQSSNDSKWAPATQLVSRKRYIKDSLRCIKPLTEDHPWVGKIIFKPALPPAF 684

Query: 738 ETSN---KIHFS-NRQSLQKQKNHFLKGFIVGPTALIELNCK 775
           ET+N   +++   +   L   KNH+LK +IVG    ++   K
Sbjct: 685 ETNNPPIRVYSGEDSTDLMHVKNHYLKPYIVGSCGFLKTGSK 726

>Kwal_33.14629
          Length = 719

 Score =  252 bits (644), Expect = 1e-72,   Method: Compositional matrix adjust.
 Identities = 124/243 (51%), Positives = 174/243 (71%), Gaps = 12/243 (4%)

Query: 70  KQDLYEHIDPLPAYPPSYDLVNPNKEVRFPIFGDTAPCPKSSLPPLYAPAVYELTLISLK 129
           ++DL+  IDPLPA PPSY   +P++ V FP++         SLP  Y+PAV  +T++S+K
Sbjct: 71  QEDLFSWIDPLPAKPPSYKSSDPSRRVTFPVY---ETLDDGSLPG-YSPAVEAITVVSMK 126

Query: 130 LERLSPYEISSNRSWRNFIIEINSTQLNFYHIDESLTKHIRNYSSGETKSEKEDRIHSDL 189
           LE L PY  S +RSW+NF++EINSTQLNFY ID +LT+ I+NY +G++    E  +   L
Sbjct: 127 LEWLDPYTCSPSRSWKNFVMEINSTQLNFYLIDPALTRGIKNYCNGKSHFGGE-HLDPSL 185

Query: 190 VHRSDQSQHLHHRLFT-LPTRSASEFKKADQERISYRVKRDRSRYLTDEALYKSFTLQNA 248
            + S      HH +F+ L +++  +F KADQE IS ++  ++S+YLTD  L++S++LQ A
Sbjct: 186 EYES------HHSIFSSLSSKNTYQFNKADQECISKKISNNKSKYLTDNKLFRSYSLQFA 239

Query: 249 RFGIPTDYTKKSFVLRMSCESEQFLLRFSHIDDMIDWSMYLSIGISVSLDLEVREYPDYR 308
           ++GIPTDY +K+FVLR+ CE+EQF+L FSH+DDMI W+MYLSIGI VSLDL+ RE P YR
Sbjct: 240 KYGIPTDYNRKTFVLRVRCETEQFMLSFSHVDDMIMWNMYLSIGIGVSLDLDFRELPTYR 299

Query: 309 IVP 311
            VP
Sbjct: 300 TVP 302

 Score =  113 bits (282), Expect = 2e-25,   Method: Compositional matrix adjust.
 Identities = 62/146 (42%), Positives = 84/146 (57%), Gaps = 22/146 (15%)

Query: 652 GYAYGSESDYSCLIEERIRNRRRASSTLSCFSNIPYGTDDIKWKPAIKEISRRRYLRDSL 711
           G  + SE DY  +++     RRRASS  S  S+ PYG+ D+KW P  KE+SRRRY+RDSL
Sbjct: 573 GIFHDSEDDYYYVVDRNDAFRRRASSVTSNLSSTPYGSGDVKWHPPRKEMSRRRYIRDSL 632

Query: 712 KCIKPFLDSNDCLGKVIYIPVSGPTFETSN--------------KIHFSNRQS------- 750
           +CIKP  D+ + LGKV+  PVS P ++T+N              K   S  +S       
Sbjct: 633 RCIKPLPDNEEWLGKVLIRPVSAPDYDTNNPPISGFVGGTGKSGKSKASPNKSSKSDKGV 692

Query: 751 -LQKQKNHFLKGFIVGPTALIELNCK 775
            LQK KNH+ K +IVGP  L++ N +
Sbjct: 693 ILQKCKNHYAKPYIVGPVGLLKTNAR 718

>KLLA0E23056g complement(2044323..2046779) weakly similar to
           sp|P38835 Saccharomyces cerevisiae YHR131c, start by
           similarity
          Length = 818

