Hit NameLength (aa)HSP LengthHSP ScoreHSP Significance
YHR034C34433915960.0
Sklu_1023.23521995655e-70
AAL062W3271925104e-62
Kwal_47.181843373274985e-60
CAGL0D03916g3443634942e-59
KLLA0C10318g3333454881e-58
Scas_690.373323474341e-50
YCL032W (STE50)34636629.3
BLASTP 2.2.26 [Sep-21-2011]

Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, 
Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), 
"Gapped BLAST and PSI-BLAST: a new generation of protein database search
programs",  Nucleic Acids Res. 25:3389-3402.

Reference for compositional score matrix adjustment: Altschul, Stephen F., 
John C. Wootton, E. Michael Gertz, Richa Agarwala, Aleksandr Morgulis,
Alejandro A. Schaffer, and Yi-Kuo Yu (2005) "Protein database searches
using compositionally adjusted substitution matrices", FEBS J. 272:5101-5109.

Query= YHR034C
         (339 letters)

Database: blastdb 
           34,618 sequences; 16,596,109 total letters

Searching..................................................done

                                                                 Score    E
Sequences producing significant alignments:                      (bits) Value

YHR034C (YHR034C) [2321] chr8 complement(176957..177991) Protein...   619   0.0  
Sklu_1023.2 YHR034C, Contig c1023 1165-2223                           222   5e-70
AAL062W [125] [Homologous to ScYHR034C - SH] complement(238295.....   201   4e-62
Kwal_47.18184                                                         196   5e-60
CAGL0D03916g complement(391089..392123) similar to sp|P38768 Sac...   194   2e-59
KLLA0C10318g complement(885031..886032) similar to sp|P38768 Sac...   192   1e-58
Scas_690.37                                                           171   1e-50
YCL032W (STE50) [511] chr3 (63441..64481) Protein required for f...    28   9.3  

>YHR034C (YHR034C) [2321] chr8 complement(176957..177991) Protein of
           unknown function, has low similarity to uncharacterized
           C. albicans Orf6.8994p [1035 bp, 344 aa]
          Length = 344

 Score =  619 bits (1596), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 309/339 (91%), Positives = 309/339 (91%)

Query: 1   MADFLLRPIKQRHRNEDKYVSVDAADGSVSKIEPIADFVIKTKLLSANGPEKLQDGRKVF 60
           MADFLLRPIKQRHRNEDKYVSVDAADGSVSKIEPIADFVIKTKLLSANGPEKLQDGRKVF
Sbjct: 1   MADFLLRPIKQRHRNEDKYVSVDAADGSVSKIEPIADFVIKTKLLSANGPEKLQDGRKVF 60

Query: 61  INVCHSPLVPKPEVDFNARIVFPLIIQNEWEIPIITSCYRMDHDKKGQECYVWDCCINSD 120
           INVCHSPLVPKPEVDFNARIVFPLIIQNEWEIPIITSCYRMDHDKKGQECYVWDCCINSD
Sbjct: 61  INVCHSPLVPKPEVDFNARIVFPLIIQNEWEIPIITSCYRMDHDKKGQECYVWDCCINSD 120

Query: 121 CSRWICDDIQLREILVEWCLESCEIRDSVVLCRDRIAFPKMKKKGAELPALEVLNDELHQ 180
           CSRWICDDIQLREILVEWCLESCEIRDSVVLCRDRIAFPKMKKKGAELPALEVLNDELHQ
Sbjct: 121 CSRWICDDIQLREILVEWCLESCEIRDSVVLCRDRIAFPKMKKKGAELPALEVLNDELHQ 180

Query: 181 DYKAKMHKIIEEEAGDPMSIXXXXXXXXXXXXXXXXXXXXXXFPIENKISGAKIEEIDKN 240
           DYKAKMHKIIEEEAGDPMSI                      FPIENKISGAKIEEIDKN
Sbjct: 181 DYKAKMHKIIEEEAGDPMSILRGRNDDGDDNNDPDDGTLPPLFPIENKISGAKIEEIDKN 240

