Hit NameLength (aa)HSP LengthHSP ScoreHSP Significance
YHR033W42341621130.0
Scas_588.1442342014430.0
YDR300C (PRO1)42841614180.0
KLLA0C10296g41841713810.0
Kwal_47.1818742141913410.0
CAGL0D03894g48547113340.0
CAGL0H01441g42741613101e-180
AAL061C42041412741e-175
Scas_690.3642442412661e-173
YER052C (HOM3)52740740.47
Scas_715.4452840720.69
KLLA0A10483g15657681.3
Scas_661.15*14174671.5
ABL091C15657671.7
Scas_718.56*15657661.7
KLLA0F27599g52240691.8
CAGL0K11748g15657661.8
ADR106W79837692.1
CAGL0J02882g53040682.2
KLLA0E08349g70463682.5
CAGL0M12320g76959673.1
CAGL0L05588g31379663.4
BLASTP 2.2.26 [Sep-21-2011]

Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, 
Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), 
"Gapped BLAST and PSI-BLAST: a new generation of protein database search
programs",  Nucleic Acids Res. 25:3389-3402.

Reference for compositional score matrix adjustment: Altschul, Stephen F., 
John C. Wootton, E. Michael Gertz, Richa Agarwala, Aleksandr Morgulis,
Alejandro A. Schaffer, and Yi-Kuo Yu (2005) "Protein database searches
using compositionally adjusted substitution matrices", FEBS J. 272:5101-5109.

Query= YHR033W
         (416 letters)

Database: blastdb 
           34,618 sequences; 16,596,109 total letters

Searching..................................................done

                                                                 Score    E
Sequences producing significant alignments:                      (bits) Value

YHR033W (YHR033W) [2320] chr8 (175540..176811) Protein with simi...   818   0.0  
Scas_588.14                                                           560   0.0  
YDR300C (PRO1) [1128] chr4 complement(1061497..1062783) Glutamat...   550   0.0  
KLLA0C10296g 883644..884900 highly similar to sp|P32264 Saccharo...   536   0.0  
Kwal_47.18187                                                         521   0.0  
CAGL0D03894g 389509..390966 similar to sp|P32264 Saccharomyces c...   518   0.0  
CAGL0H01441g complement(140740..142023) highly similar to sp|P32...   509   e-180
AAL061C [126] [Homologous to ScYDR300C (PRO1) - SH; ScYHR033W - ...   495   e-175
Scas_690.36                                                           492   e-173
YER052C (HOM3) [1480] chr5 complement(256374..257957) Aspartate ...    33   0.47 
Scas_715.44                                                            32   0.69 
KLLA0A10483g join(complement(918576..918620),complement(917868.....    31   1.3  
Scas_661.15*                                                           30   1.5  
ABL091C [501] [Homologous to ScYDR025W (RPS11A) - SH; ScYBR048W ...    30   1.7  
Scas_718.56*                                                           30   1.7  
KLLA0F27599g 2558178..2559746 highly similar to sp|P10869 Saccha...    31   1.8  
CAGL0K11748g join(1130412..1130456,1131003..1131428) highly simi...    30   1.8  
ADR106W [1847] [Homologous to ScYDL132W (CDC53) - SH] complement...    31   2.1  
CAGL0J02882g complement(277395..278987) highly similar to sp|P10...    31   2.2  
KLLA0E08349g 754048..756162 highly similar to sp|P53973 Saccharo...    31   2.5  
CAGL0M12320g complement(1229511..1231820) highly similar to sp|P...    30   3.1  
CAGL0L05588g complement(606230..607171) similar to sp|P47016 Sac...    30   3.4  

>YHR033W (YHR033W) [2320] chr8 (175540..176811) Protein with
           similarity to Pro1p [1272 bp, 423 aa]
          Length = 423

 Score =  818 bits (2113), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 400/416 (96%), Positives = 400/416 (96%)

Query: 1   MTKAYTIVIKLGSSSLVDESTKEPKLSIMTLIVETVTNLKRMGHKVIIVSSGGIAVGLDA 60
           MTKAYTIVIKLGSSSLVDESTKEPKLSIMTLIVETVTNLKRMGHKVIIVSSGGIAVGLDA
Sbjct: 1   MTKAYTIVIKLGSSSLVDESTKEPKLSIMTLIVETVTNLKRMGHKVIIVSSGGIAVGLDA 60

Query: 61  LNIPHKPKQLSEVQAIAAVGQGRLIARWNMLFSQYGEQTAQILLTRNDILRWNQYNNARN 120
           LNIPHKPKQLSEVQAIAAVGQGRLIARWNMLFSQYGEQTAQILLTRNDILRWNQYNNARN
Sbjct: 61  LNIPHKPKQLSEVQAIAAVGQGRLIARWNMLFSQYGEQTAQILLTRNDILRWNQYNNARN 120

Query: 121 TINELLAMGVIPIVNENDTLSISEIEFGDNDTLSAITAALVGADFLFLLTDVDCLYTDNP 180
           TINELLAMGVIPIVNENDTLSISEIEFGDNDTLSAITAALVGADFLFLLTDVDCLYTDNP
Sbjct: 121 TINELLAMGVIPIVNENDTLSISEIEFGDNDTLSAITAALVGADFLFLLTDVDCLYTDNP 180

Query: 181 RTNPDARPIVLVPELSEGLPXXXXXXXXXXXXXXXXMRTKLIAADLASNAGIETIVMKSD 240
           RTNPDARPIVLVPELSEGLP                MRTKLIAADLASNAGIETIVMKSD
Sbjct: 181 RTNPDARPIVLVPELSEGLPGVNTSSGSGSEVGTGGMRTKLIAADLASNAGIETIVMKSD 240

