Hit NameLength (aa)HSP LengthHSP ScoreHSP Significance
YGR196C (FYV8)81780333060.0
Scas_617.47914198691e-104
CAGL0G09295g7673628141e-96
Kwal_33.154559142826036e-66
KLLA0D09603g8202885442e-58
ACR036C7542803571e-34
Sklu_1278.245088712.1
ABL126W62467712.2
BLASTP 2.2.26 [Sep-21-2011]

Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, 
Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), 
"Gapped BLAST and PSI-BLAST: a new generation of protein database search
programs",  Nucleic Acids Res. 25:3389-3402.

Reference for compositional score matrix adjustment: Altschul, Stephen F., 
John C. Wootton, E. Michael Gertz, Richa Agarwala, Aleksandr Morgulis,
Alejandro A. Schaffer, and Yi-Kuo Yu (2005) "Protein database searches
using compositionally adjusted substitution matrices", FEBS J. 272:5101-5109.

Query= YGR196C
         (803 letters)

Database: blastdb 
           34,618 sequences; 16,596,109 total letters

Searching..................................................done

                                                                 Score    E
Sequences producing significant alignments:                      (bits) Value

YGR196C (FYV8) [2146] chr7 complement(889736..892189) Protein of...  1278   0.0  
Scas_617.4                                                            339   e-104
CAGL0G09295g 887666..889969 similar to sp|P46949 Saccharomyces c...   318   1e-96
Kwal_33.15455                                                         236   6e-66
KLLA0D09603g 811234..813696 weakly similar to sp|P46949 Saccharo...   214   2e-58
ACR036C [1084] [Homologous to ScYGR196C (FYV8) - SH] (423030..42...   142   1e-34
Sklu_1278.2 YKL179C, Contig c1278 1474-2822 reverse complement         32   2.1  
ABL126W [466] [Homologous to ScYMR278W - SH] complement(159209.....    32   2.2  

>YGR196C (FYV8) [2146] chr7 complement(889736..892189) Protein of
           unknown function [2454 bp, 817 aa]
          Length = 817

 Score = 1278 bits (3306), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 646/803 (80%), Positives = 646/803 (80%)

Query: 1   MSTEQVGRKKSYRWVSASQASYDGAGWXXXXXXXXXXXXGTKGSEIHKQKISNLPSLPKL 60
           MSTEQVGRKKSYRWVSASQASYDGAGW            GTKGSEIHKQKISNLPSLPKL
Sbjct: 1   MSTEQVGRKKSYRWVSASQASYDGAGWDSSDEYDYSSEDGTKGSEIHKQKISNLPSLPKL 60

Query: 61  NYTDVNGEHDENTGEXXXXXXXXXXXXXXXPSDKEVGYLSDGVPKLMASRESVELQAKKS 120
           NYTDVNGEHDENTGE               PSDKEVGYLSDGVPKLMASRESVELQAKKS
Sbjct: 61  NYTDVNGEHDENTGENKDSNDNNVSKSDISPSDKEVGYLSDGVPKLMASRESVELQAKKS 120

Query: 121 SEHSKSDYLSSTASLKSPSENKKSPHTNRAVNEDLDNLIEQISREMTPEIRQTSDFRRDS 180
           SEHSKSDYLSSTASLKSPSENKKSPHTNRAVNEDLDNLIEQISREMTPEIRQTSDFRRDS
Sbjct: 121 SEHSKSDYLSSTASLKSPSENKKSPHTNRAVNEDLDNLIEQISREMTPEIRQTSDFRRDS 180

Query: 181 DSCDEIQNEAPLGEAXXXXXXXXXXDEKSHSLGVSMDTNEADTTFNTPTRNGNEHLSSDG 240
           DSCDEIQNEAPLGEA          DEKSHSLGVSMDTNEADTTFNTPTRNGNEHLSSDG
Sbjct: 181 DSCDEIQNEAPLGEAVPSSSSPVEEDEKSHSLGVSMDTNEADTTFNTPTRNGNEHLSSDG 240

