Hit NameLength (aa)HSP LengthHSP ScoreHSP Significance
YGR197C (SNG1)54751424470.0
CAGL0G09273g54542412511e-167
Scas_617.354151511741e-156
YJR015W51043010881e-143
Sklu_2316.348742910801e-142
Kwal_55.2210649542010781e-142
CAGL0B03949g63242810631e-138
Scas_647.944941310391e-137
KLLA0E02134g53951510041e-130
CAGL0B03971g5434339941e-129
ADL193C4654297128e-88
Scas_434.13572624561e-51
Scas_617.0d46451703e-15
Kwal_23.372447373740.57
KLLA0E20911g67643701.8
Scas_716.151052136701.9
BLASTP 2.2.26 [Sep-21-2011]

Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, 
Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), 
"Gapped BLAST and PSI-BLAST: a new generation of protein database search
programs",  Nucleic Acids Res. 25:3389-3402.

Reference for compositional score matrix adjustment: Altschul, Stephen F., 
John C. Wootton, E. Michael Gertz, Richa Agarwala, Aleksandr Morgulis,
Alejandro A. Schaffer, and Yi-Kuo Yu (2005) "Protein database searches
using compositionally adjusted substitution matrices", FEBS J. 272:5101-5109.

Query= YGR197C
         (538 letters)

Database: blastdb 
           34,618 sequences; 16,596,109 total letters

Searching..................................................done

                                                                 Score    E
Sequences producing significant alignments:                      (bits) Value

YGR197C (SNG1) [2147] chr7 complement(892500..894143) Probable t...   947   0.0  
CAGL0G09273g 885374..887011 similar to sp|P46950 Saccharomyces c...   486   e-167
Scas_617.3                                                            456   e-156
YJR015W (YJR015W) [2918] chr10 (462635..464167) Protein with sim...   423   e-143
Sklu_2316.3 , Contig c2316 10494-11957 reverse complement             420   e-142
Kwal_55.22106                                                         419   e-142
CAGL0B03949g complement(387861..389759) similar to sp|P46950 Sac...   414   e-138
Scas_647.9                                                            404   e-137
KLLA0E02134g complement(200436..202055) similar to sp|P46950 Sac...   391   e-130
CAGL0B03971g complement(390700..392331) similar to sp|P47090 Sac...   387   e-129
ADL193C [1548] [Homologous to ScYGR197C (SNG1) - NSH] (357909..3...   278   8e-88
Scas_434.1                                                            180   1e-51
Scas_617.0d                                                            70   3e-15
Kwal_23.3724                                                           33   0.57 
KLLA0E20911g complement(1857426..1859456) weakly similar to sp|P...    32   1.8  
Scas_716.15                                                            32   1.9  

>YGR197C (SNG1) [2147] chr7 complement(892500..894143) Probable
           transport protein, confers resistance to MNNG and
           nitrosoguanidine [1644 bp, 547 aa]
          Length = 547

 Score =  947 bits (2447), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 471/514 (91%), Positives = 471/514 (91%)

Query: 1   MTKSVGDEESQYIEDPSFAAAAAFTGGRDGVSYSNQRFAEGSGHSSDLAKSLEDYRPPDE 60
           MTKSVGDEESQYIEDPSFAAAAAFTGGRDGVSYSNQRFAEGSGHSSDLAKSLEDYRPPDE
Sbjct: 1   MTKSVGDEESQYIEDPSFAAAAAFTGGRDGVSYSNQRFAEGSGHSSDLAKSLEDYRPPDE 60

Query: 61  KPSSLSSVXXXXXXXXXXXXXXXXPLARIQTGLFSPRLRNHRKKILSKFVLNNFFIACVC 120
           KPSSLSSV                PLARIQTGLFSPRLRNHRKKILSKFVLNNFFIACVC
Sbjct: 61  KPSSLSSVGEGGANEEEKGGNDGGPLARIQTGLFSPRLRNHRKKILSKFVLNNFFIACVC 120

Query: 121 VSLISIYWGACYGTDRYFFKVKNIVVLQDAPSNTSVQXXXXXXXXXXXXVPGTWHIYNAT 180
           VSLISIYWGACYGTDRYFFKVKNIVVLQDAPSNTSVQ            VPGTWHIYNAT
Sbjct: 121 VSLISIYWGACYGTDRYFFKVKNIVVLQDAPSNTSVQSISAIIPSLLASVPGTWHIYNAT 180

Query: 181 SFHRKFGTTNSTEIDRKIVDLIYDERYWLALNVKPNATDTLYNSLISQDANXXXXXXXXX 240
           SFHRKFGTTNSTEIDRKIVDLIYDERYWLALNVKPNATDTLYNSLISQDAN         
Sbjct: 181 SFHRKFGTTNSTEIDRKIVDLIYDERYWLALNVKPNATDTLYNSLISQDANSEFNSSIFF 240

Query: 241 XXXXXXGRDPSSVKSTILPLMQQLEVRLQKYYVKEYLPSLMSNITSNDRDLNINMENWAI 300
                 GRDPSSVKSTILPLMQQLEVRLQKYYVKEYLPSLMSNITSNDRDLNINMENWAI
Sbjct: 241 ESVFESGRDPSSVKSTILPLMQQLEVRLQKYYVKEYLPSLMSNITSNDRDLNINMENWAI 300

Query: 301 AGQLLFTYNDYRPFADRILMAPLQVGLIYCILLTVLQLSLYGKLHGEMARVLKPKHILIY 360
           AGQLLFTYNDYRPFADRILMAPLQVGLIYCILLTVLQLSLYGKLHGEMARVLKPKHILIY
Sbjct: 301 AGQLLFTYNDYRPFADRILMAPLQVGLIYCILLTVLQLSLYGKLHGEMARVLKPKHILIY 360

Query: 361 RLLISWATYFLLSIGFCTVSAIFRIDFTPAFGRGGFVVYWMSTWLVMMAVGGANENVLSL 420
           RLLISWATYFLLSIGFCTVSAIFRIDFTPAFGRGGFVVYWMSTWLVMMAVGGANENVLSL
Sbjct: 361 RLLISWATYFLLSIGFCTVSAIFRIDFTPAFGRGGFVVYWMSTWLVMMAVGGANENVLSL 420

