Hit NameLength (aa)HSP LengthHSP ScoreHSP Significance
YGR195W (SKI6)24624312691e-180
Scas_647.724624311711e-165
CAGL0G09317g24624311471e-161
Sklu_1267.227324310981e-153
Kwal_33.1545324524210821e-151
KLLA0D09625g24524310221e-142
ACR035W24624310071e-140
KLLA0F18304g2361401253e-08
Sklu_1989.12232161227e-08
KLLA0D14993g2251351201e-07
Sklu_1879.12381411174e-07
YGR095C (RRP46)2231401131e-06
Scas_716.302281361103e-06
Scas_621.172391291087e-06
CAGL0G03113g2331381051e-05
AFR109W2371391042e-05
Kwal_23.39692242261006e-05
CAGL0E03223g248147935e-04
YGR158C (MTR3)250128770.067
Scas_568.1556254681.2
AGL162C70476643.3
CAGL0M03685g49384625.8
BLASTP 2.2.26 [Sep-21-2011]

Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, 
Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), 
"Gapped BLAST and PSI-BLAST: a new generation of protein database search
programs",  Nucleic Acids Res. 25:3389-3402.

Reference for compositional score matrix adjustment: Altschul, Stephen F., 
John C. Wootton, E. Michael Gertz, Richa Agarwala, Aleksandr Morgulis,
Alejandro A. Schaffer, and Yi-Kuo Yu (2005) "Protein database searches
using compositionally adjusted substitution matrices", FEBS J. 272:5101-5109.

Query= YGR195W
         (243 letters)

Database: blastdb 
           34,618 sequences; 16,596,109 total letters

Searching..................................................done

                                                                 Score    E
Sequences producing significant alignments:                      (bits) Value

YGR195W (SKI6) [2145] chr7 (888885..889625) Component of the exo...   493   e-180
Scas_647.7                                                            455   e-165
CAGL0G09317g complement(890158..890898) highly similar to sp|P46...   446   e-161
Sklu_1267.2 YGR195W, Contig c1267 529-1350                            427   e-153
Kwal_33.15453                                                         421   e-151
KLLA0D09625g complement(813773..814510) highly similar to sp|P46...   398   e-142
ACR035W [1083] [Homologous to ScYGR195W (SKI6) - SH] complement(...   392   e-140
KLLA0F18304g complement(1689187..1689897) similar to sp|P48240 S...    53   3e-08
Sklu_1989.1 YGR095C, Contig c1989 348-1019                             52   7e-08
KLLA0D14993g complement(1266752..1267429) similar to sp|P53256 S...    51   1e-07
Sklu_1879.1 YGR158C, Contig c1879 329-1045 reverse complement          50   4e-07
YGR095C (RRP46) [2055] chr7 complement(675673..676344) Protein c...    48   1e-06
Scas_716.30                                                            47   3e-06
Scas_621.17                                                            46   7e-06
CAGL0G03113g complement(289747..290448) similar to sp|P53256 Sac...    45   1e-05
AFR109W [3301] [Homologous to ScYGR158C (MTR3) - SH] complement(...    45   2e-05
Kwal_23.3969                                                           43   6e-05
CAGL0E03223g complement(297800..298546) similar to sp|P48240 Sac...    40   5e-04
YGR158C (MTR3) [2112] chr7 complement(805272..806024) Protein in...    34   0.067
Scas_568.15                                                            31   1.2  
AGL162C [4150] [Homologous to ScYDR164C (SEC1) - SH] (392348..39...    29   3.3  
CAGL0M03685g complement(413333..414814) weakly similar to sp|P48...    28   5.8  

>YGR195W (SKI6) [2145] chr7 (888885..889625) Component of the
           exosome 3'-5' exoribonuclease complex involved in 3'
           processing of ribosomal 5.8S rRNA, of snoRNAs and of U4
           snRNA, and in degradation of poly(A)- mRNAs, confers
           antiviral activity by repressing replication of
           double-stranded RNA viruses [741 bp, 246 aa]
          Length = 246

 Score =  493 bits (1269), Expect = e-180,   Method: Compositional matrix adjust.
 Identities = 243/243 (100%), Positives = 243/243 (100%)

Query: 1   MSRLEIYSPEGLRLDGRRWNELRRFESSINTHPHAADGSSYMEQGNNKIITLVKGPKEPR 60
           MSRLEIYSPEGLRLDGRRWNELRRFESSINTHPHAADGSSYMEQGNNKIITLVKGPKEPR
Sbjct: 1   MSRLEIYSPEGLRLDGRRWNELRRFESSINTHPHAADGSSYMEQGNNKIITLVKGPKEPR 60

Query: 61  LKSQMDTSKALLNVSVNITKFSKFERSKSSHKNERRVLEIQTSLVRMFEKNVMLNIYPRT 120
           LKSQMDTSKALLNVSVNITKFSKFERSKSSHKNERRVLEIQTSLVRMFEKNVMLNIYPRT
Sbjct: 61  LKSQMDTSKALLNVSVNITKFSKFERSKSSHKNERRVLEIQTSLVRMFEKNVMLNIYPRT 120