Query: 241 EIAHRNLKQXXXXXXXXHEQQEDVPEYEVKMKRFKGAAYKLRILIENKAPNSKPDRFSPS 300
           EIAHRNLKQ        HEQQEDVPEYEVKMKRFKGAAYKLRILIENKAPNSKPDRFSPS
Sbjct: 241 EIAHRNLKQAPAPAPAPHEQQEDVPEYEVKMKRFKGAAYKLRILIENKAPNSKPDRFSPS 300

Query: 301 YNFAENILYINGKLSIPLPRDIVVNAADIKIFHIRKERT 339
           YNFAENILYINGKLSIPLPRDIVVNAADIKIFHIRKERT
Sbjct: 301 YNFAENILYINGKLSIPLPRDIVVNAADIKIFHIRKERT 339

>Sklu_1023.2 YHR034C, Contig c1023 1165-2223
          Length = 352

 Score =  222 bits (565), Expect = 5e-70,   Method: Compositional matrix adjust.
 Identities = 107/199 (53%), Positives = 137/199 (68%), Gaps = 11/199 (5%)

Query: 2   ADFLLRPIKQRHRNEDKYVSVDAADGSVSKIEPIADFVIKTKLLSANGPEKLQDGRKVFI 61
            +FLLRPI               +  SV  +EP   FVIK+KL S + P +L  G K+FI
Sbjct: 3   GNFLLRPINSTE-----------STASVLLLEPQPGFVIKSKLDSCSPPTELAIGTKIFI 51

Query: 62  NVCHSPLVPKPEVDFNARIVFPLIIQNEWEIPIITSCYRMDHDKKGQECYVWDCCINSDC 121
           NVC    VPKP  +FN  IV+PLI+ N+WEIPIITS  R D DKKG  CYVWDCCIN++C
Sbjct: 52  NVCFDNQVPKPNTEFNPSIVYPLIMNNQWEIPIITSNVREDKDKKGAICYVWDCCINTEC 111

Query: 122 SRWICDDIQLREILVEWCLESCEIRDSVVLCRDRIAFPKMKKKGAELPALEVLNDELHQD 181
             W+  D QLREILVEWCLESCE+R SV + RDRIAFPK+K+KG ++P LE+LN +L+QD
Sbjct: 112 MSWVNKDYQLREILVEWCLESCELRQSVEISRDRIAFPKLKRKGDKIPTLEILNSDLNQD 171

Query: 182 YKAKMHKIIEEEAGDPMSI 200
           ++ ++  I+E++  DP SI
Sbjct: 172 FRKEIDSIVEKDRTDPTSI 190

>AAL062W [125] [Homologous to ScYHR034C - SH]
           complement(238295..239278) [984 bp, 327 aa]
          Length = 327

 Score =  201 bits (510), Expect = 4e-62,   Method: Compositional matrix adjust.
 Identities = 105/192 (54%), Positives = 127/192 (66%), Gaps = 18/192 (9%)

Query: 3   DFLLRPIKQRHRNEDKYVSVDAADGSVSKIEPIADFVIKTKLLSANGPEKLQDGRKVFIN 62
           DFLLRPI             D+ + SV    P   FVIK+KL        L  G K F+N
Sbjct: 2   DFLLRPI-------------DSKECSVITFVPTPGFVIKSKLEHGKD-ATLVVGTKTFVN 47

Query: 63  VCHSPLVPKPEVDFNARIVFPLIIQNEWEIPIITSCYRMDHDKKGQECYVWDCCINSDCS 122
           VCH   VP P+V F+A IV+PLI++N+WEIPI+TS  R D DKKGQECYVWDCCINS+C 
Sbjct: 48  VCHHTQVPLPDVPFDASIVYPLIMENKWEIPIVTSAVRRDADKKGQECYVWDCCINSECM 107

Query: 123 RWICDDIQLREILVEWCLESCEIRDSVVLCRDRIAFPKMKKKGAELPALEVLNDELHQDY 182
           +WI  D QLREILVEWCLESCE+R SV + R+ + FP+MK KGA LPA+EVL  +L  DY
Sbjct: 108 QWIEKDYQLREILVEWCLESCELRQSVGISREAVVFPRMKSKGA-LPAVEVLQQDLTHDY 166

Query: 183 KAKMHKIIEEEA 194
           K   H+I E  +
Sbjct: 167 K---HEIAENSS 175

>Kwal_47.18184
          Length = 337

 Score =  196 bits (498), Expect = 5e-60,   Method: Compositional matrix adjust.
 Identities = 121/327 (37%), Positives = 176/327 (53%), Gaps = 26/327 (7%)