Query: 421 VIAYCPPYLSIWLMTWIILNISASFYPMVLNNEFYRYGYIMPIHNAVDIYKVIFLNLTKR 480
           VIAYCPPYLSIWLMTWIILNISASFYPMVLNNEFYRYGYIMPIHNAVDIYKVIFLNLTKR
Sbjct: 421 VIAYCPPYLSIWLMTWIILNISASFYPMVLNNEFYRYGYIMPIHNAVDIYKVIFLNLTKR 480

Query: 481 KMGRNYGILVAWVALNTSLMPFCMKFAGKKMQKN 514
           KMGRNYGILVAWVALNTSLMPFCMKFAGKKMQKN
Sbjct: 481 KMGRNYGILVAWVALNTSLMPFCMKFAGKKMQKN 514

>CAGL0G09273g 885374..887011 similar to sp|P46950 Saccharomyces
           cerevisiae YGR197c SNG1 or sp|P47090 Saccharomyces
           cerevisiae YJR015w, hypothetical start
          Length = 545

 Score =  486 bits (1251), Expect = e-167,   Method: Compositional matrix adjust.
 Identities = 225/424 (53%), Positives = 306/424 (72%), Gaps = 4/424 (0%)

Query: 93  LFSPRLRNHRKKILSKFVLNNFFIACVCVSLISIYWGACYGTDRYFFKVKNIVVLQDAPS 152
           + +P+L +H+  +  +F   N  +A VC+S+I IYWGA Y T+ Y FKV  + V+QD   
Sbjct: 105 ILNPKLESHKSVLAFQFCFTNVLLATVCLSIICIYWGAAYRTEHYLFKVNILSVIQDQDY 164

Query: 153 NTSVQXXXXXXXXXXXXVPGTWHIYNATSFHRKFGTTNSTE-IDRKIVDLIYDERYWLAL 211
           N ++Q             PGTWH+YN +SF  K+G  N++E +D+KI DLI++E+YW++L
Sbjct: 165 N-NIQSMASTLPALIDQTPGTWHLYNRSSFVEKYGIENTSEAVDKKITDLIFEEKYWMSL 223

Query: 212 NVKPNATDTLYNSLISQDANXXXXXXXXXXXXXXXGRDPSSVKSTILPLMQQLEVRLQKY 271
           NVK  AT+ LYNSL    A                GRDP+++KS ILP+MQQL+    +Y
Sbjct: 224 NVKTGATEALYNSLTDNTA-PAFNSSAYFECMFESGRDPTNLKSAILPIMQQLQAAYVQY 282

Query: 272 YVKEYLPSLMSNITSNDRDL-NINMENWAIAGQLLFTYNDYRPFADRILMAPLQVGLIYC 330
           Y   YLPS++ N+++    + ++N  + A +G   F Y DYRPF DR+L+APLQVGLI+ 
Sbjct: 283 YTSTYLPSMLRNVSATINSIGDVNPLSLANSGNFEFNYIDYRPFFDRVLLAPLQVGLIFT 342

Query: 331 ILLTVLQLSLYGKLHGEMARVLKPKHILIYRLLISWATYFLLSIGFCTVSAIFRIDFTPA 390
           ++LTV+QLSLYG +H +M RV KPKH L+YR  +SW+TYF+LS+ FCTVSAI++IDFT A
Sbjct: 343 LILTVVQLSLYGPMHAKMVRVFKPKHFLLYRYGLSWSTYFILSLFFCTVSAIYQIDFTLA 402

Query: 391 FGRGGFVVYWMSTWLVMMAVGGANENVLSLVIAYCPPYLSIWLMTWIILNISASFYPMVL 450
           FGRGGFV+YW++T+ VM+A+G  NENV+SL++AYCP Y+ IWL++WIILNIS SFYPMVL
Sbjct: 403 FGRGGFVIYWITTFYVMLAIGATNENVISLIVAYCPQYMPIWLISWIILNISPSFYPMVL 462

Query: 451 NNEFYRYGYIMPIHNAVDIYKVIFLNLTKRKMGRNYGILVAWVALNTSLMPFCMKFAGKK 510
           NN+FYRYGY MP+HNAVDIY+VIFL+L++ K+GRNYGIL AWVA+   + PF MK AG K
Sbjct: 463 NNQFYRYGYAMPLHNAVDIYRVIFLDLSRNKLGRNYGILTAWVAVTHIIFPFVMKIAGTK 522

Query: 511 MQKN 514
           M+ N
Sbjct: 523 MKSN 526

>Scas_617.3
          Length = 541

 Score =  456 bits (1174), Expect = e-156,   Method: Compositional matrix adjust.
 Identities = 230/515 (44%), Positives = 329/515 (63%), Gaps = 24/515 (4%)

Query: 4   SVGDEESQYIEDPSFAAAAAFTGGRDGVSYSNQRFAEGSGHSSDLAKSLEDYRPPDEKPS 63
           SV DEESQ I D +    AA    +   SY+   F+  +G              PD + +
Sbjct: 39  SVTDEESQ-INDTNSEKDAA----KGSNSYAVNSFSSAAGSQPQAYN-------PDGQNT 86

Query: 64  SLSSVXXXXXXXXXXXXXXXXPLARIQTGLFSPRLRNHRKKILSKFVLNNFFIACVCVSL 123
           +  +V                P++  +T L+SP+L + RKKI  KF+++N  +A VC+S+
Sbjct: 87  AKPAVTQPEENEENV------PISPTKTRLYSPKLASQRKKITVKFIISNLLLAGVCLSI 140

Query: 124 ISIYWGACYGTDRYFFKVKNIVVLQD---APSNTSVQXXXXXXXXXXXXVPGTWHIYNAT 180
           +S+YWG+ Y T ++  ++  I ++QD    P++ ++               G WH+YN +
Sbjct: 141 LSLYWGSLYQTTKHLERISIIAIIQDDYIPPNDLNLTSVVAPVPSFIEQSTGKWHVYNQS 200

Query: 181 SFHRKFGTTNSTEIDRKIVDLIYDERYWLALNVKPNATDTLYNSLISQDANXXXXXXXXX 240
            F  KF   + T I+ ++  LI+DE+YW+ALN+  N T  + NSL + +           
Sbjct: 201 YFQEKFNVQDPTMINERLNALIHDEKYWIALNIGANLTMRIVNSLTTPN-EPFFNSTQHI 259