 Score =  238 bits (606), Expect = 9e-67,   Method: Compositional matrix adjust.
 Identities = 117/240 (48%), Positives = 166/240 (69%), Gaps = 14/240 (5%)

Query: 72  DLYEHIDPLPAYPPSYDLVNPNKEVRFPIFGDTAPCPKSSLPPLYAPAVYELTLISLKLE 131
           + ++ +D  P  PPSY  VN N+ + +PI+         ++ P Y+PAV  +T+ISLK E
Sbjct: 124 EYFQWVDNAPRRPPSYKSVNSNRRITYPIYETL----DDNVLPGYSPAVKAITVISLKQE 179

Query: 132 RLSPYEISSNRSWRNFIIEINSTQLNFYHIDESLTKHIRNYSSGETKSEKEDRIHSDLVH 191
            L+PYE+SS+R+W+NFI+EINSTQLNFYHI ESLT +I+NY  G T    +       ++
Sbjct: 180 WLNPYELSSSRAWKNFIMEINSTQLNFYHIHESLTSNIKNYYGGPTNFPND-------LN 232

Query: 192 RSDQSQHLHHRLFTLPTRSASEFKKADQERISYRVKRDRSRYLTDEALYKSFTLQNARFG 251
            S QS      L +L ++S  +F ++DQ+ I+  ++ +  +YL+++ L+KSF+LQ  +FG
Sbjct: 233 SSKQSTRF---LPSLHSKSTYQFNRSDQQWITKMIQSNEKKYLSNDMLFKSFSLQYGKFG 289

Query: 252 IPTDYTKKSFVLRMSCESEQFLLRFSHIDDMIDWSMYLSIGISVSLDLEVREYPDYRIVP 311
           IPTDYTKK+FVLR+ CE +QFL+ F+H+DDMIDWS+ LSIGI VSLDL  RE P YR VP
Sbjct: 290 IPTDYTKKTFVLRLRCELQQFLINFAHVDDMIDWSVSLSIGIDVSLDLAYREMPTYRTVP 349

 Score = 90.9 bits (224), Expect = 2e-18,   Method: Compositional matrix adjust.
 Identities = 53/141 (37%), Positives = 74/141 (52%), Gaps = 24/141 (17%)

Query: 652 GYAYGSESDYSCLIEERIRNRRRASSTLSCFSNIPYGTDDIKWKPAIKEISRRRYLRDSL 711
           G  + S+ DY  +  E   +RRR SS  S  SN PYG D++KW P  KEI+RRRY+RDSL
Sbjct: 674 GIFHDSDDDYIYVPTEI--HRRRTSSITSNLSNTPYGGDEMKWNPPRKEITRRRYIRDSL 731

Query: 712 KCIKPFLDSNDCLGKVIYIPVSGPTFETSN----------KIHFSNRQSLQKQ------- 754
           +CIKP       + K+   P  GP +ET+N           +   N+ SL+K        
Sbjct: 732 RCIKPLGFDESWVNKIALAPSMGPKYETNNPPVSGFISNSDLSSKNKFSLKKLYNTQPAL 791

Query: 755 -----KNHFLKGFIVGPTALI 770
                KNH+L  +I+ P+ L+
Sbjct: 792 LLSRCKNHYLTPYIITPSGLV 812

>CAGL0G06182g 589050..591095 similar to sp|P38835 Saccharomyces
           cerevisiae YHR131c, start by similarity
          Length = 681

 Score =  215 bits (547), Expect = 1e-59,   Method: Compositional matrix adjust.
 Identities = 106/238 (44%), Positives = 155/238 (65%), Gaps = 20/238 (8%)

Query: 75  EHIDPLPAYPPSYDLVNPNKEVRFPIFGDTAPCPKSSLPPLYAPAVYELTLISLKLERLS 134
           E ID  PA PP YD VN N+ V FPI+ D  PC  +  PP Y P VY + ++S+KLE LS
Sbjct: 53  EIIDGEPASPPDYDEVNYNRHVTFPIWEDLTPCSMTEKPPAYHPTVYNVAIVSVKLEWLS 112