Query: 4   FLLRPIKQRHRNEDKYVSVDAADGSVSKIEPIADFVIKTKLLSA-NGPEKLQDGRKVFIN 62
           FLLR I   + + D          SV ++EP   FV+K+KL+S+ +G   L  G KVF+N
Sbjct: 3   FLLRAIDNGNNDAD----------SVVRVEPQPGFVVKSKLVSSYDGRYSL--GAKVFVN 50

Query: 63  VCHSPLVPKPEVDFNARIVFPLIIQNEWEIPIITSCYRMDHDKKGQECYVWDCCINSDCS 122
           VCH   VP+PE+ FN  +V+PLI+ N+WEIPII S  R D DKKG  CYV DCCINS C 
Sbjct: 51  VCHEDQVPQPEIPFNPSVVYPLIMTNQWEIPIIASALRQDRDKKGDLCYVCDCCINSACM 110

Query: 123 RWICDDIQLREILVEWCLESCEIRDSVVLCRDRIAFPKMKKKGAELPALEVLNDELHQDY 182
           +W   ++QLREILVEWCLESCE+R  + + R+ +AFPK++ KGA +  LEVL  +LH D+
Sbjct: 111 QWARTELQLREILVEWCLESCELRQRIEISREHLAFPKLRMKGASILPLEVLTTDLHADF 170

Query: 183 KAKMHKIIEEEAGDPMSIXXXXXXXXXXXXXXXXXXXXXXFPIENKISGAK--IEEIDKN 240
           + +M  + + EA +P SI                       P+    +  +  I+EID  
Sbjct: 171 RHEMRDLAKREA-EPASILELKRELIDADLDSTSIDSSALPPLFPSKTPTRLLIQEIDST 229

Query: 241 EIAHRNLKQXXXXXXXXHEQQEDVPEYEVKMKR--FKGAAYKLRILIENKAPNSKPDRFS 298
             + +   +         +     P +++ M +   + +  KLRI I +  P      + 
Sbjct: 230 STSSQAPAKTVSTTPPTTD-----PAFDISMGKPSAQNSQAKLRIDIVSLLPAES--DYL 282

Query: 299 PSYNFAENILYINGKLSIP-LPRDIVV 324
            SYN  EN L I+   +   LP++I +
Sbjct: 283 ISYNSNENTLTISHTNTTHFLPKEITI 309

>CAGL0D03916g complement(391089..392123) similar to sp|P38768
           Saccharomyces cerevisiae YHR034c, hypothetical start
          Length = 344

 Score =  194 bits (494), Expect = 2e-59,   Method: Compositional matrix adjust.
 Identities = 131/363 (36%), Positives = 187/363 (51%), Gaps = 51/363 (14%)

Query: 3   DFLLRPIKQRHRNEDKYVSVDAADGSVSKIEPIADFVIKTKLLSA-NGPEKL---QDGRK 58
           DFLLRPI                D  V+ + P   FVIK+K+++  N P+KL   + G K
Sbjct: 2   DFLLRPIAS------------GDDNQVTVLHPEPLFVIKSKIVNIDNRPKKLLKLEAGSK 49

Query: 59  VFINVCHSPLVPKPEVDFNARIVFPLIIQNEWEIPIITSCYRMDHDKKGQECYVWDCCIN 118
           +F+N+CH P  PKPE+ F+  IV+PLII N+WEIPI+ S  R D DKKGQ CYV DCC+ 
Sbjct: 50  IFVNLCHDPQAPKPEIPFDPNIVYPLIINNKWEIPIVASSIRTDTDKKGQVCYVIDCCVA 109

Query: 119 SDCSRWICDDIQLREILVEWCLESCEIRDSVVLCRDRIAFPKMKKKGAELPALEVLNDEL 178
           SDC +W  +D QL+EI+VEWCLE+ E+R+ + + RD+I+FPKM+KKG  +P LE+ ++EL
Sbjct: 110 SDCVKWFVEDYQLKEIVVEWCLEAAELREVIEISRDKISFPKMRKKGDSIPDLEIFSNEL 169