Query: 241 XXXXXXGRDPSSVKSTILPLMQQLEVRLQKYYVKEYLPSLMSNITSNDRD--LNINMENW 298
                  R+P+++++ +LP++Q++E+  Q +Y  EYLP L+S + ++      N    N 
Sbjct: 260 RVVYETSREPTTLEAYMLPIIQEIELAYQDFYHTEYLPELLSKLQNSTTTPLSNTGAANL 319

Query: 299 AIAGQLLFTYNDYRPFADRILMAPLQVGLIYCILLTVLQLSLYGKLHGEMARVLKPKHIL 358
           A  G+  F Y+D   F DRIL+APLQVGLIYC++LTV QLSL+G LH EMA+ LKPKHI+
Sbjct: 320 ANIGKFQFDYDDILVFPDRILIAPLQVGLIYCLILTVFQLSLFGPLHAEMAKYLKPKHII 379

Query: 359 IYRLLISWATYFLLSIGFCTVSAIFRIDFTPAFGRGGFVVYWMSTWLVMMAVGGANENVL 418
           IYRL +SWATYF LS+ FCTVSAIF+IDFT  FG+GGFV+YWM+T+LVM+A+GGANENVL
Sbjct: 380 IYRLSVSWATYFFLSLFFCTVSAIFQIDFTVTFGKGGFVIYWMTTYLVMLALGGANENVL 439

Query: 419 SLVIAYCPPYLSIWLMTWIILNISASFYPMVLNNEFYRYGYIMPIHNAVDIYKVIFLNLT 478
           SL+I + P YL +WL++WII+NIS +F PMVL+N FYRYGY+MP+H A+DI+KV+FLN++
Sbjct: 440 SLIILFIPEYLPLWLLSWIIMNISPTFNPMVLDNVFYRYGYMMPLHQALDIFKVVFLNVS 499

Query: 479 KRKMGRNYGILVAWVALNTSLMPFCMKFAGKKMQK 513
           KR MGRNYGILVAW+ +NT L P  MK  GK +QK
Sbjct: 500 KRHMGRNYGILVAWIVVNTCLFPLVMKIVGKTVQK 534

>YJR015W (YJR015W) [2918] chr10 (462635..464167) Protein with
           similarity to Sng1p and multidrug resistance proteins
           [1533 bp, 510 aa]
          Length = 510

 Score =  423 bits (1088), Expect = e-143,   Method: Compositional matrix adjust.
 Identities = 211/430 (49%), Positives = 290/430 (67%), Gaps = 9/430 (2%)

Query: 92  GLFSPRLRNHRKKILSKFVLNNFFIACVCVSLISIYWGACYGTDRYFFKVKNIVVLQDAP 151
             FSP L+  RKK+L KFV  N  +A +C ++  ++WGA Y T +Y  KVK +VV+Q+ P
Sbjct: 73  SFFSPNLQGQRKKVLLKFVFTNCLLAIICFTMFVLFWGALYDTSKYLHKVKLLVVIQEPP 132

Query: 152 -------SNTSVQXXXXXXXXXXXXVPGTWHIYNATSFHRKFGTTNSTEIDRKIVDLIYD 204
                  S+  V             +P  W IYN+ +F  KF      +++ K+VDL+YD
Sbjct: 133 VVILDNNSSMVVPSISYALPTFINKIPCDWDIYNSPTFQAKFDVNTPQQVNDKVVDLVYD 192

Query: 205 ERYWLALNVKPNATDTLYNSLISQDANXXXXXXXXXXXXXXXGRDPSSVKSTILPLMQQL 264
           E+YW A+N+KPNAT+TL+ SLI+ D                 GRDP+++KSTILP+ Q +
Sbjct: 193 EKYWFAINIKPNATETLFESLIN-DTAPLFNSTLFNQVVYETGRDPTNLKSTILPVAQTI 251

Query: 265 EVRLQKYYVKEYLPSLMSNITSNDR-DLNINMENWAIAGQLLFTYNDYRPFADRILMAPL 323
           E     +Y   YLP L++NIT   R  L  N    A AG+  + Y D+RPF DRIL+AP 
Sbjct: 252 EEYYHTFYTLNYLPPLLTNITQVYRYALTNNARYIAAAGKYNYEYYDHRPFTDRILLAPT 311

Query: 324 QVGLIYCILLTVLQLSLYGKLHGEMARVLKPKHILIYRLLISWATYFLLSIGFCTVSAIF 383
           Q+G++YC+LLT  Q  LYG LH EMA+VL+P + LIYR+ +SW T+F  S+ FCT +AIF
Sbjct: 312 QIGVVYCLLLTFFQFLLYGPLHVEMAKVLRPANGLIYRIAMSWFTFFFASLFFCTTTAIF 371

Query: 384 RIDFTPAFGRGGFVVYWMSTWLVMMAVGGANENVLSLVIAYCPPYLSIWLMTWIILNISA 443
           ++DFT +FGRGGFVVYWMSTWL M+A GGANEN + LVI   P YL  W+++++ILNI+ 
Sbjct: 372 QVDFTKSFGRGGFVVYWMSTWLFMLAAGGANENAVMLVITLGPQYLGFWILSFVILNIAP 431

Query: 444 SFYPMVLNNEFYRYGYIMPIHNAVDIYKVIFLNLTKRKMGRNYGILVAWVALNTSLMPFC 503
           SF+P+ LNN  YRYGY+MP+HN +DIY+VIF ++T+RKMGRNYGILVA +ALNT+L+PF 
Sbjct: 432 SFFPLALNNNVYRYGYMMPVHNVIDIYRVIFFDVTRRKMGRNYGILVALIALNTALLPFV 491

Query: 504 MKFAGKKMQK 513
            K+A +K+++
Sbjct: 492 GKYASRKLKQ 501

>Sklu_2316.3 , Contig c2316 10494-11957 reverse complement
          Length = 487

 Score =  420 bits (1080), Expect = e-142,   Method: Compositional matrix adjust.
 Identities = 208/429 (48%), Positives = 280/429 (65%), Gaps = 12/429 (2%)