Query: 241 DVSEQKDDEFKVSERGYLADILPAEKEENLQQEDDGEVXXXXXXXXXXXXXXXXXIRNRN 300
           DVSEQKDDEFKVSERGYLADILPAEKEENLQQEDDGEV                 IRNRN
Sbjct: 241 DVSEQKDDEFKVSERGYLADILPAEKEENLQQEDDGEVESSGALEKKEKSEEKTSIRNRN 300

Query: 301 STSSGQDKVAKPKPVANETKTSDNGYRNSFFNDYQHXXXXXXXXXXXXXXXXXXXXXXXX 360
           STSSGQDKVAKPKPVANETKTSDNGYRNSFFNDYQH                        
Sbjct: 301 STSSGQDKVAKPKPVANETKTSDNGYRNSFFNDYQHSSDSEEDDNNEGNSGSSDDDNRSS 360

Query: 361 XXXKHADINRQSKQLDTTDDDALSYTESIKYSTXXXXXXXXXXXXXXXXXXXXXXXXXXX 420
              KHADINRQSKQLDTTDDDALSYTESIKYST                           
Sbjct: 361 VSDKHADINRQSKQLDTTDDDALSYTESIKYSTNETEEEDNEDNESIEDKNEDNESIEDE 420

Query: 421 XXXXXSYKFSNREKGSILLTSDEEEEEKGMSSDSDEGSLKAPKSGYFSKMIGNDDKGDSA 480
                SYKFSNREKGSILLTSDEEEEEKGMSSDSDEGSLKAPKSGYFSKMIGNDDKGDSA
Sbjct: 421 NEDTDSYKFSNREKGSILLTSDEEEEEKGMSSDSDEGSLKAPKSGYFSKMIGNDDKGDSA 480

Query: 481 LQPNQIDTIXXXXXXXXXXXXXXXXXXXXXDHINEDKVLEESSVKDSTDVDSWKPDSEAL 540
           LQPNQIDTI                     DHINEDKVLEESSVKDSTDVDSWKPDSEAL
Sbjct: 481 LQPNQIDTIENTNLSNSGSELENSDGSDEEDHINEDKVLEESSVKDSTDVDSWKPDSEAL 540

Query: 541 RSGFVQDTANKKAPPGYVIDSNGKLVDLTPASMKPRVVSTYSEMESTWDAFPSKGEDDDL 600
           RSGFVQDTANKKAPPGYVIDSNGKLVDLTPASMKPRVVSTYSEMESTWDAFPSKGEDDDL
Sbjct: 541 RSGFVQDTANKKAPPGYVIDSNGKLVDLTPASMKPRVVSTYSEMESTWDAFPSKGEDDDL 600

Query: 601 ETIRDTKTIYDNNTIYNVPGLIGNQSNLPPLPMDAQEQLXXXXXXXXXXXXXXXXXXXXX 660
           ETIRDTKTIYDNNTIYNVPGLIGNQSNLPPLPMDAQEQL                     
Sbjct: 601 ETIRDTKTIYDNNTIYNVPGLIGNQSNLPPLPMDAQEQLNAGNDNSTTDNDNSNNTANDL 660

Query: 661 XXRSASFKSENRTVSQGEMTSVHEPSTEEMAKLGQQNNLPKLDMNKLLNSKTSHAGKIEQ 720
             RSASFKSENRTVSQGEMTSVHEPSTEEMAKLGQQNNLPKLDMNKLLNSKTSHAGKIEQ
Sbjct: 661 AARSASFKSENRTVSQGEMTSVHEPSTEEMAKLGQQNNLPKLDMNKLLNSKTSHAGKIEQ 720