Query: 179 H-QDYKAKMHKIIEEEAGDPMSIXXXXXXXXXXXXXXXXXXXXX--------XFPIENKI 229
              D K        ++  DP S+                              FP  N+ 
Sbjct: 170 DGSDIKEATQ---NDKGNDPSSLLQIRRDLLSQEEDLSLSNDSDITAHGLPPLFPKANET 226

Query: 230 SG-AKIEEIDKNEIAHRNLKQXXXXXXXXHEQQEDVPEYEVKMKRFKGAAYKLRILIENK 288
            G + I+EID       +L           + Q+++ EY V MK+ +   YKLR+ I+  
Sbjct: 227 KGRSLIQEID-------DLTLKEKPKNAAKKVQKNI-EYNVVMKKIENHKYKLRLDIQID 278

Query: 289 APNSKPDR---FSPSYN--FAENI---LYINGKLSIPLPRDIVVNAADI----KIFHIRK 336
           +   K D    + P+ N     N+   LY      IPLP   +    DI    +IF++ K
Sbjct: 279 SITGKSDLNIFYDPTNNDIVLRNLNTDLYDQKDFKIPLPN--IFEGKDIMNSSEIFYVNK 336

Query: 337 ERT 339
             T
Sbjct: 337 TGT 339

>KLLA0C10318g complement(885031..886032) similar to sp|P38768
           Saccharomyces cerevisiae YHR034c singleton, start by
           similarity
          Length = 333

 Score =  192 bits (488), Expect = 1e-58,   Method: Compositional matrix adjust.
 Identities = 124/345 (35%), Positives = 182/345 (52%), Gaps = 30/345 (8%)

Query: 4   FLLRPIKQRHRNEDKYVSVDAADGSVSKIEPIADFVIKTKLLSANGPEKLQDGRKVFINV 63
           FLLRP+                  +V +I P   FV+K+K+++  G   L    K+FIN+
Sbjct: 3   FLLRPLNDSSS---------NNSNNVIRISPEPCFVVKSKVINP-GTTSLSSNAKIFINI 52

Query: 64  CHSPLVPKPEVDFNARIVFPLIIQNEWEIPIITSCYRMDHDKKGQECYVWDCCINSDCSR 123
           CH+  +P PE+DFN  IV+PLII N+WEIPI+TS  R D DKKG  CYV DCCIN+ C  
Sbjct: 53  CHNDQIPLPEIDFNPAIVYPLIINNQWEIPIVTSSIREDVDKKGNVCYVSDCCINTKCVS 112

Query: 124 WICDDIQLREILVEWCLESCEIRDSVVLCRDRIAFPKMKKKGAELPALEVLNDELHQDYK 183
           WI  D+QLREI+VEWCLESCE+R  + + RD I+FPK+KKKG  +P LE+L ++L ++Y+
Sbjct: 113 WIQHDLQLREIVVEWCLESCELRAELEISRDNISFPKLKKKGDTIPELEILREDLTENYE 172

Query: 184 AKMHKIIEEEAGDPMSIXXXXXXXXXXXXXXXXXXXXXXFPIENKISGAKIEEIDKNEIA 243
             ++ ++  E  +P+SI                         ++      IEEI+     
Sbjct: 173 ETINDLVNREQKEPVSIIEKRRDFLAEDEPSTGELPPLIPIDQSSRRKPLIEEIE----- 227

Query: 244 HRNLKQXXXXXXXXHEQQEDVPEYEVKMKRFKGAA-YKLRILIENKAPNSKPDRFSPSYN 302
             +L           E Q+    YE+ M + K  + + L+I + ++  NS  D ++  Y+
Sbjct: 228 --DLSLHETKKPKVEEIQKKSISYELSMGKPKDTSEFLLKIEVTSEL-NSSLD-YNIKYD 283

Query: 303 FAENILYING---------KLSIPLPRDIVVNAADIKIFHIRKER 338
              N L I           KL +PLP DI  N   ++ F ++ ER
Sbjct: 284 AKSNKLIIKNTNLGIYPEKKLKVPLP-DIFNNPPKLECFFVKPER 327

>Scas_690.37
          Length = 332

 Score =  171 bits (434), Expect = 1e-50,   Method: Compositional matrix adjust.
 Identities = 120/347 (34%), Positives = 167/347 (48%), Gaps = 38/347 (10%)