Query: 86  LARIQTGLFSPRLRNHRKKILSKFVLNNFFIACVCVSLISIYWGACYGTDRYFFKVKNIV 145
           L R+ T  FSPRL+  RK +  +F+ N   +A + +S+ S+YWGA Y  + +  KV+ + 
Sbjct: 58  LQRMATSFFSPRLQAQRKHVWFQFLFNILALAALTISVFSLYWGALYNRNSHLGKVRILA 117

Query: 146 VLQDAPSNTSVQXXXXXXXXXXXXVPGTWHIYNATSFHRKFGTTNSTEIDRKIVDLIYDE 205
           V+QD  S                  PG WH+Y +  F  K+   N T+ID KI  L++ +
Sbjct: 118 VIQDDGSLPGALPAIIDAN------PGGWHVYTSEQFQSKY-HINETQIDSKIEHLVHTQ 170

Query: 206 RYWLALNVKPNATDTLYNSLISQDANXXXXXXXXXXXXXXXGRDPSSVKSTILPLMQQLE 265
           ++W++LNVKPNAT+ L+ SL +  A+               GRDP++ +S+ILPL+Q++E
Sbjct: 171 KFWMSLNVKPNATNALHESLQNPSADPFVASNYFEAIYES-GRDPTNFRSSILPLLQEVE 229

Query: 266 VRLQKYYVKEYLPSLMSNITSNDRDLNINMENWAIAGQLLFTYNDYRPFADRILMAPLQV 325
           +  QK Y   YLP L+S+   +    N +  N A AG L F   D RPF++ +L+ PLQV
Sbjct: 230 LSFQKNYTSSYLPELLSHTNLS----NASPANLAAAGNLEFCSEDMRPFSNYVLLGPLQV 285

Query: 326 GLIYCILLTVLQLSLYGKLHGEMARVLKPKHILIYRLLISWATYFLLSIGFCTVSAIFRI 385
           GLI+C+LLT  QL+++G LHG ++  LKP HILIYR  IS   YF LS+ FCTVSAIF++
Sbjct: 286 GLIFCVLLTFFQLAMFGPLHGMVSPKLKPAHILIYRYCISMTAYFFLSLFFCTVSAIFQV 345

Query: 386 DFTPAFGRGGFVVYWMSTWLVMMAVGGANENVLSLVIAYCPPYLSIWLMTWIILNISASF 445
           DFTP FGR GF+VYWMSTWL+M AVGGANENVLSL++ Y   YL  WL+ WI+ NIS SF
Sbjct: 346 DFTPTFGRAGFMVYWMSTWLIMAAVGGANENVLSLILPYGAQYLGFWLVFWIVSNISPSF 405

Query: 446 YPMVLNNEFYRYGYIMPIHNAVDIYKVIFLNLTKRKMGRNYGILVAWVALNTSLMPFCMK 505
           +P+ L N FYRYGY+MPIHNA+DIYKVIFLN  K  +GRNYGIL AWV +N+ L    +K
Sbjct: 406 FPLALMNNFYRYGYMMPIHNAMDIYKVIFLNTYKGTLGRNYGILCAWVVINSILFVPVLK 465

Query: 506 FAGKKMQKN 514
             G KM++N
Sbjct: 466 IVGNKMKQN 474

>Kwal_55.22106
          Length = 495

 Score =  419 bits (1078), Expect = e-142,   Method: Compositional matrix adjust.
 Identities = 198/420 (47%), Positives = 283/420 (67%), Gaps = 7/420 (1%)

Query: 86  LARIQTGLFSPRLRNHRKKILSKFVLNNFFIACVCVSLISIYWGACYGTDRYFFKVKNIV 145
           L+R+ TG FS R++  R+K++ +F+LN+F +A + +S+ S+YWGA Y   ++  KVK + 
Sbjct: 63  LSRVVTGFFSDRVKGERRKLIMRFLLNHFLLAMLIMSVFSLYWGATYQRSKHMHKVKILA 122

Query: 146 VLQDAPSNTSVQXXXXXXXXXXXXVPGTWHIYNATSFHRKFGTTNSTEIDRKIVDLIYDE 205
           V+QD P   +               PGTWH+YN +SF +K+G     E+D KI  L++D+
Sbjct: 123 VVQDEPGTGT--GIASSIPTLAEQAPGTWHVYNTSSFQQKYGVAQD-EVDAKIQQLVHDQ 179

Query: 206 RYWLALNVKPNATDTLYNSLISQDANXXXXXXXXXXXXXXXGRDPSSVKSTILPLMQQLE 265
           +YW++LNVKPNAT TL  SL +  A+               GRDP+++KS+ILP+   LE
Sbjct: 180 KYWVSLNVKPNATSTLIESLQNSRASPFNSSAFFELFYES-GRDPTNLKSSILPIALSLE 238

Query: 266 VRLQKYYVKEYLPSLMSNITSNDRDLNINMENWAIAGQLLFTYNDYRPFADRILMAPLQV 325
            R Q  Y    LP ++SNIT    D++ N+   A+AG ++F   D RPF D +L+ PLQV
Sbjct: 239 SRYQNIYASTILPGILSNITQRVGDVSRNV---AMAGNMVFAQVDNRPFNDYVLLGPLQV 295

Query: 326 GLIYCILLTVLQLSLYGKLHGEMARVLKPKHILIYRLLISWATYFLLSIGFCTVSAIFRI 385
           GLIYCILLT  QL+L+G +H  + + LKP H+L+YR +I++  YF LS+ FC VS  F++
Sbjct: 296 GLIYCILLTFFQLALFGPIHALLGQKLKPVHMLLYRYVIAFVNYFFLSLFFCLVSLAFQV 355

Query: 386 DFTPAFGRGGFVVYWMSTWLVMMAVGGANENVLSLVIAYCPPYLSIWLMTWIILNISASF 445
           DFT AFGR GF+V WMS+WL+M AVGGANEN+L++++A+ P YL  WL+ W++LNIS +F
Sbjct: 356 DFTKAFGRAGFMVAWMSSWLLMAAVGGANENMLTIIMAFGPQYLGFWLIFWVVLNISPAF 415

Query: 446 YPMVLNNEFYRYGYIMPIHNAVDIYKVIFLNLTKRKMGRNYGILVAWVALNTSLMPFCMK 505
           YPM L + FYRYGY+ PI+N V I++V FL+L +  +GRNYGIL AW+ LN ++ PF MK
Sbjct: 416 YPMELTHNFYRYGYMTPIYNGVGIFRVTFLDLYRGHLGRNYGILCAWIVLNMAIFPFVMK 475