Query: 721 LRNYKRELDEYDTGIQTWINYTLKSSSNKDKDFIAEEYKQHSHVREAYANADDLSKKHTV 780
           LRNYKRELDEYDTGIQTWINYTLKSSSNKDKDFIAEEYKQHSHVREAYANADDLSKKHTV
Sbjct: 721 LRNYKRELDEYDTGIQTWINYTLKSSSNKDKDFIAEEYKQHSHVREAYANADDLSKKHTV 780

Query: 781 INTVASVNQNVTHLRRKVFQHSM 803
           INTVASVNQNVTHLRRKVFQHSM
Sbjct: 781 INTVASVNQNVTHLRRKVFQHSM 803

>Scas_617.4
          Length = 791

 Score =  339 bits (869), Expect = e-104,   Method: Compositional matrix adjust.
 Identities = 192/419 (45%), Positives = 254/419 (60%), Gaps = 58/419 (13%)

Query: 427 YKFSNREKGSIL----LTSDEEEEEKGMSSDSDEGSLKAPKSGYFSKMIGNDDKGDSALQ 482
           +KFS + + SIL        EE ++  + + SD  S K  +SGYF K++  D+   S  Q
Sbjct: 371 FKFSTKNRQSILQSSSEEEGEENDDHSLQNSSDMESFKVSESGYFEKLLEEDEMNPSTDQ 430

Query: 483 ------------------------PNQIDTIXXXXXXXXXXXXXXXXXXXXXDHINEDK- 517
                                   P  I++                      D  +E+  
Sbjct: 431 ESHHEELDKEENNSEGTEDDILSIPASIESDKVEENPEGINKEADETSEKEKDRESENSK 490

Query: 518 --------VLEESSVKDSTDVDSWKPDSEALRSGFVQDTANKKAPPGYVIDSNGKLVDLT 569
                   + E  S +DS ++ SWKPD++A+RSGFVQDT NK+APPG+V D NGKLVDLT
Sbjct: 491 SGDDQETTITEGDSSRDSINLGSWKPDTDAIRSGFVQDT-NKRAPPGFVYDENGKLVDLT 549

Query: 570 PASMKPRVVSTYSEMESTWDAFPSKGE---DDDLETIRDTKTIYDNNTIYNVPGLIGNQS 626
           P+SMKPRVVSTYSEMESTW AFPS G    ++DLETI+DTKT+YDNNTI+NVPG++ N  
Sbjct: 550 PSSMKPRVVSTYSEMESTWAAFPSNGNPENNEDLETIKDTKTLYDNNTIFNVPGIMTNNE 609

Query: 627 NLPPLPMDAQEQLXXXXXXXXXXXXXXXXXXXXXXXRSASFKSENRTVS--QGEMTSVHE 684
           NLPPLP +                             +A  + + +++     E  SVH+
Sbjct: 610 NLPPLPKNVN---------------IEQGSLPVARTLTAGSEVDKKSIKSIHSEGPSVHK 654

Query: 685 PSTEEMAKLGQQNNLPKLDMNKLLNSKTSHAGKIEQLRNYKRELDEYDTGIQTWINYTLK 744
           P + EMAKL  Q+ LP+LD+N+L++SK SH  KIEQL+ Y + L +YD+GIQTWINYTLK
Sbjct: 655 PDSYEMAKLSDQDPLPELDLNELISSKASHLSKIEQLQAYSQSLADYDSGIQTWINYTLK 714

Query: 745 SSSNKDKDFIAEEYKQHSHVREAYANADDLSKKHTVINTVASVNQNVTHLRRKVFQHSM 803
           SSS  D+D++ +EYK++ HVREAYANA+DLS+K+TVINTVASVNQNV+HLR+KVF HSM
Sbjct: 715 SSSKADRDYLFDEYKKNEHVREAYANAEDLSRKNTVINTVASVNQNVSHLRKKVFSHSM 773

 Score = 73.9 bits (180), Expect = 3e-13,   Method: Compositional matrix adjust.
 Identities = 68/199 (34%), Positives = 88/199 (44%), Gaps = 35/199 (17%)

