Hit NameLength (aa)HSP LengthHSP ScoreHSP Significance
YHL020C (OPI1)40439815120.0
Kwal_26.81523732704707e-55
Scas_709.573942374072e-45
CAGL0K03267g4871594104e-45
ABR048W3572703939e-44
KLLA0F25388g4051733261e-33
Sklu_2074.251472663.3
BLASTP 2.2.26 [Sep-21-2011]

Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, 
Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), 
"Gapped BLAST and PSI-BLAST: a new generation of protein database search
programs",  Nucleic Acids Res. 25:3389-3402.

Reference for compositional score matrix adjustment: Altschul, Stephen F., 
John C. Wootton, E. Michael Gertz, Richa Agarwala, Aleksandr Morgulis,
Alejandro A. Schaffer, and Yi-Kuo Yu (2005) "Protein database searches
using compositionally adjusted substitution matrices", FEBS J. 272:5101-5109.

Query= YHL020C
         (398 letters)

Database: blastdb 
           34,618 sequences; 16,596,109 total letters

Searching..................................................done

                                                                 Score    E
Sequences producing significant alignments:                      (bits) Value

YHL020C (OPI1) [2266] chr8 complement(66238..67452) Negative reg...   587   0.0  
Kwal_26.8152                                                          185   7e-55
Scas_709.57                                                           161   2e-45
CAGL0K03267g 299090..300553 similar to tr|AAB65073 Saccharomyces...   162   4e-45
ABR048W [639] [Homologous to ScYHL020C (OPI1) - SH] complement(4...   155   9e-44
KLLA0F25388g complement(2362150..2363367) some similarities with...   130   1e-33
Sklu_2074.2 YPL256C, Contig c2074 3646-5190                            30   3.3  

>YHL020C (OPI1) [2266] chr8 complement(66238..67452) Negative
           regulator of phospholipid biosynthesis pathway [1215 bp,
           404 aa]
          Length = 404

 Score =  587 bits (1512), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 303/398 (76%), Positives = 303/398 (76%)

Query: 1   MSENQRLGLSXXXXXXXXXLGVLKQSCRQKSQPSEDVSQADKMPASESSTTPLNILDRVS 60
           MSENQRLGLS         LGVLKQSCRQKSQPSEDVSQADKMPASESSTTPLNILDRVS
Sbjct: 1   MSENQRLGLSEEEVEAAEVLGVLKQSCRQKSQPSEDVSQADKMPASESSTTPLNILDRVS 60

Query: 61  NKIISNVVTFYDEINTNKRPLKSIGRLLXXXXXXXXXXXXXXXXFFTNKRQKLSRAIAKG 120
           NKIISNVVTFYDEINTNKRPLKSIGRLL                FFTNKRQKLSRAIAKG
Sbjct: 61  NKIISNVVTFYDEINTNKRPLKSIGRLLDDDDDEHDDYDYNDDEFFTNKRQKLSRAIAKG 120

Query: 121 KDNLKEYKLNMSIESKKRLVTCLHLLKLANKQLSDKISCLQDLVEKEQVHPLHKQDGNAR 180
           KDNLKEYKLNMSIESKKRLVTCLHLLKLANKQLSDKISCLQDLVEKEQVHPLHKQDGNAR
Sbjct: 121 KDNLKEYKLNMSIESKKRLVTCLHLLKLANKQLSDKISCLQDLVEKEQVHPLHKQDGNAR 180

Query: 181 TTTGAGXXXXXXXXXXXXXXXXXXXXQVNASEQSIVVKMEVVGTVKKVYSLISKFTANSL 240
           TTTGAG                    QVNASEQSIVVKMEVVGTVKKVYSLISKFTANSL
Sbjct: 181 TTTGAGEDETSSDEDDDDEEFFDASEQVNASEQSIVVKMEVVGTVKKVYSLISKFTANSL 240

Query: 241 PEPARSQVRESLLNLPTNWFDSVHSTSLPHHASFHYANCEEQKVEXXXXXXXXXXXXXXX 300
           PEPARSQVRESLLNLPTNWFDSVHSTSLPHHASFHYANCEEQKVE               
Sbjct: 241 PEPARSQVRESLLNLPTNWFDSVHSTSLPHHASFHYANCEEQKVEQQQQQQQQQQQQQLL 300

Query: 301 XXXXXXXXXXKRNKDGDDSASPSSSVTANGKVLILAKESLEMVRNVMGVVDSTLGXXXXX 360
                     KRNKDGDDSASPSSSVTANGKVLILAKESLEMVRNVMGVVDSTLG     
Sbjct: 301 QQQLLQQQQQKRNKDGDDSASPSSSVTANGKVLILAKESLEMVRNVMGVVDSTLGKAEEW 360