Query: 135 PYEISSNRSWRNFIIEINSTQLNFYHIDESLTKHIRNYSSGETKSEKEDRIHSDLVHRSD 194
           P+E S NRSWR FI+EINSTQ+NFY ++    + ++NY +               +   D
Sbjct: 113 PFEPSPNRSWRTFIMEINSTQINFYALEPEFHRLVKNYYN---------------LKYDD 157

Query: 195 QSQHLHHRLFTLP-TRSASEFKKADQE----RISYRVKRDRSRYLTDEALYKSFTLQNAR 249
            ++ L   + +L  ++  ++ K  D E    R++ +++R+ S+YL+D  LY+SFTLQ AR
Sbjct: 158 GAKSLAKGILSLGNSKKKNDNKIVDTEPHWKRLNAKLERNYSKYLSDARLYRSFTLQYAR 217

Query: 250 FGIPTDYTKKSFVLRMSCESEQFLLRFSHIDDMIDWSMYLSIGISVSLDLEVREYPDY 307
            GIPTDY K +  LR+ CE+EQFL+ F ++DD+I+WSMY+++GISV+LDL+ R+ P+Y
Sbjct: 218 MGIPTDYRKSAHALRLRCEAEQFLVAFDNVDDLINWSMYINMGISVALDLDCRQLPNY 275

 Score = 85.9 bits (211), Expect = 5e-17,   Method: Compositional matrix adjust.
 Identities = 53/149 (35%), Positives = 78/149 (52%), Gaps = 26/149 (17%)

Query: 652 GYAYGSESDYSCLIEERIRNRRRASSTLSCFSNIPYG-TDDIKWKPAIKEISRRRYLRDS 710
           G  + SESDY    E+R   R RA+ST S    I +   DD+KW P  K +SRRRY++DS
Sbjct: 526 GLVHESESDY--YYEQRRLTRSRAASTASNM--ISHADADDVKWMPPQKILSRRRYVKDS 581

Query: 711 LKCIKPFLDSNDCLGKVIYIPVSGPTFETSNK---------------------IHFSNRQ 749
           L+CIK F++ +  +G+V+  P   P+F+T+N                      ++ S  +
Sbjct: 582 LRCIKGFVEHSSWMGRVVCCPTGPPSFKTNNDLVLLNGKKIDEKTVGNSRNKIVNSSGDK 641

Query: 750 SLQKQKNHFLKGFIVGPTALIELNCKNKN 778
           S  K KNHFL+ +I+ PT  I +     N
Sbjct: 642 SYWKTKNHFLQLYIIEPTGYIPITALEAN 670

>AFR049W [3241] [Homologous to ScYNL144C - SH; ScYHR131C - SH]
           complement(517312..519465) [2154 bp, 717 aa]
          Length = 717

 Score =  204 bits (518), Expect = 2e-55,   Method: Compositional matrix adjust.
 Identities = 122/296 (41%), Positives = 169/296 (57%), Gaps = 31/296 (10%)

Query: 12  PSSSSTCSMDEVLITSSNNSSSICLETMRQLPREGVSGQINIIKETAASSSSHAALFIKQ 71
           PSS ST S+D V   S ++ S         LP+   SG++        S   HA      
Sbjct: 24  PSSVSTSSVDGVTTLSYDSRS------HGSLPQ---SGEVE-------SGELHA------ 61

Query: 72  DLYEHIDPLPAYPPSYDLVNPNKEVRFPIFGDTAPCPKSSLPPLYAPAVYELTLISLKLE 131
           D+   + P PA PP Y  VNPN+ +R+PI+       +++  P YAPAV+EL L+S+K E
Sbjct: 62  DVLAVLQPQPARPPPYYAVNPNRRIRYPIYERE----ETNELPAYAPAVHELALVSVKQE 117