Query: 1   MSTEQVGRKKSYRWVSASQASYDGAGWXXXXXXXXXXXXGTKGSEIHKQKISNLPSLPKL 60
           MS+E VGRKKS+RW SASQA+YDGA W              +     +  ++ LPSLPKL
Sbjct: 1   MSSENVGRKKSHRWASASQATYDGADWNSSDSDEDHAISNEEA----QPNVTKLPSLPKL 56

Query: 61  NYTDVNGEHDENTGEXXXXXXXXXXXXXXXPSDKEVGYLSDGVP---KLMASRESVELQA 117
           NYT  N E +E                         G L+D      KL  S E      
Sbjct: 57  NYTS-NEEEEE-------------------------GKLTDNAEENGKLPNSEEEERPTL 90

Query: 118 KKSSEHSKSDYLSSTASLKSPSENKKSPHTNRAVNEDLDNLIEQISREMTPEIRQTSDF- 176
             ++E  ++D  SS    KS     +     R VN DLDNL+ QIS+EMTP++     F 
Sbjct: 91  HITTE-DETDRSSSNNESKSSLNRTRRNSPMRGVNTDLDNLMLQISKEMTPKLENEPVFP 149

Query: 177 RRDSDSCDEIQNEAPLGEA 195
            RDS +    +   P   A
Sbjct: 150 PRDSPTSASREGSTPFYNA 168

>CAGL0G09295g 887666..889969 similar to sp|P46949 Saccharomyces
           cerevisiae YGR196c, start by similarity
          Length = 767

 Score =  318 bits (814), Expect = 1e-96,   Method: Compositional matrix adjust.
 Identities = 170/362 (46%), Positives = 231/362 (63%), Gaps = 18/362 (4%)

Query: 445 EEEKGMSSDSDEGSLKAPKSGYFSKMIG---NDDKGDSALQPNQIDTIXXXXXXXXXXXX 501
           EE++ ++S   +G +   KSGYF K++     D K D     N + +             
Sbjct: 407 EEDEVLNSTLTDGDVHVHKSGYFKKLVAEELGDKKLDDGKSLNNVASTQTASTEDKVASD 466

Query: 502 XXXXXXXXXDHINEDKVLEESSVKDSTDVDSWKPDSEALRSGFVQDTANKKAPPGYVIDS 561
                    D+ +       SS + S   + W+PD++ALR GF+Q T +   PPG+V D 
Sbjct: 467 TEDVQESKADNDDTKNDAHVSSNRSSVTSEEWRPDTDALRDGFMQKTGDN-PPPGFVRDE 525

Query: 562 NGKLVDLTPASMKPRVVSTYSEMESTWDAFPSKGEDDDLETIRDTKTIYDNNTIYNVPGL 621
            G+LVDLTPASMKPRVVSTYSE+ESTW+AFPS+ + DDLETIRDTKT+YDN+T+YNVPG+
Sbjct: 526 KGELVDLTPASMKPRVVSTYSEIESTWNAFPSE-DADDLETIRDTKTLYDNSTLYNVPGI 584

Query: 622 IGNQSNLPPLPMDAQEQLXXXXXXXXXXXXXXXXXXXXXXXRSASFKSENRTVSQGEMTS 681
           + N   LPPLP DA                           R+AS     R VS+ E  +
Sbjct: 585 MTNNDALPPLPEDA---------SLYRDSNQSDAVGSQDRARAASV---TRKVSK-EGVN 631

Query: 682 VHEPSTEEMAKLGQQNNLPKLDMNKLLNSKTSHAGKIEQLRNYKRELDEYDTGIQTWINY 741
           + +P+++E+ KL +QN +P  D+NK+++S ++HA K+E LR+Y+  LD +D+G+QTWI Y
Sbjct: 632 IAQPTSQEINKLSEQNTMPTRDLNKIISSNSTHAIKLENLRDYRNTLDNFDSGLQTWIAY 691