Query: 241 RPEYVPKIVDYIQHHFRPPRHIGNGTQQQFLDLQDTELEQLRRYDVPMHTKFLANDNKHK 300
           RPEYVPKIVDYIQHHFRPPRHIGNGTQQQFLDLQDTELEQLRRYDVPMHTKFLANDNKHK
Sbjct: 241 RPEYVPKIVDYIQHHFRPPRHIGNGTQQQFLDLQDTELEQLRRYDVPMHTKFLANDNKHK 300

Query: 301 LKNREFWILHGLITKGAIIIDENSYDKLLSKDMASLTPNAVIEVRDNFHELECVDLKIGQ 360
           LKNREFWILHGLITKGAIIIDENSYDKLLSKDMASLTPNAVIEVRDNFHELECVDLKIGQ
Sbjct: 301 LKNREFWILHGLITKGAIIIDENSYDKLLSKDMASLTPNAVIEVRDNFHELECVDLKIGQ 360

Query: 361 RLPNGELDISKPIQSVGCVRSNYTSLELAKIKGLPSEKIHDVLGYSVSEYVAHREN 416
           RLPNGELDISKPIQSVGCVRSNYTSLELAKIKGLPSEKIHDVLGYSVSEYVAHREN
Sbjct: 361 RLPNGELDISKPIQSVGCVRSNYTSLELAKIKGLPSEKIHDVLGYSVSEYVAHREN 416

>Scas_588.14
          Length = 423

 Score =  560 bits (1443), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 271/420 (64%), Positives = 335/420 (79%), Gaps = 9/420 (2%)

Query: 1   MTKAYTIVIKLGSSSLVDESTKEPKLSIMTLIVETVTNLKRMGHKVIIVSSGGIAVGLDA 60
           M+K YT+VIKLGSSSLVDE TKEPKL+IM+L+VETV  L+R+GHKVIIVSSGGIAVGL  
Sbjct: 3   MSKCYTLVIKLGSSSLVDEKTKEPKLAIMSLLVETVVKLRRLGHKVIIVSSGGIAVGLRT 62

Query: 61  LNIPHKPKQLSEVQAIAAVGQGRLIARWNMLFSQYGEQTAQILLTRNDILRWNQYNNARN 120
           LN+  +PK L+EVQAIAAVGQGRLI RW++LFSQ+G++ AQIL+TRNDI+ W QY NA+N
Sbjct: 63  LNLDKRPKHLAEVQAIAAVGQGRLIGRWDLLFSQFGQRIAQILITRNDIVDWTQYKNAQN 122

Query: 121 TINELLAMGVIPIVNENDTLSISEIEFGDNDTLSAITAALVGADFLFLLTDVDCLYTDNP 180
           TINELL MGV+PIVNENDTLSISEI+FGDNDTLSAIT+ALVGAD+LFLLTDVDCLYTDNP
Sbjct: 123 TINELLKMGVVPIVNENDTLSISEIKFGDNDTLSAITSALVGADYLFLLTDVDCLYTDNP 182

Query: 181 RTNPDARPIVLVPELSEGLPXXXXXXXXXXXXXXXXMRTKLIAADLASNAGIETIVMKSD 240
           RTNP+A+PI++VP+L++GLP                M TKLIAADLA+NAG+ TI+MKSD
Sbjct: 183 RTNPEAKPILVVPDLAKGLPGVNTSSGSGSDVGTGGMETKLIAADLATNAGVHTIIMKSD 242

Query: 241 RPEYVPKIVDYIQHHFRPPRHIGNGTQQQFL----DLQDTELEQLRRYDVPMHTKFLAND 296
            P  + KIV+Y+Q      + +    +Q++      LQD EL  L+   VP+HT F+AND
Sbjct: 243 IPGNILKIVEYMQ-----AQDLDTNKKQKYQGDLSSLQDKELATLQSLHVPLHTTFIAND 297

Query: 297 NKHKLKNREFWILHGLITKGAIIIDENSYDKLLSKDMASLTPNAVIEVRDNFHELECVDL 356
           N H LKNREFWILHGL+T+G++IID+ +Y+ L  K+ A L P  +I++   FHELECVDL
Sbjct: 298 NLHHLKNREFWILHGLVTRGSVIIDQGAYNALTRKNKAGLLPVGIIDIEGTFHELECVDL 357

Query: 357 KIGQRLPNGELDISKPIQSVGCVRSNYTSLELAKIKGLPSEKIHDVLGYSVSEYVAHREN 416
           K+G+RLPNGELD + P+Q+VG  R NYTSLEL++IKGL SE+I + LGY+ SEY AHREN
Sbjct: 358 KLGKRLPNGELDPNTPLQTVGRARCNYTSLELSRIKGLQSEQIEEELGYADSEYAAHREN 417

>YDR300C (PRO1) [1128] chr4 complement(1061497..1062783) Glutamate
           5-kinase, carries out first step in proline biosynthesis
           pathway [1287 bp, 428 aa]
          Length = 428

 Score =  550 bits (1418), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 266/416 (63%), Positives = 326/416 (78%), Gaps = 1/416 (0%)

Query: 2   TKAYTIVIKLGSSSLVDESTKEPKLSIMTLIVETVTNLKRMGHKVIIVSSGGIAVGLDAL 61
           +K+YTIVIKLGSSSLVDE TKEPKL+IM+LIVETV  L+RMGHKVIIVSSGGIAVGL  +
Sbjct: 7   SKSYTIVIKLGSSSLVDEKTKEPKLAIMSLIVETVVKLRRMGHKVIIVSSGGIAVGLRTM 66

Query: 62  NIPHKPKQLSEVQAIAAVGQGRLIARWNMLFSQYGEQTAQILLTRNDILRWNQYNNARNT 121
            +  +PK L+EVQAIAA+GQGRLI RW++LFSQ+ ++ AQILLTRNDIL W QY NA+NT
Sbjct: 67  RMNKRPKHLAEVQAIAAIGQGRLIGRWDLLFSQFDQRIAQILLTRNDILDWTQYKNAQNT 126