Query: 361 XXXXXXXXXMIRERFLXXXXXXXXXXXKDGNYVKPSQD 398
                    MIRERFL           KDGNYVKPSQD
Sbjct: 361 VKQKQEVKEMIRERFLQQQQQYRQQQQKDGNYVKPSQD 398

>Kwal_26.8152
          Length = 373

 Score =  185 bits (470), Expect = 7e-55,   Method: Compositional matrix adjust.
 Identities = 121/270 (44%), Positives = 144/270 (53%), Gaps = 64/270 (23%)

Query: 107 TNKRQKLSRAIAKGKDNLKEYKLNMSIESKKRLVTCLHLLKLANKQLSDKISCLQDLVEK 166
           T+KRQK+S AIAK K NLK Y+L+MSIESKKRLVTCLHLLKLAN QLS+++  LQDLV K
Sbjct: 150 TSKRQKISNAIAKSKVNLKGYQLDMSIESKKRLVTCLHLLKLANNQLSNRVGFLQDLVLK 209

Query: 167 EQVHPLHKQDGNARTTTGAGXXXXXXXXXXXXXXXXXXXXQVNASEQSIVVKMEVVGTVK 226
           EQ   L K  G  R                            N  E S VVKME+VGTVK
Sbjct: 210 EQ--KLRK--GRIRDRQAESDDEEEYYDASD-----------NIDELSNVVKMEIVGTVK 254

Query: 227 KVYSLISKFTANSLPEPARSQVRESLLNLPTNWFDSVHSTSLPHHASFHYANCEEQKVEX 286
           KVYSLISKFT +SLPEPAR+QVRESLL LP NW  +++S +L  + S             
Sbjct: 255 KVYSLISKFTGSSLPEPARTQVRESLLKLPMNWTSTMNSENLARYTS------------- 301

Query: 287 XXXXXXXXXXXXXXXXXXXXXXXXKRNKDGDDSASPSSSVTANGKVLILAKESLEMVRNV 346
                                               S  V+ NGKVLILAKESL MV NV
Sbjct: 302 ------------------------------------SKGVSPNGKVLILAKESLGMVHNV 325

Query: 347 MGVVDSTLGXXXXXXXXXXXXXXMIRERFL 376
           M VVD+TLG              ++++++L
Sbjct: 326 MNVVDNTLGKAEEWVKQKQEVKELLKKQYL 355

>Scas_709.57
          Length = 394

 Score =  161 bits (407), Expect = 2e-45,   Method: Compositional matrix adjust.
 Identities = 102/237 (43%), Positives = 130/237 (54%), Gaps = 37/237 (15%)

Query: 55  ILDRVSNKIISNVVTFYDEINTNKRPLKSIGRLLXXXXXXXXXXXXXXXX---------- 104
           +LDRV      NV TFYD+ ++ KR + SI RLL                          
Sbjct: 74  LLDRV----YKNVATFYDDFSSRKR-VASIARLLDDAYEENYTDAENEDEEQEKGGYNDE 128

Query: 105 -------------FFTNKRQKLSRAIAKGKDNLKEYKLNMSIESKKRLVTCLHLLKLANK 151
                        +  +KR+KLS A+ K KDN KEYKLNMSIESKKRL+TCLHLLKLANK
Sbjct: 129 DGDNDGVDNEWDEYVVSKRRKLSEALLKSKDNFKEYKLNMSIESKKRLITCLHLLKLANK 188

Query: 152 QLSDKISCLQDLVEKEQV------HPLHKQDG---NARTTTGAGXXXXXXXXXXXXXXXX 202
           QLSDK++ LQ+LVE+E+       H + K++    N +                      
Sbjct: 189 QLSDKVTFLQELVEEEETVKEEDSHAIEKKEHVVRNKKQQHTEHEDDEDEDEDEDEDEFF 248

Query: 203 XXXXQVNASEQSIVVKMEVVGTVKKVYSLISKFTANSLPEPARSQVRESLLNLPTNW 259
                VN  E+  ++ ME+VGT+KKVYSL+SK+   SLPEPAR+QVRE+LLNLPTNW
Sbjct: 249 DANESVNYDEKCTIINMEIVGTIKKVYSLVSKYGGTSLPEPARTQVREALLNLPTNW 305