Query: 742 TLKSSSNKDKDFIAEEYKQHSHVREAYANADDLSKKHTVINTVASVNQNVTHLRRKVFQH 801
           TLKSSS  D+DFI +EYK +SHVREAYANADDLS+K+TVINTV +VNQNV HLR+KV QH
Sbjct: 692 TLKSSSKTDRDFIFQEYKSNSHVREAYANADDLSRKNTVINTVTNVNQNVNHLRKKVLQH 751

Query: 802 SM 803
           S+
Sbjct: 752 SL 753

 Score = 83.2 bits (204), Expect = 3e-16,   Method: Compositional matrix adjust.
 Identities = 70/200 (35%), Positives = 97/200 (48%), Gaps = 32/200 (16%)

Query: 1   MSTEQVGRKKSYRWVSASQASYDGAGWXXXXXXXXXXXXGTKGSEIHKQKISNLPSLPKL 60
           M   QV RKKSYRWVSASQA+YDGAGW              K  ++ +    +LPSLPKL
Sbjct: 1   MDESQVERKKSYRWVSASQATYDGAGWDSSSESETETRSQPKLGKLDE----SLPSLPKL 56

Query: 61  NY--TDVNG---EHDENTGEXXXXXXXXXXXXXXXPSDKEVGYLSDGVPKLMASRESVEL 115
           NY  TDV+    E DE+T                  S+ +   + +  P +  + + ++ 
Sbjct: 57  NYDNTDVSQYKEEDDEDTDNRTEKAGEIGAGTLHSNSEIQNDVIVEDDPVIKQTPDMID- 115

Query: 116 QAKKSSEHSKSDYLSSTASLK--SPSEN------KKSPHTNRAVNEDLDNLIEQISREMT 167
                    K   L+S  + K  SPS N       + P  NRAVNE LD+L+ +IS+E+T
Sbjct: 116 ---------KDTLLTSPTAHKESSPSPNGSRHTFSRRPLPNRAVNEHLDDLMLEISKELT 166

Query: 168 PEIRQTSDF-----RRDSDS 182
           P+  Q + F     R+D DS
Sbjct: 167 PKPEQEAVFGNHSPRKDIDS 186

>Kwal_33.15455
          Length = 914

 Score =  236 bits (603), Expect = 6e-66,   Method: Compositional matrix adjust.
 Identities = 130/282 (46%), Positives = 178/282 (63%), Gaps = 15/282 (5%)

Query: 525 KDSTDVDSWKPDSEALRSGFVQDTANKKAPPGYVIDSNGKLVDLTPASMK-PRVVSTYSE 583
           + S ++  W+PD++A R+ F+   A  + P GYV+D +G+LV++ P+SM+  RVVSTYSE
Sbjct: 629 RQSVNLGKWQPDTDAGRAEFL-GQAKPEVPEGYVVDQDGQLVNVNPSSMRDARVVSTYSE 687

Query: 584 MESTWDAFP-SKGEDDDLETIRDTKTIYDNNTIYNVPGLIGNQSNLPPLPMDAQEQLXXX 642
            ES W+AFP S G   DL+TI DTKTIYDN TI+NVPGL  N  +LPPLP D        
Sbjct: 688 AESAWNAFPASAGNGGDLDTIYDTKTIYDNQTIHNVPGLATNNDSLPPLPRDITAVDSSL 747

Query: 643 XXXXXXXXXXXXXXXXXXXXRSASFKSENRTVSQGEMTSVHEPSTEEMAKLGQQNNLPKL 702
                                 ++ K         E  SVH P  EE+A L +Q  +P  
Sbjct: 748 SANVTDSDSILNHLNGVKRHHYSNLK---------ESFSVHTPDQEEIA-LVKQKAVPTA 797