Query: 122 INELLAMGVIPIVNENDTLSISEIEFGDNDTLSAITAALVGADFLFLLTDVDCLYTDNPR 181
           INELL MGVIPIVNENDTLS+ EI+FGDNDTLSAIT+AL+ AD+LFLLTDVDCLYTDNPR
Sbjct: 127 INELLNMGVIPIVNENDTLSVREIKFGDNDTLSAITSALIHADYLFLLTDVDCLYTDNPR 186

Query: 182 TNPDARPIVLVPELSEGLPXXXXXXXXXXXXXXXXMRTKLIAADLASNAGIETIVMKSDR 241
           TNPDA PI++VP+LS+GLP                M TKL+AADLA+NAG+ T++MKSD 
Sbjct: 187 TNPDAMPILVVPDLSKGLPGVNTAGGSGSDVGTGGMETKLVAADLATNAGVHTLIMKSDT 246

Query: 242 PEYVPKIVDYIQH-HFRPPRHIGNGTQQQFLDLQDTELEQLRRYDVPMHTKFLANDNKHK 300
           P  + +IV+Y+Q         +         DLQ  E E+L+  +VP+HTKF+ANDNKH 
Sbjct: 247 PANIGRIVEYMQTLELDDENKVKQAYNGDLTDLQKREFEKLKALNVPLHTKFIANDNKHH 306

Query: 301 LKNREFWILHGLITKGAIIIDENSYDKLLSKDMASLTPNAVIEVRDNFHELECVDLKIGQ 360
           LKNREFWILHGL++KGA++ID+ +Y  L  K+ A L P  VI+V+  FHELECVD+K+G+
Sbjct: 307 LKNREFWILHGLVSKGAVVIDQGAYAALTRKNKAGLLPAGVIDVQGTFHELECVDIKVGK 366

Query: 361 RLPNGELDISKPIQSVGCVRSNYTSLELAKIKGLPSEKIHDVLGYSVSEYVAHREN 416
           +LP+G LD   P+Q+VG  R NYTS EL KIKGL S++I + LGY+ SEYVAHREN
Sbjct: 367 KLPDGTLDPDFPLQTVGKARCNYTSSELTKIKGLHSDQIEEELGYNDSEYVAHREN 422

>KLLA0C10296g 883644..884900 highly similar to sp|P32264
           Saccharomyces cerevisiae YDR300c PRO1 glutamate
           5-kinase, start by similarity
          Length = 418

 Score =  536 bits (1381), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 263/417 (63%), Positives = 326/417 (78%), Gaps = 6/417 (1%)

Query: 1   MTKAYTIVIKLGSSSLVDESTKEPKLSIMTLIVETVTNLKRMGHKVIIVSSGGIAVGLDA 60
           M K + IVIKLGSSSLVDE TKEPKLSIM+LIVETV  L+R GHKVIIVSSGGIAVGL  
Sbjct: 1   MVKQFVIVIKLGSSSLVDEETKEPKLSIMSLIVETVVKLRRRGHKVIIVSSGGIAVGLKT 60

Query: 61  LNIPHKPKQLSEVQAIAAVGQGRLIARWNMLFSQYGEQTAQILLTRNDILRWNQYNNARN 120
           +N+  +PK+LS+VQAIAAVGQGRLI RW+ LFS++ ++ AQIL+TRNDI+ W QY NA+N
Sbjct: 61  MNMKGRPKKLSKVQAIAAVGQGRLIGRWDSLFSEFDQRIAQILITRNDIVDWTQYKNAQN 120

Query: 121 TINELLAMGVIPIVNENDTLSISEIEFGDNDTLSAITAALVGADFLFLLTDVDCLYTDNP 180
           TI+ELL+MGV+PIVNENDTLS+SEI+FGDNDTLSAITAAL GAD+LFLLTDVDCLYTDNP
Sbjct: 121 TISELLSMGVVPIVNENDTLSVSEIKFGDNDTLSAITAALTGADYLFLLTDVDCLYTDNP 180

Query: 181 RTNPDARPIVLVPELSEGLPXXXXXXXXXXXXXXXXMRTKLIAADLASNAGIETIVMKSD 240
           R NPDA+PI++VP++S+GLP                M+TKLIAA+LA+NAG+ TI+MKSD
Sbjct: 181 RANPDAKPILVVPDISQGLPGVNTDGGSGSDVGTGGMKTKLIAAELATNAGVHTIIMKSD 240

Query: 241 RPEYVPKIVDYIQHHFRPPRHIG-NGTQQQFLDLQDTELEQLRRYDVPMHTKFLANDNKH 299
            PE + KIV Y+Q      R  G N   Q   DLQ TE++ L    VP+HT+F+AN N H
Sbjct: 241 TPENISKIVLYMQE-----RDDGVNELTQDLADLQLTEMQSLVNNHVPLHTRFIANSNHH 295

Query: 300 KLKNREFWILHGLITKGAIIIDENSYDKLLSKDMASLTPNAVIEVRDNFHELECVDLKIG 359
            LKNR+FW+LHGL+++GA+IID  +Y+ L  K+ A L P  VIEV+ +FHE EC+D+K+G
Sbjct: 296 HLKNRQFWMLHGLVSQGAVIIDIGAYEALTRKNKAGLLPAGVIEVQGSFHEHECIDIKLG 355

Query: 360 QRLPNGELDISKPIQSVGCVRSNYTSLELAKIKGLPSEKIHDVLGYSVSEYVAHREN 416
            R  +G LD S  +++VG  R NYTS EL+KIKGL S++I D+LGY+ SEYVAHREN
Sbjct: 356 VRDSDGNLDKSVALKTVGRARCNYTSTELSKIKGLQSDQIEDILGYADSEYVAHREN 412