Query: 132 RLSPYEISSNRSWRNFIIEINSTQLNFYHIDESLTKHIRNYSSGETKSEKEDRIHSDLVH 191
             SPYE + +RSWR  ++E+NSTQLNFYH+DE L + +R  ++  T      +  S L  
Sbjct: 118 WASPYEPAVSRSWRTLLMELNSTQLNFYHVDEGLLRGLRGRAADSTLGVACAQAVSSLSF 177

Query: 192 RSDQSQHLHHRLFTLPTRSASEFKKADQERISYRVKRDRSRYLTDEALYKSFTLQNARFG 251
                Q     L  L  R   +   A Q+ +  R +RD  R+L  E LYKS++LQ A FG
Sbjct: 178 ----GQVKAGTLLAL-GRDERQLSPAHQQHVCARAQRDPERHLCAERLYKSYSLQYATFG 232

Query: 252 IPTDYTKKSFVLRMSCESEQFLLRFSHIDDMIDWSMYLSIGISVSLDLEVREYPDY 307
           +P DYTK+SFVLR+ CE+EQFL+ F  +D +I WS+ LS+GI VSLDL+ R+ P Y
Sbjct: 233 VPMDYTKRSFVLRLRCETEQFLVCFGTVDMLISWSVSLSVGIGVSLDLDHRKMPAY 288

 Score = 62.8 bits (151), Expect = 8e-10,   Method: Compositional matrix adjust.
 Identities = 40/117 (34%), Positives = 61/117 (52%), Gaps = 18/117 (15%)

Query: 672 RRRASSTLSCFSNIPYGTD--DIKWKPAIKEISRRRYLRDSLKCIKPFLDSNDCLGKVIY 729
           R+RA S  S  S  PYG      KW P +KE +RRR++RDS++CI+P  D +  LG ++ 
Sbjct: 592 RQRAHSAASSLSFAPYGYSFSREKWVPPVKESTRRRFVRDSIRCIRPLCDDDTWLGALVV 651

Query: 730 IPVSGPTFETS--------NKIHFSNRQSLQK--------QKNHFLKGFIVGPTALI 770
            P +GP   +S              +R+SL++        +   F+K +IVGP  L+
Sbjct: 652 SPSAGPGSSSSGFPFDLGLGSKRLGSRRSLKRGSQSLSGTRAARFMKAYIVGPVGLV 708

>Scas_654.22
          Length = 580

 Score =  166 bits (420), Expect = 3e-43,   Method: Compositional matrix adjust.
 Identities = 91/247 (36%), Positives = 149/247 (60%), Gaps = 29/247 (11%)

Query: 76  HIDPLPAYPPSYDLVNPNKEVRFPIFGDTAPCPKSSLPPLYAPAVYELTLISLKLER--- 132
           HIDP P  PP YD +NP++++ FPI+       +   PP Y+PAV E+TL+S+KLE    
Sbjct: 93  HIDPYPVEPPRYDTMNPSRKISFPIYETYHDTIQQPAPPSYSPAVDEITLVSMKLEWESP 152

Query: 133 LSPYEISSNRSWRNFIIEINSTQLNFYHIDESLTKHIRNYSSGETKSEKEDRIHSDLVHR 192
           ++P   ++ R W+  ++E+NSTQLNFY +D  L   ++  + G  K+       +     
Sbjct: 153 MAPIRYAAQR-WKIVLMEVNSTQLNFYDVDALLQSQLKK-TIGPRKNS------TLFGMN 204

Query: 193 SDQSQHLHHRLFTLPTRSASEFKKADQERISYRVKRDRSRYLTDEALYKSFTLQNARFGI 252
           +++++ +  + +T          K+D E+I   ++R++S+YL D  L KS++LQ  R G 
Sbjct: 205 NNRNEDITFQSYT----------KSDNEKICQLIRRNKSKYLHDANLVKSYSLQFGRVGF 254

Query: 253 PTDYTKKS--------FVLRMSCESEQFLLRFSHIDDMIDWSMYLSIGISVSLDLEVREY 304
           PTD + K+          LR+ CE++QFLL+F+ +D +I  ++++ +GISVSLDL++RE 
Sbjct: 255 PTDLSSKNKGKRTSDPIALRLRCEAQQFLLQFTDMDSLIMSAVHIDMGISVSLDLQIREL 314