Query: 3   DFLLRPIKQRHRNEDKYVSVDAADGSVSKIEPIADFVIKTKLLSANGPEKLQDGRKVFIN 62
           DFL+RPI               A   +  I P   FVIK+KL   N         K+FIN
Sbjct: 7   DFLIRPIS-------------TAQDPIITIHPTPKFVIKSKLTPTNS--------KLFIN 45

Query: 63  VCHSPLVPKPEVDFNARIVFPLIIQNEWEIPIITSCYRMDHDKKGQECYVWDCCINSDCS 122
           VC    VP P + F   +V+PLI+++EWEIPI+TS  R D DKKG  C+V DC IN  C 
Sbjct: 46  VCQDANVPSPSIPFQPNVVYPLIMRDEWEIPILTSPMRQDTDKKGSPCHVCDCIINDQCM 105

Query: 123 RWICDDIQLREILVEWCLESCEIRDSVVLCRDRIAFPKMKKKGA-ELPALEVLNDELHQD 181
           +WI  D+QLREIL+EWCLE+ E+R++V + RD +  PK+  KG+  LP LE+   EL +D
Sbjct: 106 QWIAKDLQLREILIEWCLEAVELREAVTVDRDAVKLPKLTCKGSLPLPVLEIPKRELERD 165

Query: 182 YKAKMHKIIEEEAGD-PMSIXXXXXXXXXXXXXXXXXXXXXXFPIENKISGAKIEEIDKN 240
           +K  +  IIEE   D P+ +                      FP    + G  IEEID +
Sbjct: 166 FKRDIASIIEENTVDEPVKV----LQLKRTQNDDPDDTLPPLFPQSGNVQGPLIEEIDVD 221

Query: 241 EIAHRNLKQXXXXXXXXHEQQEDVPEYEVKMKRFKGAA-YKLRILIENKAPNSKPDRFSP 299
               +  KQ           ++    +E  M++      YKLRI I ++  +S     + 
Sbjct: 222 MDDLKITKQEPTSSRTSPLLKD--LHFETVMRKTNNTQRYKLRIDITSEIDSSLDLHLAY 279

Query: 300 SYNFAENIL-------YINGKLSIPLPRDIVV-NAADIKIFHIRKER 338
                E IL       +I  K+ IPLP      N    + F I+K++
Sbjct: 280 DRTNNELILQNLNTVEFIEKKIKIPLPNIFTYENIKQSECFFIKKQK 326

>YCL032W (STE50) [511] chr3 (63441..64481) Protein required for
           feedback control of pheromone-induced signal
           transduction [1041 bp, 346 aa]
          Length = 346

 Score = 28.5 bits (62), Expect = 9.3,   Method: Compositional matrix adjust.
 Identities = 11/36 (30%), Positives = 20/36 (55%), Gaps = 6/36 (16%)

Query: 118 NSDCSRWICDDIQLREILVEWCLESCEIRDSVVLCR 153
           N D S+W  DD+      + WC+ + E+ ++  LC+
Sbjct: 29  NEDFSQWSVDDV------ITWCISTLEVEETDPLCQ 58

  Database: blastdb
    Posted date:  Apr 3, 2006  3:33 PM
  Number of letters in database: 16,596,109
  Number of sequences in database:  34,618
  
Lambda     K      H
   0.320    0.138    0.418 

Gapped
Lambda     K      H
   0.267   0.0410    0.140 

Matrix: BLOSUM62
Gap Penalties: Existence: 11, Extension: 1
Number of Sequences: 34618
Number of Hits to DB: 10,817,807
Number of extensions: 457068
Number of successful extensions: 864
Number of sequences better than 10.0: 8
Number of HSP's gapped: 872
Number of HSP's successfully gapped: 9
Length of query: 339
Length of database: 16,596,109
Length adjustment: 102
Effective length of query: 237
Effective length of database: 13,065,073
Effective search space: 3096422301
Effective search space used: 3096422301
Neighboring words threshold: 11
Window for multiple hits: 40
X1: 16 ( 7.4 bits)
X2: 38 (14.6 bits)
X3: 64 (24.7 bits)
S1: 41 (21.8 bits)
S2: 62 (28.5 bits)