>Kwal_47.18187
          Length = 421

 Score =  521 bits (1341), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 250/419 (59%), Positives = 318/419 (75%), Gaps = 7/419 (1%)

Query: 1   MTKAYTIVIKLGSSSLVDESTKEPKLSIMTLIVETVTNLKRMGHKVIIVSSGGIAVGLDA 60
           M+K YTIVIKLGSSSLVDE TKEPKL+ M ++VETV  L+RMGH+V++VSSGGIAVGL  
Sbjct: 1   MSKTYTIVIKLGSSSLVDEKTKEPKLATMAMVVETVVRLRRMGHRVVLVSSGGIAVGLKT 60

Query: 61  LNIPHKPKQLSEVQAIAAVGQGRLIARWNMLFSQYGEQTAQILLTRNDILRWNQYNNARN 120
           LN+  +PK L++VQAIAAVGQGRLI RW+ LFSQ+ ++ AQIL+TRNDI+ W QY NA+N
Sbjct: 61  LNLDKRPKHLAQVQAIAAVGQGRLIGRWDALFSQFSQRIAQILITRNDIVDWTQYKNAQN 120

Query: 121 TINELLAMGVIPIVNENDTLSISEIEFGDNDTLSAITAALVGADFLFLLTDVDCLYTDNP 180
           TI+ELL MGV+PIVNENDTLS+SEI+FGDNDTLSAITAAL GAD+LFLLTDVDCLYTDNP
Sbjct: 121 TIHELLQMGVVPIVNENDTLSVSEIKFGDNDTLSAITAALCGADYLFLLTDVDCLYTDNP 180

Query: 181 RTNPDARPIVLVP---ELSEGLPXXXXXXXXXXXXXXXXMRTKLIAADLASNAGIETIVM 237
           RTNP+A+PI++VP   ++SEG                  M TKLIAA+LA+NAG+ TI+M
Sbjct: 181 RTNPNAKPILVVPATSQMSEGTLGVKTSSGSGSDVGTGGMTTKLIAAELATNAGVNTIIM 240

Query: 238 KSDRPEYVPKIVDYIQHHFRPPRHIGNGTQQQFLDLQDTELEQLRRYDVPMHTKFLANDN 297
           KS  P  + K+V Y+Q+       I          LQ+ E+ +L+   VP+HT+F+A+++
Sbjct: 241 KSAEPSNISKVVSYMQN----CESITGAAADNVEHLQEQEMLRLQENCVPLHTRFVADES 296

Query: 298 KHKLKNREFWILHGLITKGAIIIDENSYDKLLSKDMASLTPNAVIEVRDNFHELECVDLK 357
           +  L NREFW+LHGL++KGAI+ID+ +Y  L  K+ A L P  +IEV  NFHE EC+DLK
Sbjct: 297 QMHLSNREFWMLHGLVSKGAIVIDQGAYAALTRKNKAGLLPAGLIEVEGNFHEHECIDLK 356

Query: 358 IGQRLPNGELDISKPIQSVGCVRSNYTSLELAKIKGLPSEKIHDVLGYSVSEYVAHREN 416
           +G RL  GELD + P+ ++G  R NYTS+EL KIKGL S++I +VLGY+ SEYVAHR N
Sbjct: 357 VGSRLATGELDPAMPVTTIGRARCNYTSVELCKIKGLQSDQIENVLGYADSEYVAHRGN 415

>CAGL0D03894g 389509..390966 similar to sp|P32264 Saccharomyces
           cerevisiae YDR300c PRO1 or sp|P38690 Saccharomyces
           cerevisiae YHR033w, hypothetical start
          Length = 485

 Score =  518 bits (1334), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 266/471 (56%), Positives = 331/471 (70%), Gaps = 61/471 (12%)

Query: 4   AYTIVIKLGSSSLVDESTKEPKLSIMTLIVETVTNLKRMGHKVIIVSSGGIAVGLDALNI 63
           + TIVIKLG+SSLVDE T+EPKLSIMT +VETV  LKR GHKV+IVSSGGIAVGL+A+ +
Sbjct: 2   SQTIVIKLGTSSLVDEKTREPKLSIMTQVVETVIQLKRQGHKVVIVSSGGIAVGLNAMEM 61

Query: 64  PHKPKQLSEVQAIAAVGQGRLIARWNMLFSQYGEQTAQILLTRNDILRWNQYNNARNTIN 123
             KP  L+E+QAIAA+GQGRLI RW+MLF QYGE+ AQIL+TRNDIL W QY NA+NTI 
Sbjct: 62  DKKPTDLAEIQAIAAIGQGRLIGRWSMLFQQYGEKIAQILITRNDILGWTQYKNAQNTIL 121

Query: 124 ELLAMGVIPIVNENDTLSISEIEFGDNDTLSAITAALVGADFLFLLTDVDCLYTDNPRTN 183
           +LL MGV+PIVNENDTLSISEI+FGDNDTLSAITAALV AD LFLLTDVDCLYT+NPRTN
Sbjct: 122 QLLEMGVVPIVNENDTLSISEIKFGDNDTLSAITAALVSADHLFLLTDVDCLYTENPRTN 181

Query: 184 PDARPIVLVPELSEGLP-XXXXXXXXXXXXXXXXMRTKLIAADLASNAGIETIVMKSDRP 242
           PDA+PIV+VP + +G+P                 MRTKLIAADLA+NAG+ TI+MKSD P
Sbjct: 182 PDAKPIVIVPNMDQGVPGVDTSNADAGSSVGTGGMRTKLIAADLATNAGVNTIIMKSDAP 241