Query: 703 DMNKLLNSK-TSHAGKIEQLRNYKRELDEYDTGIQTWINYTLKSSSNKDKDFIAEEYKQH 761
           D++ L+  K T+HA KI  L  +  EL +YD+G+ TWI+Y LK+S++ DKD+I + YK  
Sbjct: 798 DLDALITRKNTTHAAKINDLNKHFNELKDYDSGLHTWISYALKTSTS-DKDYIFQNYKVS 856

Query: 762 SHVREAYANADDLSKKHTVINTVASVNQNVTHLRRKVFQHSM 803
           +HV++AY++ADDLSKK TV NTVA+VNQNV+HL+RKVF H+M
Sbjct: 857 THVKDAYSHADDLSKKMTVSNTVANVNQNVSHLKRKVFSHTM 898

 Score = 42.4 bits (98), Expect = 0.002,   Method: Compositional matrix adjust.
 Identities = 45/167 (26%), Positives = 67/167 (40%), Gaps = 32/167 (19%)

Query: 8   RKKSYRWVSASQASYDGAGWXXXXXXX-----XXXXXGTKGSEIHKQKISNLPSLPKLNY 62
           RKKS RWVS S+ +YDG  W                  ++ S      +S LP LP L+Y
Sbjct: 7   RKKSQRWVSVSKGTYDGKEWDSSEEDEPYGAWENDEGQSRKSPERNGTVSKLPPLPMLSY 66

Query: 63  TDVNGEHDENTGEXXXXXXXXXXXXXXXPSDKEVGYLSDGVPKLMASRESVELQAKKSSE 122
               G+    + E                     G    G P+L  S          SS 
Sbjct: 67  ----GKDSRRSNEVERTETGADEASGSQLDSTSTGA---GSPRLYQS----------SSG 109

Query: 123 HSKSDYLSSTASL-KSPSENKKSPHTNRAVNEDLDNLIEQISREMTP 168
            ++ +  SST  + + PS+ K         +E+LD+L+ Q+S+E+TP
Sbjct: 110 AARVNSQSSTGRITRGPSQYK---------SENLDHLMTQLSQELTP 147

>KLLA0D09603g 811234..813696 weakly similar to sp|P46949
           Saccharomyces cerevisiae YGR196c singleton, start by
           similarity
          Length = 820

 Score =  214 bits (544), Expect = 2e-58,   Method: Compositional matrix adjust.
 Identities = 121/288 (42%), Positives = 172/288 (59%), Gaps = 25/288 (8%)

Query: 523 SVKDSTDVDSWKPDSEALRSGFVQDTANKKAPP-GYVIDSNGKLVDLT--PASMKPRVVS 579
           S ++S ++  WKPD++A RSGFV +T +   PP GY ++ +G++V++     S   R  S
Sbjct: 536 STRESINLGKWKPDTDAFRSGFVTETIDINNPPEGYTVNEDGEIVEVNKNTTSNIQRNSS 595

Query: 580 TYSEMESTWDAFP--SKGEDDDLETIRDTKTIYDNNTIYNVPGLIGNQSNLPPLPMDAQE 637
             S+ ES ++AFP     +DDDL+TI DTKTIYDN TIYNVP LI N ++ P LP + Q 
Sbjct: 596 VASDGESQFNAFPHDVASDDDDLKTIADTKTIYDNQTIYNVPALIANNASAPALPTNIQ- 654

Query: 638 QLXXXXXXXXXXXXXXXXXXXXXXXRSASFKSENRTVSQGE--MTSVHEPSTEEMAKLGQ 695
                                        FK  N    +GE  +        +E+  +  
Sbjct: 655 --------------ITNESTDYVSSNDTIFKHVNGEAPKGESKLKEAFSSEGDEIPSVVH 700

Query: 696 QNNLPKLDMNKLLNSKTSHAGKIEQLRNYKRELDEYDTGIQTWINYTLKSSSNKDKDFIA 755
           Q+ +P LD+ KLL+S   H+ K+++L NYK +L EYD+G+Q+WI Y LKSS+  DKDFI 
Sbjct: 701 QSTVPNLDLVKLLSSNELHSQKLKKLNNYKEQLKEYDSGLQSWIQYALKSSTTSDKDFIF 760