>CAGL0B03949g complement(387861..389759) similar to sp|P46950
           Saccharomyces cerevisiae YGR197c SNG1 or sp|P47090
           Saccharomyces cerevisiae YJR015w, hypothetical start
          Length = 632

 Score =  414 bits (1063), Expect = e-138,   Method: Compositional matrix adjust.
 Identities = 188/428 (43%), Positives = 280/428 (65%), Gaps = 5/428 (1%)

Query: 90  QTGLFSPRLRNHRKKILSKFVLNNFFIACVCVSLISIYWGACYGTDRYFFKVKNIVVLQD 149
           +T LFS R+++HR++IL+KF+  +  +A   +  +S+YWGA Y      ++V +I V+QD
Sbjct: 168 KTSLFSKRMKDHRRRILAKFISTHILLAIFVIGALSLYWGAIYNYSGNLYRVHSIAVIQD 227

Query: 150 ----APSNTSVQXXXXXXXXXXXXVPGTWHIYNATSFHRKFGTTNSTEIDRKIVDLIYDE 205
               AP  T +             +PG W I N+T F   +  TN+ EID K+ +LI+DE
Sbjct: 228 EPYTAPDGTVIPALTRNVTNIINSIPGNWRIMNSTEFKVIYNVTNAQEIDEKVAELIFDE 287

Query: 206 RYWLALNVKPNATDTLYNSLISQDANXXXXXXXXXXXXXXXGRDPSSVKSTILPLMQQLE 265
           ++WLA+NV+  AT+  Y S ++++                 GRDP+++KS+I P++ + E
Sbjct: 288 KFWLAVNVREGATEAFYKS-VTEEGAPVFNSTNYFQSIYESGRDPTNLKSSIYPILAKFE 346

Query: 266 VRLQKYYVKEYLPSLMSNITSNDRDLNINMENWAIAGQLLFTYNDYRPFADRILMAPLQV 325
              +  Y+K Y+P  + NITS D +  +N  N    G       D RPF DR+L+ PL +
Sbjct: 347 SVFRSQYLKIYVPEFIKNITSPDFNETVNTANLYGLGNFATNSYDLRPFTDRVLLGPLSM 406

Query: 326 GLIYCILLTVLQLSLYGKLHGEMARVLKPKHILIYRLLISWATYFLLSIGFCTVSAIFRI 385
           GL Y I+ +V  +S++G ++ EMA+ LKP+ +  YR+LISW+ +F LS+  CTVSAIF+I
Sbjct: 407 GLNYNIMFSVFSISIFGPVNKEMAKYLKPRSLFFYRILISWSMFFFLSLFTCTVSAIFQI 466

Query: 386 DFTPAFGRGGFVVYWMSTWLVMMAVGGANENVLSLVIAYCPPYLSIWLMTWIILNISASF 445
           DFTP FG+ GFV+YWM++WLVM AVG ANEN+LS+++ +CP Y+S W++ W ILNI+ S 
Sbjct: 467 DFTPGFGKAGFVIYWMTSWLVMTAVGMANENILSIILTFCPQYMSYWMIIWTILNIAPSL 526

Query: 446 YPMVLNNEFYRYGYIMPIHNAVDIYKVIFLNLTKRKMGRNYGILVAWVALNTSLMPFCMK 505
           YP+VL + FYR+GY MPIHN V IY+VIFL++++ +M RNYGIL AWVA+NT++ PF  K
Sbjct: 527 YPLVLISRFYRFGYAMPIHNGVQIYRVIFLDISRHQMSRNYGILAAWVAVNTAINPFVNK 586

Query: 506 FAGKKMQK 513
           F  K ++K
Sbjct: 587 FISKVVKK 594

>Scas_647.9
          Length = 449

 Score =  404 bits (1039), Expect = e-137,   Method: Compositional matrix adjust.
 Identities = 182/413 (44%), Positives = 272/413 (65%), Gaps = 2/413 (0%)

Query: 98  LRNHRKKILSKFVLNNFFIACVCVSLISIYWGACYGTDRYFFKVKNIVVLQD-APSNTSV 156
           ++  RK +L  F   N  +A  C ++  ++WG  Y     + +V+ + V+QD   +N++V
Sbjct: 1   MKGERKNVLINFAFTNGVLAVFCFTIFVLFWGINYRITDKYHRVQILAVIQDEGINNSTV 60

Query: 157 QXXXXXXXXXXXXVPGTWHIYNATSFHRKFGTTNSTEIDRKIVDLIYDERYWLALNVKPN 216
                         P TWH+YN TSF+ KFGT ++  ID++++  ++ E YW+ALNVKPN
Sbjct: 61  LPMASILPTLMQENPATWHLYNTTSFNEKFGTNSTEAIDKEVIHEVFSEHYWMALNVKPN 120

Query: 217 ATDTLYNSLISQDANXXXXXXXXXXXXXXXGRDPSSVKSTILPLMQQLEVRLQKYYVKEY 276
           AT  L+ + I+ +                  RDPS+ + T+LPL++ LE   + YY+  Y
Sbjct: 121 ATQALFETFINPNG-PPFNSTEYFQAVFLSARDPSNFRVTLLPLIEFLETAYRNYYINTY 179

Query: 277 LPSLMSNITSNDRDLNINMENWAIAGQLLFTYNDYRPFADRILMAPLQVGLIYCILLTVL 336
            P  MSN++  +    +N+ N A+AG + F Y DYRPF +R L+AP+ +G+ YC+LLT  
Sbjct: 180 FPQFMSNVSIANNLTTVNVTNIALAGAMNFDYFDYRPFTERELIAPVMIGVAYCLLLTFF 239

Query: 337 QLSLYGKLHGEMARVLKPKHILIYRLLISWATYFLLSIGFCTVSAIFRIDFTPAFGRGGF 396
           Q  +Y  LH E +R+LKP  ++ YR+++ W T F+ S+ FCT SAIF++DFT AFG+GGF
Sbjct: 240 QFLVYSGLHAETSRLLKPNQVIYYRIIMLWCTMFIASLFFCTTSAIFQVDFTRAFGKGGF 299