 Score = 58.9 bits (141), Expect = 2e-09,   Method: Compositional matrix adjust.
 Identities = 29/51 (56%), Positives = 34/51 (66%)

Query: 326 VTANGKVLILAKESLEMVRNVMGVVDSTLGXXXXXXXXXXXXXXMIRERFL 376
           +T NGKVLILAKESL +VRN+M VVDS+LG              MIRE+FL
Sbjct: 332 LTTNGKVLILAKESLNVVRNIMDVVDSSLGKAEEWVKQKQELKEMIREQFL 382

>CAGL0K03267g 299090..300553 similar to tr|AAB65073 Saccharomyces
           cerevisiae YHL020c Negative regulator of phospholipid
           biosynthesis, hypothetical start
          Length = 487

 Score =  162 bits (410), Expect = 4e-45,   Method: Compositional matrix adjust.
 Identities = 88/159 (55%), Positives = 108/159 (67%), Gaps = 5/159 (3%)

Query: 106 FTNKRQKLSRAIAKGKDNLKEYKLNMSIESKKRLVTCLHLLKLANKQLSDKISCLQDLVE 165
           + +KR+ LS A+AKG+ NL+EYKL MSIESKKRL+TCLHLLKLANKQLSDK++ LQD VE
Sbjct: 198 YYSKRKALSEALAKGRYNLREYKLTMSIESKKRLITCLHLLKLANKQLSDKVAYLQDAVE 257

Query: 166 KEQVHPLHKQDGNARTTTGAGXXXXXXXXXXXXXXXXXXXXQVNASEQSIVVKMEVVGTV 225
           KEQ    + ++    T    G                      N+ +    + +E+VGTV
Sbjct: 258 KEQ-ELANGEEVKKETRALNGEHSGPQNDDDLEFYDASESVDQNSGD----LGLEIVGTV 312

Query: 226 KKVYSLISKFTANSLPEPARSQVRESLLNLPTNWFDSVH 264
           KKVYSLISK+T +SLPEPARSQVRESLLNLP+NW  SVH
Sbjct: 313 KKVYSLISKYTGSSLPEPARSQVRESLLNLPSNWNTSVH 351

 Score = 52.0 bits (123), Expect = 5e-07,   Method: Compositional matrix adjust.
 Identities = 26/51 (50%), Positives = 34/51 (66%)

Query: 326 VTANGKVLILAKESLEMVRNVMGVVDSTLGXXXXXXXXXXXXXXMIRERFL 376
           V++NGK LILAKESL MV++V+ VVDSTLG              MI+++FL
Sbjct: 380 VSSNGKYLILAKESLNMVQSVIDVVDSTLGRAEEWVKQKQELKEMIKKKFL 430

>ABR048W [639] [Homologous to ScYHL020C (OPI1) - SH]
           complement(481129..482202) [1074 bp, 357 aa]
          Length = 357

 Score =  155 bits (393), Expect = 9e-44,   Method: Compositional matrix adjust.
 Identities = 102/270 (37%), Positives = 138/270 (51%), Gaps = 77/270 (28%)

Query: 108 NKRQKLSRAIAKGKDNLKEYKLNMSIESKKRLVTCLHLLKLANKQLSDKISCLQDLVEKE 167
           +KRQK+       K+NLKEY+L MSIESKK+L+TCLHLLKLAN+QLS  +  LQDLV+KE
Sbjct: 135 SKRQKI-------KENLKEYRLTMSIESKKQLITCLHLLKLANRQLSSTVGSLQDLVQKE 187

Query: 168 QVHPLHKQDGNARTTTGAGXXXXXXXXXXXXXXXXXXXXQVNASEQSIVVKMEVVGTVKK 227
                 ++D   R                          +   SE+S  +KMEVVGTVKK
Sbjct: 188 ------REDSGPR------------EPEEEDGEQYFDASETIVSERSKEIKMEVVGTVKK 229

Query: 228 VYSLISKFTANSLPEPARSQVRESLLNLPTNWFDSVHSTSLPHHASFHYANCEEQKVEXX 287
           VYSLIS+F  +SLPEPARSQVRE+LL +PTNW  +V+S S                    
Sbjct: 230 VYSLISRFAGSSLPEPARSQVRETLLKMPTNWSLTVNSAS-------------------- 269

Query: 288 XXXXXXXXXXXXXXXXXXXXXXXKRNKDGDDSASPSSS-VTANGKVLILAKESLEMVRNV 346
                                            +P+++ ++AN K+LILA+ESL+MV N+
Sbjct: 270 -------------------------------RETPTNARLSANSKMLILAEESLDMVSNI 298