Query: 305 PDYRIVP 311
           P YRIVP
Sbjct: 315 PTYRIVP 321

 Score = 79.0 bits (193), Expect = 5e-15,   Method: Compositional matrix adjust.
 Identities = 39/95 (41%), Positives = 55/95 (57%), Gaps = 5/95 (5%)

Query: 690 DDIKWKPAIKEISRRRYLRDSLKCIKPFLDSNDCLGKVIYIPVSGPTFETSNKIHFSNR- 748
           DD KW P  K+ SRRRY+RDSL+CIK   +++  +GKV++ P   P+FET+N   F  + 
Sbjct: 480 DDYKWSPTSKQTSRRRYVRDSLRCIKSMTENHKWVGKVVFCPTKAPSFETNNLPLFIGKG 539

Query: 749 ----QSLQKQKNHFLKGFIVGPTALIELNCKNKNA 779
                     KNH+LK  +VG   LI+   K  +A
Sbjct: 540 PHASTVYDTTKNHYLKAHVVGAWRLIKAGSKIYDA 574

>CAGL0J05830g complement(552107..553930) some similarities with
           sp|P53907 Saccharomyces cerevisiae YNL144c or sp|P38835
           Saccharomyces cerevisiae YHR131c, hypothetical start
          Length = 607

 Score = 98.6 bits (244), Expect = 4e-21,   Method: Compositional matrix adjust.
 Identities = 73/238 (30%), Positives = 107/238 (44%), Gaps = 41/238 (17%)

Query: 114 PLYAPAVYELTLISLKLERLSPYEISSNRSWRNFIIEINSTQLNFY----HIDESLTKHI 169
           P Y+PAV +      KLE  SP ++S +  W + ++ INSTQLN Y          +K +
Sbjct: 41  PGYSPAVEKFVRAKFKLEWESPTQVSRDPCWYDVVLHINSTQLNLYLPRCPKSRPASKSL 100

Query: 170 RNYSSGETKSEKEDRIHSDLVHRSDQSQHLHHRLFTLPTRSA--SEFKKADQERISYRVK 227
            +Y S +       R+                 L   PT +   + ++   Q+ +  R K
Sbjct: 101 -SYVSAKPSVSGVRRLSERFTRFKKNYLPAFEPLDFHPTPAGFTNSYQNMPQDALGARKK 159

Query: 228 RDRSRYLTDEALYKSF--------------------TLQNARFGIPTDYTKKS------- 260
           R        +  Y+ +                    +LQ A+ G+PT  ++K        
Sbjct: 160 RSNQYDFIYDTNYEEYCSETCDSMDVSTGFVPFKSYSLQGAKVGMPTSESRKKVYIDEEN 219

Query: 261 -------FVLRMSCESEQFLLRFSHIDDMIDWSMYLSIGISVSLDLEVREYPDYRIVP 311
                    LR+  E +QFL++F HIDDMI WSMYLS+GI+VS DL  REYP+YRIVP
Sbjct: 220 VYKDAYLVCLRLRMEDQQFLVQFEHIDDMIMWSMYLSMGINVSKDLYDREYPNYRIVP 277

 Score = 47.0 bits (110), Expect = 6e-05,   Method: Compositional matrix adjust.
 Identities = 26/75 (34%), Positives = 39/75 (52%), Gaps = 7/75 (9%)

Query: 691 DIKWKPAIKEISRRRYLRDSLKCIKPFLDSNDCLGKVIYIPVSGPTFETSNKIHFSNRQS 750
           D KW P  KE +R+RY+R SL+CI+P        G+ IY+          NK++  N   
Sbjct: 536 DTKWNPVKKEQTRKRYIRHSLRCIRPLAPDAKWEGETIYVKAG-----LRNKMY--NPSL 588

Query: 751 LQKQKNHFLKGFIVG 765
           L+  K + ++  IVG
Sbjct: 589 LKDIKPYLMETKIVG 603

>KLLA0A08206g 730940..731632 no similarity, hypothetical start
          Length = 230