Query: 397 VVYWMSTWLVMMAVGGANENVLSLVIAYCPPYLSIWLMTWIILNISASFYPMVLNNEFYR 456
           VVYWM+TWL M+A GG NEN +SL+    P +L IW++++IILNI+ +FYP++L N  YR
Sbjct: 300 VVYWMTTWLFMVACGGTNENAVSLLFLMGPRFLGIWILSFIILNITPTFYPLILANPVYR 359

Query: 457 YGYIMPIHNAVDIYKVIFLNLTKRKMGRNYGILVAWVALNTSLMPFCMKFAGK 509
           YGY+MP+HNA+DIY+VIFL+L+K KMGRN+G+L+AW+A+NT+ +PF  KF  K
Sbjct: 360 YGYMMPVHNAIDIYRVIFLDLSKHKMGRNFGLLIAWIAMNTAALPFVYKFVSK 412

>KLLA0E02134g complement(200436..202055) similar to sp|P46950
           Saccharomyces cerevisiae YGR197c SNG1 involved in
           nitroguanidine resistance, start by similarity
          Length = 539

 Score =  391 bits (1004), Expect = e-130,   Method: Compositional matrix adjust.
 Identities = 212/515 (41%), Positives = 293/515 (56%), Gaps = 29/515 (5%)

Query: 3   KSVGDEESQYIEDPSFAAAAAFTGGRDGVSYSNQRFAEGSGHSSDLAKSLEDYRPPDE-- 60
           +S  DEESQ            F G   G        A     + D + S E     +E  
Sbjct: 43  ESSADEESQ-----------GFAGNESGRKSRTPSLAMVGEDNQDQSTSDEQAESVEEFN 91

Query: 61  KPSSLSSVXXXXXXXXXXXXXXXXPLARIQTGLFSPRLRNHRKKILSKFVLNNFFIACVC 120
           K S+                     L R++T  FS +L  HR     +F LN F +  + 
Sbjct: 92  KESANIDDKNEEQNDGSPAEAGQPALGRVKTRFFSSKLSTHRNIFARRFALNCFLLGSLA 151

Query: 121 VSLISIYWGACYGTDRYFFKVKNIVVLQDAPSNTSVQXXXXXXXXXXXXVPGTWHIYNAT 180
           +++ S+YWGA Y     +  VK I V++D                    +P  + +YN +
Sbjct: 152 IAMFSLYWGALYNHSSDYHNVKFIAVVED-----DGDMGAGVIPIMDSAIP-QFFVYNTS 205

Query: 181 SFHRKFGTTNSTEIDRKIVDLIYDERYWLALNVKPNATDTLYNSLISQDANXXXXXXXXX 240
           SF  K+G      I  K+  L++ +++W +L V P  TD   +SL + DA          
Sbjct: 206 SFRDKYG--QDVNISEKVHHLVHTKKFWGSLIVYPGTTDAFVDSLTTDDA-PAFNSTDYF 262

Query: 241 XXXXXXGRDPSSVKSTILPLMQQLEVRLQK-YYVKEYLPSLMSNITSNDRDLNINMENWA 299
                  RD S+++++I+PL+  +E   +K ++  +Y PS+++NIT      NI+  N +
Sbjct: 263 EFFYKTARDLSNMRASIVPLLTSIETTYKKTFFYNDYFPSVIANIT------NISGPNLS 316

Query: 300 IAGQLLFTYNDYRPFADRILMAPLQVGLIYCILLTVLQLSLYGKLHGEMARVLKPKHILI 359
            AG + +   D RPF D  L+ P+QVGLIYCILLT  QL+L+G  H  ++ +LKPKHI++
Sbjct: 317 AAGDMNWKQIDNRPFTDYTLLGPMQVGLIYCILLTFFQLALFGPFHAMLSPLLKPKHIIL 376

Query: 360 YRLLISWATYFLLSIGFCTVSAIFRIDFTPAFGRGGFVVYWMSTWLVMMAVGGANENVLS 419
           YRL+ SWATYF LS+ FCTVSAIF +DFT AFGRGGFVVYWM+TW++M AVGGANENVLS
Sbjct: 377 YRLVTSWATYFFLSLFFCTVSAIFHVDFTLAFGRGGFVVYWMTTWILMGAVGGANENVLS 436

Query: 420 LVIAYCPPYLSIWLMTWIILNISASFYPMVLNNEFYRYGYIMPIHNAVDIYKVIFLNLTK 479
           +++AYCP YL  WL++WII+NISASF P+VL N FYRYGY+ PI+NA++IY+VIF +  K
Sbjct: 437 ILLAYCPQYLGFWLISWIIINISASFVPLVLANRFYRYGYMTPIYNAMEIYRVIFTDTYK 496

Query: 480 RKMGRNYGILVAWVALNTSLMPFCMKFAGKKMQKN 514
             MGRNYGIL AW  LNT L PF MK  G+K   +
Sbjct: 497 GDMGRNYGILAAWCVLNTLLFPFVMKIVGQKFMND 531

>CAGL0B03971g complement(390700..392331) similar to sp|P47090
           Saccharomyces cerevisiae YJR015w or sp|P46950
           Saccharomyces cerevisiae YGR197c SNG1, hypothetical
           start
          Length = 543

 Score =  387 bits (994), Expect = e-129,   Method: Compositional matrix adjust.
 Identities = 188/433 (43%), Positives = 274/433 (63%), Gaps = 8/433 (1%)

Query: 86  LARIQTGLFSPRLRNHRKKILSKFVLNNFFIACVCVSLISIYWGACYGTDRYFFKVKNIV 145
           L + +T  FSP  ++ RK++  +++L  F + C C +++ + WG  Y T  Y  + K + 
Sbjct: 103 LTKTKTRFFSPNFKDQRKRVAYRWLLAVFLLMCFCFTILVLMWGVLYRTPHYVRRAKVLA 162

Query: 146 VLQDAPS---NTSVQ--XXXXXXXXXXXXVPGTWHIYNATSFHRKFGTTNSTEIDRKIVD 200
           V+Q+      N +VQ              VP +W IYNATSF  K+       +++K++D
Sbjct: 163 VIQEDQVYRFNDTVQFPSVSSPLYDIIAEVPLSWEIYNATSFQIKYNVEGIEAMNQKVID 222