Query: 243 EYVPKIVDYIQHHFRPPRHI--------------------------GNG-------TQQQ 269
             V  IVDY+    + P+ +                          G G       +++ 
Sbjct: 242 SNVKHIVDYL---VKYPKKVLYDDNKSSREQSSEPLSLDQLKNHPYGKGGVISPPKSEED 298

Query: 270 FLDLQDTELEQLRRYDVPMHTKFLANDNKHKLKNREFWILHGLITKGAIIIDENSYDKLL 329
            L LQD EL++++  +VP+HT FLA D  H LKNREFWILHGL+TKG +IIDE++Y+ L 
Sbjct: 299 LLSLQDAELKEIKERNVPLHTVFLAKDIDHHLKNREFWILHGLVTKGVLIIDEDAYNTLT 358

Query: 330 SK------------------DMA------SLTPNAVIEVRDNFHELECVDLKIGQRLPNG 365
           ++                  +M+       L P  VIEV+ +FHELECVD+K+G+RLPNG
Sbjct: 359 NESGDEEHVSEAYVSEVEDDEMSEVDQDHGLLPKDVIEVKGSFHELECVDIKVGKRLPNG 418

Query: 366 ELDISKPIQSVGCVRSNYTSLELAKIKGLPSEKIHDVLGYSVSEYVAHREN 416
           +LD   P++ VG  R N+TS+EL +IKGLP +++ DVLGY VSEYVAH++N
Sbjct: 419 KLDPDAPLEYVGRARCNFTSVELNRIKGLPVDRVQDVLGYDVSEYVAHKDN 469

>CAGL0H01441g complement(140740..142023) highly similar to sp|P32264
           Saccharomyces cerevisiae YDR300c PRO1 glutamate
           5-kinase, hypothetical start
          Length = 427

 Score =  509 bits (1310), Expect = e-180,   Method: Compositional matrix adjust.
 Identities = 249/416 (59%), Positives = 310/416 (74%), Gaps = 5/416 (1%)

Query: 3   KAYTIVIKLGSSSLVDESTKEPKLSIMTLIVETVTNLKRMGHKVIIVSSGGIAVGLDALN 62
           K +TIVIKLG+SSLVDE TKEP+L+IM+LIVETV  L+R+GH V+IVSSG I VGL  L 
Sbjct: 9   KPFTIVIKLGTSSLVDEKTKEPRLAIMSLIVETVVKLRRLGHNVVIVSSGSIGVGLHILG 68

Query: 63  IPHKPKQLSEVQAIAAVGQGRLIARWNMLFSQYGEQTAQILLTRNDILRWNQYNNARNTI 122
           +  +PK LSEVQAIAA+GQ +LI RW+ LF+ +G+  AQILLTRNDIL W+QY NA+NT+
Sbjct: 69  MEKRPKHLSEVQAIAAIGQSKLIGRWDSLFAHFGQSIAQILLTRNDILDWSQYRNAQNTV 128

Query: 123 NELLAMGVIPIVNENDTLSISEIEFGDNDTLSAITAALVGADFLFLLTDVDCLYTDNPRT 182
            ELL MGV+PI+NENDTLS+ EI+FGDNDTLSAITA L+ AD+LFLLTDVDCLYT +PR+
Sbjct: 129 EELLKMGVVPIINENDTLSVQEIKFGDNDTLSAITAGLIHADYLFLLTDVDCLYTADPRS 188

Query: 183 NPDARPIVLVPELSEGLPXXXXXXXXXXXXXXXXMRTKLIAADLASNAGIETIVMKSDRP 242
           +PDA+PI++VP+LS+GLP                M+TKL+AA+LA+NAG+ TI+MKSD P
Sbjct: 189 DPDAKPILIVPDLSKGLPGVDTSSGSGSDVGTGGMQTKLVAAELATNAGVHTIIMKSDAP 248

Query: 243 EYVPKIVDYIQ--HHFRPPRHIGNGTQQQFLDLQDTELEQLRRYDVPMHTKFLANDNKHK 300
             + KIV YIQ  H       +  G     + LQ  E E+L R  VP HTKFLAN     
Sbjct: 249 SNIYKIVKYIQSLHDTGEDNKVFEG---DLMKLQLEEYEKLDRMGVPFHTKFLANSISRH 305

Query: 301 LKNREFWILHGLITKGAIIIDENSYDKLLSKDMASLTPNAVIEVRDNFHELECVDLKIGQ 360
           L+N+EFWILHGL+T GA+IIDE +Y  L  K+ A L P  VIE+  +FHE+ECVDLK+G+
Sbjct: 306 LRNKEFWILHGLVTSGAVIIDEGAYKALTRKNKAGLLPVGVIEIEGSFHEMECVDLKVGK 365

Query: 361 RLPNGELDISKPIQSVGCVRSNYTSLELAKIKGLPSEKIHDVLGYSVSEYVAHREN 416
           RLPNGELD   P+  VG  R NY SLE++KIKG  S++I + LGY  SEY+AHREN
Sbjct: 366 RLPNGELDPDYPLTIVGRARCNYPSLEISKIKGQQSDEIENELGYCNSEYIAHREN 421

>AAL061C [126] [Homologous to ScYDR300C (PRO1) - SH; ScYHR033W - SH]
           (239518..240780) [1263 bp, 420 aa]
          Length = 420

 Score =  495 bits (1274), Expect = e-175,   Method: Compositional matrix adjust.
 Identities = 247/414 (59%), Positives = 309/414 (74%), Gaps = 5/414 (1%)

Query: 3   KAYTIVIKLGSSSLVDESTKEPKLSIMTLIVETVTNLKRMGHKVIIVSSGGIAVGLDALN 62
           + +TIV+KLGSSSLVDEST EPKLSIM+ IVETV  L+RMGHKV+IVSSG IAVGL  + 
Sbjct: 6   RKFTIVLKLGSSSLVDESTLEPKLSIMSHIVETVVKLRRMGHKVVIVSSGCIAVGLKTVG 65