 Score = 38.9 bits (89), Expect = 0.010,   Method: Compositional matrix adjust.
 Identities = 22/57 (38%), Positives = 32/57 (56%), Gaps = 5/57 (8%)

Query: 241 KSFTLQNARFGIPTDYTKKSFVLRMSCESEQFLLRFSHIDDMIDWSMYLSIGISVSL 297
           K ++LQ+ R G+ TD ++    LR+ CE EQFLLR    DD    S++  I  +  L
Sbjct: 156 KKYSLQDCRIGLNTDMSR---CLRIRCEREQFLLRVP--DDASVTSLFAKIACAAEL 207

>ADR241C [1982] [Homologous to ScYLR039C (RIC1) - SH]
           (1123202..1126183) [2982 bp, 993 aa]
          Length = 993

 Score = 32.0 bits (71), Expect = 2.3,   Method: Compositional matrix adjust.
 Identities = 32/117 (27%), Positives = 53/117 (45%), Gaps = 10/117 (8%)

Query: 669 IRNRRRASSTLSCFSN-IPYGTDD---IKWKPAIKEISRRRYLRDSLKCIKPFLDSNDCL 724
           +  +  A ++L+CF N I  G+ D   I W P  +EIS +       K   P +  N   
Sbjct: 395 MNGKSLACTSLNCFDNTILIGSADGHLITW-PMWQEISNQSI---DFKHDTPLILCNKHN 450

Query: 725 GKVIYIPVSGPTFETSNKIHFSNRQSLQKQKNHFLKGFIVGPTALIELNCKNKNAIV 781
             +I  P++ PT E +     S    L++  NH L   + GP  L+ +   N+N ++
Sbjct: 451 DLMISSPLNCPTLEQNLMQVIS--LPLKELNNHILAARLNGPQNLLAVYISNRNILL 505

>KLLA0B08976g complement(786122..787039) weakly similar to sp|P32605
           Saccharomyces cerevisiae YBR119w MUD1 U1 snRNP-specific
           A protein singleton, start by similarity
          Length = 305

 Score = 29.6 bits (65), Expect = 9.7,   Method: Compositional matrix adjust.
 Identities = 22/80 (27%), Positives = 39/80 (48%), Gaps = 10/80 (12%)

Query: 540 SVDGCEIMLQSQNAVMKEELRSVASNLVANERDEASIRP---KPQSSSIYLSGLAPNGES 596
           +VD  +   +++N V+K  LR   S L   + DE +I+    KP+ ++       P G +
Sbjct: 154 AVDNSQPKTKTKNEVLKRRLRRARSKLRKKDLDEETIQKLLSKPRKTN-------PEGTN 206

Query: 597 ATDLSQSSRSLCLTNRDAEI 616
            T +SQ S  +  T +  +I
Sbjct: 207 KTAMSQQSEKVSSTKKVFDI 226

  Database: blastdb
    Posted date:  Apr 3, 2006  3:33 PM
  Number of letters in database: 16,596,109
  Number of sequences in database:  34,618
  
Lambda     K      H
   0.316    0.130    0.373 

Gapped
Lambda     K      H
   0.267   0.0410    0.140 

Matrix: BLOSUM62
Gap Penalties: Existence: 11, Extension: 1
Number of Sequences: 34618
Number of Hits to DB: 22,206,164
Number of extensions: 887077
Number of successful extensions: 2860
Number of sequences better than 10.0: 21
Number of HSP's gapped: 2935
Number of HSP's successfully gapped: 30
Length of query: 826
Length of database: 16,596,109
Length adjustment: 110
Effective length of query: 716
Effective length of database: 12,788,129
Effective search space: 9156300364
Effective search space used: 9156300364
Neighboring words threshold: 11
Window for multiple hits: 40
X1: 16 ( 7.3 bits)
X2: 38 (14.6 bits)
X3: 64 (24.7 bits)
S1: 41 (21.6 bits)
S2: 66 (30.0 bits)