Query: 201 LIYDERYWLALNVKPNATDTLYNSLISQDANXXXXXXXXXXXXXXXGRDPSSVKSTILPL 260
           L+Y E +WLALNV+ N TDTL  SLIS D++               GRD +++ S +LP+
Sbjct: 223 LVYKEEFWLALNVQGNVTDTLVRSLISADSDVQFNSTSLFEVVYESGRDITNLPSVLLPV 282

Query: 261 MQQLEVRLQKYYVKEYLPSLMSNITSNDRDLNINMENWAIAGQLLFTYNDYRPFADRILM 320
            Q +E   QK Y  +YLP L+ NIT+ D   N N    A AG++ F YNDYRP  DR+ +
Sbjct: 283 FQGIEGVFQKVYTYQYLPQLLGNITNGD---NFNPARVAAAGRMKFNYNDYRPVTDRVTL 339

Query: 321 APLQVGLIYCILLTVLQLSLYGKLHGEMARVLKPKHILIYRLLISWATYFLLSIGFCTVS 380
              Q+G +YC+LLTV Q  ++G LHGEM+R++K  ++ IYRL++ W+  F +SI +CTVS
Sbjct: 340 LSTQIGAVYCLLLTVFQFLVFGPLHGEMSRMIKFSNLWIYRLIVLWSVLFFVSIFWCTVS 399

Query: 381 AIFRIDFTPAFGRGGFVVYWMSTWLVMMAVGGANENVLSLVIAYCPPYLSIWLMTWIILN 440
           A++++DFT AFGR GFVVYWMST+L M+AVGG NENV+ L+I   P Y+  W+++++ILN
Sbjct: 400 AMYQVDFTKAFGRAGFVVYWMSTYLYMLAVGGLNENVIMLIILISPSYIGFWILSFVILN 459

Query: 441 ISASFYPMVLNNEFYRYGYIMPIHNAVDIYKVIFLNLTKRKMGRNYGILVAWVALNTSLM 500
           ++ +F+ +   N FYRYGY MP+H  V I +VIF +++K ++GRNYGIL AWV LNT  M
Sbjct: 460 LAPAFFAIGYANVFYRYGYAMPLHCIVGINRVIFFDISKHQLGRNYGILCAWVGLNTISM 519

Query: 501 PFCMKFAGKKMQK 513
           PF  KF  K + K
Sbjct: 520 PFVSKFVLKTLHK 532

>ADL193C [1548] [Homologous to ScYGR197C (SNG1) - NSH]
           (357909..359306) [1398 bp, 465 aa]
          Length = 465

 Score =  278 bits (712), Expect = 8e-88,   Method: Compositional matrix adjust.
 Identities = 153/429 (35%), Positives = 239/429 (55%), Gaps = 8/429 (1%)

Query: 86  LARIQTGLFSPRLRNHRKKILSKFVLNNFFIACVCVSLISIYWGACYGTDRYFFKVKNIV 145
           LAR++T   SPR+   RK++L  F+ N  F+AC+ + + S++ G      +Y  ++  ++
Sbjct: 44  LARLKTRFMSPRVYLARKRLLVLFLSNKLFLACLVLVVFSLHVGVLVNQQQYLGRLPMLM 103

Query: 146 VLQDAPSNTSVQXXXXXXXXXXXXVPGTWHIYNATSFHRKFGTTNSTEIDRKIVDLIYDE 205
           V+QD  +  S +              G W   +  +    FG     ++D  +  LI   
Sbjct: 104 VVQDEDAGMSAELLRAAEH-----AAGRWTTVHGAAAWSHFGLEEDADLDEYLQSLIRKH 158

Query: 206 RYWLALNVKPNATDTLYNSLISQDANXXXXXXXXXXXXXXXGRDPSSVKSTILPLMQQLE 265
           RYW+AL+V+P AT+ L  SL    A                 RD +++ S +  LM+ LE
Sbjct: 159 RYWMALHVRPGATEALRRSLDDPGAPVFNSSEFFKVYYETV-RDFNAMGS-VRKLMETLE 216

Query: 266 VRLQKYYVKEYLPSLMSNITSNDRDLNINMENWAIAGQLLFTYNDYRPFADRILMAPLQV 325
              + YY+  +LP  +    +N  DL+    N   AG + ++Y D  PF D  L   LQV
Sbjct: 217 ANFRAYYLDTWLPGELRE-RANTIDLSSTGSNIVAAGSMRWSYVDLGPFYDPSLYGILQV 275

Query: 326 GLIYCILLTVLQLSLYGKLHGEMARVLKPKHILIYRLLISWATYFLLSIGFCTVSAIFRI 385
           G+I C+LLT  QL++   LH E++ +L+  H+L+YR ++S+A+Y LLS+ +  V  I+ +
Sbjct: 276 GMIICLLLTFFQLAMISALHTELSLLLRTSHLLLYRYIVSYASYLLLSLFYSIVPIIYHL 335

Query: 386 DFTPAFGRGGFVVYWMSTWLVMMAVGGANENVLSLVIAYCPPYLSIWLMTWIILNISASF 445
           D   A+GR GF+V+WM+TWL M A+GGANENV+S++  YCP ++  WLM WI+ NI+ +F
Sbjct: 336 DMEKAYGRAGFLVFWMTTWLFMTALGGANENVISVIFEYCPRFVGFWLMFWIVFNITPTF 395

Query: 446 YPMVLNNEFYRYGYIMPIHNAVDIYKVIFLNLTKRKMGRNYGILVAWVALNTSLMPFCMK 505
           Y + L N+FY+YGYI PI+NA + YKV+  +  +  +   Y +LVAW  LN +L P  +K
Sbjct: 396 YSLHLANDFYKYGYITPIYNARECYKVLLFDTDRGYLKVAYVVLVAWTVLNAALFPLALK 455

Query: 506 FAGKKMQKN 514
               K  K 
Sbjct: 456 IVNIKSGKQ 464

>Scas_434.1
          Length = 357

 Score =  180 bits (456), Expect = 1e-51,   Method: Compositional matrix adjust.
 Identities = 92/262 (35%), Positives = 151/262 (57%), Gaps = 6/262 (2%)