Query: 347 MGVVDSTLGXXXXXXXXXXXXXXMIRERFL 376
           + V D TLG              +I+ +++
Sbjct: 299 IQVFDMTLGRAEEWVKHKQELKELIKSQYM 328

>KLLA0F25388g complement(2362150..2363367) some similarities with
           sp|P21957 Saccharomyces cerevisiae YHL020c OPI1 negative
           regulator of phospholipid biosynthesis pathway
           singleton, hypothetical start
          Length = 405

 Score =  130 bits (326), Expect = 1e-33,   Method: Compositional matrix adjust.
 Identities = 79/173 (45%), Positives = 99/173 (57%), Gaps = 33/173 (19%)

Query: 121 KDNLKEYKLNMSIESKKRLVTCLHLLKLANKQLSDKISCLQDLVEKEQVH---PL----- 172
           K+NLKEY+LNMSIESKKRL+TCL LLKLANKQLS ++  LQD+V+KEQ+    PL     
Sbjct: 148 KENLKEYQLNMSIESKKRLMTCLGLLKLANKQLSQRVMSLQDVVKKEQLRRRSPLPISSS 207

Query: 173 ------HKQDGNARTTTGAGXXXXXXXXXXXXXXXXXXXXQVNAS-----------EQSI 215
                  +   + R TT +                     Q+N             EQ  
Sbjct: 208 IDAEVRPRNHCSVRETTSSAEHPGHDRDEEEDEQFFDASSQLNEQAGNRKQDDTNKEQED 267

Query: 216 V--------VKMEVVGTVKKVYSLISKFTANSLPEPARSQVRESLLNLPTNWF 260
           +        +++EVVGT+KKVYS++S+FT NSLPEPARSQVRESLL LPT W 
Sbjct: 268 LDIDAAANDIQLEVVGTLKKVYSVVSRFTGNSLPEPARSQVRESLLKLPTKWM 320

 Score = 44.3 bits (103), Expect = 1e-04,   Method: Compositional matrix adjust.
 Identities = 23/59 (38%), Positives = 35/59 (59%), Gaps = 1/59 (1%)

Query: 318 DSASPSSS-VTANGKVLILAKESLEMVRNVMGVVDSTLGXXXXXXXXXXXXXXMIRERF 375
           +S  P+S  +++N + L+LA+E+L+MV NVM VVD TLG              M+ E+F
Sbjct: 322 NSEKPNSKRISSNKRALLLAQEALDMVGNVMNVVDGTLGKAEEWVKNKQELKQMLMEQF 380

>Sklu_2074.2 YPL256C, Contig c2074 3646-5190
          Length = 514

 Score = 30.0 bits (66), Expect = 3.3,   Method: Compositional matrix adjust.
 Identities = 22/72 (30%), Positives = 32/72 (44%), Gaps = 5/72 (6%)

Query: 22  VLKQSCRQKSQPSEDVSQADKMPASESSTT-----PLNILDRVSNKIISNVVTFYDEINT 76
           V+ QSCR K  P     Q +  P +   T       L++  RV+N I  + V  YD   +
Sbjct: 45  VISQSCRLKPDPKLVDQQPEMNPHATRHTIVTFLFELSVKTRVTNGIFFHAVRLYDRYCS 104

Query: 77  NKRPLKSIGRLL 88
            +  LK   RL+
Sbjct: 105 KRIVLKDQARLV 116

  Database: blastdb
    Posted date:  Apr 3, 2006  3:33 PM
  Number of letters in database: 16,596,109
  Number of sequences in database:  34,618
  
Lambda     K      H
   0.312    0.127    0.344 

Gapped
Lambda     K      H
   0.267   0.0410    0.140 

Matrix: BLOSUM62
Gap Penalties: Existence: 11, Extension: 1
Number of Sequences: 34618
Number of Hits to DB: 9,381,682
Number of extensions: 306395
Number of successful extensions: 853
Number of sequences better than 10.0: 10
Number of HSP's gapped: 849
Number of HSP's successfully gapped: 19
Length of query: 398
Length of database: 16,596,109
Length adjustment: 104
Effective length of query: 294
Effective length of database: 12,995,837
Effective search space: 3820776078
Effective search space used: 3820776078
Neighboring words threshold: 11
Window for multiple hits: 40
X1: 16 ( 7.2 bits)
X2: 38 (14.6 bits)
X3: 64 (24.7 bits)
S1: 42 (21.9 bits)
S2: 63 (28.9 bits)