Query: 63  IPHKPKQLSEVQAIAAVGQGRLIARWNMLFSQYGEQTAQILLTRNDILRWNQYNNARNTI 122
              +PK+LS++QAIAAVGQGRLIARW+ LF  + E+ AQILLTRNDI+ W+QY NA+NT 
Sbjct: 66  TDRRPKKLSQLQAIAAVGQGRLIARWDSLFRPFNEKIAQILLTRNDIVDWSQYKNAQNTF 125

Query: 123 NELLAMGVIPIVNENDTLSISEIEFGDNDTLSAITAALVGADFLFLLTDVDCLYTDNPRT 182
           +ELLAMGV PIVNENDTLSIS ++FGDNDTLSAITA L+GAD+LFL+TDVDCLYTDNPRT
Sbjct: 126 HELLAMGVTPIVNENDTLSISGVKFGDNDTLSAITAGLIGADYLFLMTDVDCLYTDNPRT 185

Query: 183 NPDARPIVLVPELSEGLPXXXXXXXXXXXXXXXXMRTKLIAADLASNAGIETIVMKSDRP 242
           NPDA+PI++VP+LS+GLP                M TK++AADLA+NAG+ TI+MKS+RP
Sbjct: 186 NPDAKPILVVPDLSQGLPGVNTSSGSGSGVGTGGMATKILAADLATNAGVHTIIMKSERP 245

Query: 243 EYVPKIVDYIQHHFRPPRHIGNGTQQQFLDLQDTELEQLRRYDVPMHTKFLANDNKHKLK 302
             + +IV++++      R            LQ  EL  L+ + VP+HT+F+AN  +  L 
Sbjct: 246 VDMVRIVEFMEW-----REQCTAVSADAETLQTDELNLLQEHGVPLHTRFIANVWQPSLN 300

Query: 303 NREFWILHGLITKGAIIIDENSYDKLLSKDMASLTPNAVIEVRDNFHELECVDLKIGQRL 362
            REFWILHGL++ G +IID+ +Y  L  K+ A L P  VI V  +FHELE VDLKIG R 
Sbjct: 301 KREFWILHGLVSCGTVIIDKGAYKALTRKNKAGLLPAGVIAVEGSFHELEAVDLKIGVRK 360

Query: 363 PNGELDISKPIQSVGCVRSNYTSLELAKIKGLPSEKIHDVLGYSVSEYVAHREN 416
            +G LD S+P+Q+VG  R NY+S+E+ KIKGL S +I  VLGY  SEY+AHREN
Sbjct: 361 ADGSLDESEPLQTVGRARCNYSSVEVDKIKGLQSGQIETVLGYIDSEYIAHREN 414

>Scas_690.36
          Length = 424

 Score =  492 bits (1266), Expect = e-173,   Method: Compositional matrix adjust.
 Identities = 252/424 (59%), Positives = 306/424 (72%), Gaps = 15/424 (3%)

Query: 1   MTKAYTIVIKLGSSSLVDESTKEPKLSIMTLIVETVTNLKRMGHKVIIVSSGGIAVGLDA 60
           MTK+ TIVIKLGSSSLVDE T+EPKLS MT IVE V+ LKR+GHKV+IVSSGGIAVGLDA
Sbjct: 1   MTKSNTIVIKLGSSSLVDEVTREPKLSTMTQIVEIVSCLKRLGHKVVIVSSGGIAVGLDA 60

Query: 61  LNIPHKPKQLSEVQAIAAVGQGRLIARWNMLFSQYGEQTAQILLTRNDILRWNQYNNARN 120
           +N+  KP QLSE+QAIAA+GQG+LI RW MLF QY EQ AQILLTR DI  W Q+ NA+N
Sbjct: 61  MNLKKKPSQLSEIQAIAAIGQGKLIGRWEMLFRQYNEQIAQILLTRKDIFGWTQFKNAQN 120

Query: 121 TINELLAMGVIPIVNENDTLSISEIEFGDNDTLSAITAALVGADFLFLLTDVDCLYTDNP 180
           TIN LL MGV+PIVNENDTLS+SEI+FGDNDTLSAIT+ALV AD+LFLLTDVDCLYTDNP
Sbjct: 121 TINALLKMGVVPIVNENDTLSVSEIKFGDNDTLSAITSALVNADYLFLLTDVDCLYTDNP 180

Query: 181 RTNPDARPIVLVPELSEG-----LPXXXXXXXXXXXXXXXXMRTKLIAADLASNAGIETI 235
           + N DA+PI+ V ++ E      L                 MRTK+ AADLA+N GI TI
Sbjct: 181 KVNKDAKPILTVFDMHEDSISKVLDTCPSLSDSGSNIGTGGMRTKITAADLATNVGIHTI 240

Query: 236 VMKSDRPEYVPKIVDYIQHHFRPPRHIGNGTQQQFLDLQDTELEQLRRYDVPMHTKFLAN 295
           +M S  P  + KI++Y++        +  G         D EL+ L  +DVP+HTKF+AN
Sbjct: 241 IMSSQTPANILKIIEYME---TSNLKVDGGVCSN----NDLELKNLIAHDVPLHTKFIAN 293

Query: 296 DNKHK-LKNREFWILHGLITKGAIIIDENSYDKLLSK--DMASLTPNAVIEVRDNFHELE 352
           +N    LKNREFWILHGL+TKG+IIID+NSY  LL K      L P ++I+  D FHELE
Sbjct: 294 ENSETYLKNREFWILHGLVTKGSIIIDKNSYKDLLRKKEKCKGLLPISIIDTEDQFHELE 353