Query: 86  LARIQTGLFSPRLRNHRKKILSKFVLNNFFIACVCVSLISIYWGACYGTDRYFFKVKNIV 145
           LA  +T LFSP L  HRKKI  KF+  N  I   C +++ I+WG  YGT++YF KV  ++
Sbjct: 94  LAPAKTTLFSPHLTQHRKKIFWKFISINAIIGLFCCTVLPIFWGCLYGTNQYFHKVHYLM 153

Query: 146 VLQDAP---SNTSVQXXXXXXXXXXXXVPGTWHIYNATSFHRKFGTTNSTEIDRKIVDLI 202
           V+QD P      SV             +PGTWH+YN ++F   +  TN+++I+ K+VDLI
Sbjct: 154 VVQDEPLQLGGLSVPSMASFLPEIVPSLPGTWHVYNTSTFMDHYHLTNASDINNKVVDLI 213

Query: 203 YDERYWLALNVKPNATDTLYNSLISQDANXXXXXXXXX---XXXXXXGRDPSSVKSTILP 259
           + ER+W+A+NVKPNAT +L  SL+   +                    RD +SV++ ++ 
Sbjct: 214 FQERFWVAVNVKPNATASLMQSLVQPQSTTPETLFNATNFFQVIYETARDVTSVQAAMVL 273

Query: 260 LMQQLEVRLQKYYVKEYLPSLMSNITSNDRDLNINMENWAIAGQLLFTYNDYRPFADRIL 319
           ++Q++E   ++ Y+++YLP++++ +   ++  ++   + + A  + F Y DYR F +R L
Sbjct: 274 VVQEMESAYREIYMEQYLPTILAQMDPTNQISSLAPTSLSRATNINFQYWDYRSFYNRAL 333

Query: 320 MAPLQVGLIYCILLTVLQLSLY 341
           M PL  G IY + +TV Q  ++
Sbjct: 334 MGPLLAGTIYSLTITVFQFLIF 355

>Scas_617.0d
          Length = 46

 Score = 70.1 bits (170), Expect = 3e-15,   Method: Composition-based stats.
 Identities = 30/45 (66%), Positives = 36/45 (80%)

Query: 469 IYKVIFLNLTKRKMGRNYGILVAWVALNTSLMPFCMKFAGKKMQK 513
           +YKVIF +L + KMGRNYGILVAW+ LNT L PF MKF GK +Q+
Sbjct: 2   VYKVIFCDLERSKMGRNYGILVAWIVLNTCLFPFIMKFVGKTLQE 46

>Kwal_23.3724
          Length = 473

 Score = 33.1 bits (74), Expect = 0.57,   Method: Compositional matrix adjust.
 Identities = 21/73 (28%), Positives = 36/73 (49%), Gaps = 11/73 (15%)

Query: 402 STWLVMMAVGGANENVLSLVIAYCPPYLSIWLMTWIILNISASFYPMVLNNEFYRYGYIM 461
           S+ +V++  GG NE ++S    Y         +TW I++  +   P   +N F R+  ++
Sbjct: 377 SSNIVLLGGGGYNEKLMSRFYTY---------LTWRIVSKYSENAPT--DNPFDRHDDVI 425

Query: 462 PIHNAVDIYKVIF 474
           P H  +D YK  F
Sbjct: 426 PDHEFIDSYKDEF 438

>KLLA0E20911g complement(1857426..1859456) weakly similar to
           sp|P40071 Saccharomyces cerevisiae YER113c, start by
           similarity
          Length = 676

 Score = 31.6 bits (70), Expect = 1.8,   Method: Compositional matrix adjust.
 Identities = 17/43 (39%), Positives = 24/43 (55%), Gaps = 3/43 (6%)

Query: 106 LSKFVLNNFFIACVCVSLISI---YWGACYGTDRYFFKVKNIV 145
           L  F+L+N  I C+C+ L+SI   Y    YG D   FK  N++
Sbjct: 549 LYGFLLSNIVIVCICICLLSIIGCYIHLNYGNDSLNFKWDNVI 591

>Scas_716.15
          Length = 1052

 Score = 31.6 bits (70), Expect = 1.9,   Method: Compositional matrix adjust.
 Identities = 35/136 (25%), Positives = 57/136 (41%), Gaps = 10/136 (7%)

Query: 332 LLTVLQLSLYGKLHGEMARVLKPKHILIYRLLISWATYFLLSIGFCTVSAIFRIDFTPAF 391
           +LT L     GKLH        P+HILI    I    YFLL  G    + + + +++  F
Sbjct: 336 MLTGLTFYSLGKLHLGKIVGFFPRHILIG--CIGGVGYFLLVTGIEVTTRVAKFEYSIPF 393

Query: 392 GRGGFVVYWMSTWLVMMAVGGANENVLSLVIAYCPP----YLSIWLMTWIILNISASFYP 447
               F   W + W  ++ V      V+ +V   C        S +++T I+ +   +  P
Sbjct: 394 LASLFS-DWATLWKWLLPVL---LTVILIVTQRCFKNSLVLPSFYILTLILFHFIVAIIP 449

Query: 448 MVLNNEFYRYGYIMPI 463
            +  N+    G+I PI
Sbjct: 450 SLTLNQLRDSGWIFPI 465

  Database: blastdb
    Posted date:  Apr 3, 2006  3:33 PM
  Number of letters in database: 16,596,109
  Number of sequences in database:  34,618
  
Lambda     K      H
   0.324    0.138    0.425 

Gapped
Lambda     K      H
   0.267   0.0410    0.140 

Matrix: BLOSUM62
Gap Penalties: Existence: 11, Extension: 1
Number of Sequences: 34618
Number of Hits to DB: 15,658,150
Number of extensions: 625740
Number of successful extensions: 1962
Number of sequences better than 10.0: 19
Number of HSP's gapped: 1978
Number of HSP's successfully gapped: 19
Length of query: 538
Length of database: 16,596,109
Length adjustment: 106
Effective length of query: 432
Effective length of database: 12,926,601
Effective search space: 5584291632
Effective search space used: 5584291632
Neighboring words threshold: 11
Window for multiple hits: 40
X1: 15 ( 7.0 bits)
X2: 38 (14.6 bits)
X3: 64 (24.7 bits)
S1: 40 (21.5 bits)
S2: 64 (29.3 bits)