Query: 756 EEYKQHSHVREAYANADDLSKKHTVINTVASVNQNVTHLRRKVFQHSM 803
           ++YK + HV++AYA AD LSKK++V NT   VNQNVTHL++K+F  SM
Sbjct: 761 KDYKVNKHVQDAYAQADILSKKNSVANT---VNQNVTHLKKKMFSSSM 805

 Score = 40.8 bits (94), Expect = 0.005,   Method: Compositional matrix adjust.
 Identities = 21/64 (32%), Positives = 31/64 (48%), Gaps = 11/64 (17%)

Query: 3  TEQVGRKKSYRWVSASQASYDGAGWXXXXXXXXXXXXGTKGSEIHKQKISNLPSLPKLNY 62
          ++ + R KS RWVSAS+A+YDGA W                        +N+P LP++N 
Sbjct: 16 SDNITRHKSQRWVSASKANYDGADWDAYSSNSEDEGL-----------TNNIPQLPQVNI 64

Query: 63 TDVN 66
           + N
Sbjct: 65 PESN 68

 Score = 34.7 bits (78), Expect = 0.33,   Method: Compositional matrix adjust.
 Identities = 20/45 (44%), Positives = 29/45 (64%), Gaps = 3/45 (6%)

Query: 134 SLKSPSENKKSPHTNRAVNEDLDNLIEQISREMTP---EIRQTSD 175
            L+S S N      N++VN+DLD+L+ QIS+EMT    ++  TSD
Sbjct: 83  CLRSDSLNTSVRSGNKSVNDDLDSLMHQISQEMTAKDEDVNNTSD 127

>ACR036C [1084] [Homologous to ScYGR196C (FYV8) - SH]
           (423030..425294) [2265 bp, 754 aa]
          Length = 754

 Score =  142 bits (357), Expect = 1e-34,   Method: Compositional matrix adjust.
 Identities = 90/280 (32%), Positives = 140/280 (50%), Gaps = 12/280 (4%)

Query: 525 KDSTDVDSWKPDSEALRSGFVQDTANKKAPPGYVIDSNGKLVDLTPASMKPRVVSTYSEM 584
           + S  + +W PD+E  R  F+   +      G      G   + T    +        + 
Sbjct: 467 QQSVHLGAWNPDTEGKRGAFLTQASPMSTNKGMC----GSQDEETTGDDQQLAEPCNDDS 522

Query: 585 ESTWDAFPSKGEDDDLETIRDTKTIYDNNTIYNVPGLIGNQSNLPPLPMDAQEQLXXXXX 644
           +S W+ FPS GE +DL+++ D KTIYDN T+YNVPG+I + +++PPLP    E       
Sbjct: 523 DSVWEGFPSVGEYEDLQSVADIKTIYDNQTLYNVPGIITSSTSVPPLPSSMSELTSRQDT 582

Query: 645 XXXXXXXXXXXXXXXXXXRSASFKSENRTVSQGEMTSVHEPSTEEMAKLGQQNN-LPKLD 703
                             R    +   R   +  M   +   T E+      N+ +P LD
Sbjct: 583 SILSESTSGSGLDSDSLMRVVEGQ---RHAPKPSMFKENFGQTPEVQVEHLVNSPVPSLD 639

Query: 704 MNKLLNSKTSHAGKIEQLRNYKRELDEYDTGIQTWINYTLKSSSNKDKDFIAEEYKQHSH 763
           +  L+    SH+ K ++L ++  +L+ Y +G QTWI Y LKS+ +   +   +EY    H
Sbjct: 640 ICALIEGPQSHSFKRDKLNSHIEDLNAYSSGAQTWIKYALKSTQSS-SNITFDEYVISKH 698