Query: 353 CVDLKIGQRLPNGELDISKPIQSVGCVRSNYTSLELAKIKGLPSEKIHDVLGYSVSEYVA 412
           CV+LK+G+RLPNG+++    ++ VG  R NYTS E+ KIKGL S++I + LGY  S YV 
Sbjct: 354 CVELKVGERLPNGKVNRKAGLKVVGRARCNYTSYEINKIKGLKSDQIFETLGYGDSAYVV 413

Query: 413 HREN 416
           H EN
Sbjct: 414 HNEN 417

>YER052C (HOM3) [1480] chr5 complement(256374..257957) Aspartate
           kinase (L-aspartate 4-P-transferase), catalyzes the
           first step in the common pathway for methionine and
           threonine biosynthesis [1584 bp, 527 aa]
          Length = 527

 Score = 33.1 bits (74), Expect = 0.47,   Method: Compositional matrix adjust.
 Identities = 16/40 (40%), Positives = 24/40 (60%)

Query: 148 GDNDTLSAITAALVGADFLFLLTDVDCLYTDNPRTNPDAR 187
           G  D  +A+ A  V AD L +  +VD ++T +PR  P+AR
Sbjct: 231 GYTDLCAALIAVAVNADELQVWKEVDGIFTADPRKVPEAR 270

>Scas_715.44
          Length = 528

 Score = 32.3 bits (72), Expect = 0.69,   Method: Compositional matrix adjust.
 Identities = 16/40 (40%), Positives = 23/40 (57%)

Query: 148 GDNDTLSAITAALVGADFLFLLTDVDCLYTDNPRTNPDAR 187
           G  D  +A+ A  V AD L +  +VD ++T +PR  P AR
Sbjct: 227 GYTDLCAALIAVAVNADELQVWKEVDGIFTADPRKVPQAR 266

>KLLA0A10483g
           join(complement(918576..918620),
           complement(917868..918293)) highly similar to sp|P26781
           Saccharomyces cerevisiae YDR025w RPS18A ribosomal
           protein S11.e or sp|P26781 Saccharomyces cerevisiae
           YBR048w RPS18B ribosomal protein, hypothetical start
          Length = 156

 Score = 30.8 bits (68), Expect = 1.3,   Method: Compositional matrix adjust.
 Identities = 17/57 (29%), Positives = 27/57 (47%)

Query: 217 MRTKLIAADLASNAGIETIVMKSDRPEYVPKIVDYIQHHFRPPRHIGNGTQQQFLDL 273
           +R K++   + S     TIV++ D   YVPK   Y + H   P H+    + Q  D+
Sbjct: 66  IRGKILTGTVVSTRMHRTIVIRRDYLHYVPKYNRYEKRHKNVPAHVSPAFRVQVGDI 122

>Scas_661.15*
          Length = 141

 Score = 30.4 bits (67), Expect = 1.5,   Method: Compositional matrix adjust.
 Identities = 20/74 (27%), Positives = 34/74 (45%), Gaps = 4/74 (5%)

Query: 217 MRTKLIAADLASNAGIETIVMKSDRPEYVPKIVDYIQHHFRPPRHIGNGTQQQFLDL--- 273
           +R K++   + S     TIV++ D   YVPK   Y + H   P H+    + Q  D+   
Sbjct: 51  IRGKILTGTVVSTKMHRTIVIRRDYLHYVPKYNRYEKRHKNVPVHVSPAFRVQVGDIVTA 110

Query: 274 -QDTELEQLRRYDV 286
            Q   + +  R++V
Sbjct: 111 GQCRPISKTVRFNV 124

>ABL091C [501] [Homologous to ScYDR025W (RPS11A) - SH; ScYBR048W
           (RPS11B) - SH] (229509..229934,230173..230217) [471 bp,
           156 aa]
          Length = 156

 Score = 30.4 bits (67), Expect = 1.7,   Method: Compositional matrix adjust.
 Identities = 16/57 (28%), Positives = 27/57 (47%)

Query: 217 MRTKLIAADLASNAGIETIVMKSDRPEYVPKIVDYIQHHFRPPRHIGNGTQQQFLDL 273
           +R K++   + S     TI+++ D   YVPK   Y + H   P H+    + Q  D+
Sbjct: 66  IRGKILTGTVVSTKMHRTIIIRRDYLHYVPKYNRYEKRHKNVPVHVSPAFRVQLGDI 122

>Scas_718.56*
          Length = 156

 Score = 30.0 bits (66), Expect = 1.7,   Method: Compositional matrix adjust.
 Identities = 17/57 (29%), Positives = 27/57 (47%)

Query: 217 MRTKLIAADLASNAGIETIVMKSDRPEYVPKIVDYIQHHFRPPRHIGNGTQQQFLDL 273
           +R K++   + S     TIV++ D   YVPK   Y + H   P H+    + Q  D+
Sbjct: 66  IRGKILTGTVVSTKMHRTIVIRRDYLHYVPKYNRYEKRHKNVPVHVSPAFRVQVGDI 122

>KLLA0F27599g 2558178..2559746 highly similar to sp|P10869
           Saccharomyces cerevisiae YER052c HOM3 L-aspartate
           4-P-transferase singleton, start by similarity
          Length = 522

 Score = 31.2 bits (69), Expect = 1.8,   Method: Compositional matrix adjust.
 Identities = 15/40 (37%), Positives = 23/40 (57%)

Query: 148 GDNDTLSAITAALVGADFLFLLTDVDCLYTDNPRTNPDAR 187
           G  D  +A+ A  + AD L +  +VD ++T +PR  P AR
Sbjct: 228 GYTDLCAALIAVALNADELQVWKEVDGIFTADPRKVPQAR 267