Query: 764 VREAYANADDLSKKHTVINTVASVNQNVTHLRRKVFQHSM 803
           V++AYA A+++SKKH+V N   +VNQNV+ LR+KVF HSM
Sbjct: 699 VQDAYAQAEEVSKKHSVTN---AVNQNVSQLRKKVFSHSM 735

 Score = 45.4 bits (106), Expect = 2e-04,   Method: Compositional matrix adjust.
 Identities = 23/58 (39%), Positives = 30/58 (51%), Gaps = 4/58 (6%)

Query: 4  EQVGRKKSYRWVSASQASYDGAGWXXXXXXXXXXXXGTKGSEIHKQKISNLPSLPKLN 61
          ++V R+KS RWVS S+ +YDGA W             T+      + I  LP LPKLN
Sbjct: 3  DKVNRRKSQRWVSVSKGNYDGADWDSDYSGEELESSPTR----QHETICKLPELPKLN 56

>Sklu_1278.2 YKL179C, Contig c1278 1474-2822 reverse complement
          Length = 450

 Score = 32.0 bits (71), Expect = 2.1,   Method: Compositional matrix adjust.
 Identities = 22/88 (25%), Positives = 43/88 (48%), Gaps = 8/88 (9%)

Query: 534 KPDSEALRSGF--VQDTANKKAPPGYVIDSNGKLVDL---TPASMKPRVVSTYSEMESTW 588
           K + E LRS    +QD A K A    +     +L+DL   +  ++  R+++   E+ STW
Sbjct: 117 KEELEGLRSKLATLQDQAAKHADYDKI---KARLLDLEQRSAETLTKRLLAREQELTSTW 173

Query: 589 DAFPSKGEDDDLETIRDTKTIYDNNTIY 616
           +       D + + ++  +T+ +NN + 
Sbjct: 174 EEKQRNWADREADLVKQLETLKNNNKVL 201

>ABL126W [466] [Homologous to ScYMR278W - SH]
           complement(159209..161083) [1875 bp, 624 aa]
          Length = 624

 Score = 32.0 bits (71), Expect = 2.2,   Method: Compositional matrix adjust.
 Identities = 20/67 (29%), Positives = 31/67 (46%), Gaps = 1/67 (1%)

Query: 556 GYVIDSNGKLVDLTPASMKPRVVSTYSEMESTWDAFPSK-GEDDDLETIRDTKTIYDNNT 614
           GY +D NG  +   PA  K       +E       +PS  G + ++E +RD    Y ++T
Sbjct: 479 GYFVDYNGYYISSAPAVTKEVFDYFRNEYTPAGKPYPSHIGCEFEVEYLRDLTVGYQSDT 538

Query: 615 IYNVPGL 621
             N+P L
Sbjct: 539 ATNIPDL 545

  Database: blastdb
    Posted date:  Apr 3, 2006  3:33 PM
  Number of letters in database: 16,596,109
  Number of sequences in database:  34,618
  
Lambda     K      H
   0.304    0.123    0.337 

Gapped
Lambda     K      H
   0.267   0.0410    0.140 

Matrix: BLOSUM62
Gap Penalties: Existence: 11, Extension: 1
Number of Sequences: 34618
Number of Hits to DB: 23,483,540
Number of extensions: 963809
Number of successful extensions: 3143
Number of sequences better than 10.0: 70
Number of HSP's gapped: 3146
Number of HSP's successfully gapped: 84
Length of query: 803
Length of database: 16,596,109
Length adjustment: 110
Effective length of query: 693
Effective length of database: 12,788,129
Effective search space: 8862173397
Effective search space used: 8862173397
Neighboring words threshold: 11
Window for multiple hits: 40
X1: 16 ( 7.0 bits)
X2: 38 (14.6 bits)
X3: 64 (24.7 bits)
S1: 43 (21.9 bits)
S2: 66 (30.0 bits)