>CAGL0K11748g join(1130412..1130456,1131003..1131428) highly similar
           to sp|P26781 Saccharomyces cerevisiae YDR025w RPS18A or
           sp|P26781 Saccharomyces cerevisiae YBR048w RPS18B
          Length = 156

 Score = 30.0 bits (66), Expect = 1.8,   Method: Compositional matrix adjust.
 Identities = 16/57 (28%), Positives = 28/57 (49%)

Query: 217 MRTKLIAADLASNAGIETIVMKSDRPEYVPKIVDYIQHHFRPPRHIGNGTQQQFLDL 273
           +R K+++  + S     TI+++ D   YVPK   Y + H   P H+    + Q  D+
Sbjct: 66  IRGKILSGTVVSTKMHRTIIIRRDYLHYVPKYNRYEKRHKNVPVHVSPAFRVQVGDI 122

>ADR106W [1847] [Homologous to ScYDL132W (CDC53) - SH]
           complement(894781..897177) [2397 bp, 798 aa]
          Length = 798

 Score = 31.2 bits (69), Expect = 2.1,   Method: Compositional matrix adjust.
 Identities = 14/37 (37%), Positives = 22/37 (59%)

Query: 125 LLAMGVIPIVNENDTLSISEIEFGDNDTLSAITAALV 161
           L  M ++ + NENDTLS  +I+ G N T   I  +++
Sbjct: 622 LFQMAILLMFNENDTLSFEQIQEGTNLTTQHIILSML 658

>CAGL0J02882g complement(277395..278987) highly similar to sp|P10869
           Saccharomyces cerevisiae YER052c HOM3, hypothetical
           start
          Length = 530

 Score = 30.8 bits (68), Expect = 2.2,   Method: Compositional matrix adjust.
 Identities = 15/40 (37%), Positives = 23/40 (57%)

Query: 148 GDNDTLSAITAALVGADFLFLLTDVDCLYTDNPRTNPDAR 187
           G  D  +A+ A  + AD L +  +VD ++T +PR  P AR
Sbjct: 231 GYTDLCAALIAVALNADELQVWKEVDGIFTADPRKVPQAR 270

>KLLA0E08349g 754048..756162 highly similar to sp|P53973
           Saccharomyces cerevisiae YNL021w HDA1 histone
           deacetylase A, start by similarity
          Length = 704

 Score = 30.8 bits (68), Expect = 2.5,   Method: Compositional matrix adjust.
 Identities = 23/63 (36%), Positives = 27/63 (42%), Gaps = 9/63 (14%)

Query: 226 LASNAGIETIVMKSDRPEYVPKI--VDYIQHHFRPPRHIGNGTQQQFLDLQDTELEQLRR 283
           L SN  +    M    PE V KI  VD+  HH       GNGTQ+ F D        L R
Sbjct: 213 LFSNVAVAAANMLKSYPESVRKIMIVDWDIHH-------GNGTQKAFYDDDRVLYVSLHR 265

Query: 284 YDV 286
           Y +
Sbjct: 266 YQL 268

>CAGL0M12320g complement(1229511..1231820) highly similar to
           sp|P39719 Saccharomyces cerevisiae YAL053w, hypothetical
           start
          Length = 769

 Score = 30.4 bits (67), Expect = 3.1,   Method: Compositional matrix adjust.
 Identities = 18/59 (30%), Positives = 30/59 (50%), Gaps = 5/59 (8%)

Query: 237 MKSDRPEYVPKIVDYIQHHFRPPRHIGNGTQ-----QQFLDLQDTELEQLRRYDVPMHT 290
           MK DR  ++PKIV+    +F   +  G+  +     Q  +D  +TE E++ R D  + T
Sbjct: 613 MKDDRVSFIPKIVNGNSGYFGGDKKNGSEAELFELKQAVMDTNETEQEKMIRDDTFVRT 671

>CAGL0L05588g complement(606230..607171) similar to sp|P47016
           Saccharomyces cerevisiae YJL126w NIT2 nitrilase, start
           by similarity
          Length = 313

 Score = 30.0 bits (66), Expect = 3.4,   Method: Compositional matrix adjust.
 Identities = 22/79 (27%), Positives = 37/79 (46%), Gaps = 14/79 (17%)

Query: 324 SYDKLLSKDMASLTPNAVIEVRD----NFHELECVDLKIGQRLPNGELDISKP------- 372
           ++ ++L+K   +   +  ++++D       E   +D+ IG  LP  E DI K        
Sbjct: 52  THSRVLAKSSPTFVDDLQLKIKDINERYKSEKRAIDVSIGVHLPPSEQDILKGDDRVKNV 111

Query: 373 ---IQSVGCVRSNYTSLEL 388
              I S G +RS+YT L L
Sbjct: 112 LLYIDSSGVIRSSYTKLHL 130

  Database: blastdb
    Posted date:  Apr 3, 2006  3:33 PM
  Number of letters in database: 16,596,109
  Number of sequences in database:  34,618
  
Lambda     K      H
   0.318    0.135    0.386 

Gapped
Lambda     K      H
   0.267   0.0410    0.140 

Matrix: BLOSUM62
Gap Penalties: Existence: 11, Extension: 1
Number of Sequences: 34618
Number of Hits to DB: 13,163,497
Number of extensions: 556541
Number of successful extensions: 1591
Number of sequences better than 10.0: 27
Number of HSP's gapped: 1604
Number of HSP's successfully gapped: 28
Length of query: 416
Length of database: 16,596,109
Length adjustment: 104
Effective length of query: 312
Effective length of database: 12,995,837
Effective search space: 4054701144
Effective search space used: 4054701144
Neighboring words threshold: 11
Window for multiple hits: 40
X1: 16 ( 7.3 bits)
X2: 38 (14.6 bits)
X3: 64 (24.7 bits)
S1: 41 (21.7 bits)
S2: 63 (28.9 bits)