Query: 121 VIDIEIHVLEQDGGIMGSLINGITLALIDAGISMFDYISGISVGLYDTTPLLDTNSLEEN 180
           VIDIEIHVLEQDGGIMGSLINGITLALIDAGISMFDYISGISVGLYDTTPLLDTNSLEEN
Sbjct: 121 VIDIEIHVLEQDGGIMGSLINGITLALIDAGISMFDYISGISVGLYDTTPLLDTNSLEEN 180

Query: 181 AMSTVTLGVVGKSEKLSLLLVEDKIPLDRLENVLAIGIAGAHRVRDLMDEELRKHAQKRV 240
           AMSTVTLGVVGKSEKLSLLLVEDKIPLDRLENVLAIGIAGAHRVRDLMDEELRKHAQKRV
Sbjct: 181 AMSTVTLGVVGKSEKLSLLLVEDKIPLDRLENVLAIGIAGAHRVRDLMDEELRKHAQKRV 240

Query: 241 SNA 243
           SNA
Sbjct: 241 SNA 243

>Scas_647.7
          Length = 246

 Score =  455 bits (1171), Expect = e-165,   Method: Compositional matrix adjust.
 Identities = 215/243 (88%), Positives = 235/243 (96%)

Query: 1   MSRLEIYSPEGLRLDGRRWNELRRFESSINTHPHAADGSSYMEQGNNKIITLVKGPKEPR 60
           MSRLEIYSPEGLRLDGRRWNELRRFE SINTH HA+DGSSY+EQGNNK+ITLVKGPKEP 
Sbjct: 1   MSRLEIYSPEGLRLDGRRWNELRRFECSINTHSHASDGSSYLEQGNNKVITLVKGPKEPT 60

Query: 61  LKSQMDTSKALLNVSVNITKFSKFERSKSSHKNERRVLEIQTSLVRMFEKNVMLNIYPRT 120
           L+SQMDT KA+L +SVNIT+FSKFERSKSSHKNERRVLE+QT+L+R FEKNVMLNIYPRT
Sbjct: 61  LRSQMDTEKAILKISVNITQFSKFERSKSSHKNERRVLEMQTALIRTFEKNVMLNIYPRT 120

Query: 121 VIDIEIHVLEQDGGIMGSLINGITLALIDAGISMFDYISGISVGLYDTTPLLDTNSLEEN 180
           +IDIE+HVL+QDGGIMGSLINGITLALIDAGI+M+DYISG+S+GLYDTTPLLD NSLEEN
Sbjct: 121 LIDIEVHVLQQDGGIMGSLINGITLALIDAGIAMYDYISGVSIGLYDTTPLLDVNSLEEN 180

Query: 181 AMSTVTLGVVGKSEKLSLLLVEDKIPLDRLENVLAIGIAGAHRVRDLMDEELRKHAQKRV 240
           AMS+VTLGVVGKSEKLSLLLVEDKIPLDRLE VLAIGIAGAHRVRDLMDEELRKHA+KRV
Sbjct: 181 AMSSVTLGVVGKSEKLSLLLVEDKIPLDRLETVLAIGIAGAHRVRDLMDEELRKHAEKRV 240

Query: 241 SNA 243
           +NA
Sbjct: 241 ANA 243

>CAGL0G09317g complement(890158..890898) highly similar to sp|P46948
           Saccharomyces cerevisiae YGR195w SKI6 3-5
           exoribonuclease required for 3 end formation of 5.8S
           rRNA, start by similarity
          Length = 246

 Score =  446 bits (1147), Expect = e-161,   Method: Compositional matrix adjust.
 Identities = 208/243 (85%), Positives = 234/243 (96%)

Query: 1   MSRLEIYSPEGLRLDGRRWNELRRFESSINTHPHAADGSSYMEQGNNKIITLVKGPKEPR 60
           MSR+EIYSPEGLRLDGRRWNELRRFES+INTHPHAADGSSY+EQGNNK+ITLVKGPKEP 
Sbjct: 1   MSRVEIYSPEGLRLDGRRWNELRRFESAINTHPHAADGSSYLEQGNNKVITLVKGPKEPT 60

Query: 61  LKSQMDTSKALLNVSVNITKFSKFERSKSSHKNERRVLEIQTSLVRMFEKNVMLNIYPRT 120
           LKSQMD  KA+L V+VNITKFSKFERSKSSHKNERRVLE+QT+LVR FEKNVML++YPRT
Sbjct: 61  LKSQMDIQKAILKVTVNITKFSKFERSKSSHKNERRVLEMQTALVRTFEKNVMLHVYPRT 120

Query: 121 VIDIEIHVLEQDGGIMGSLINGITLALIDAGISMFDYISGISVGLYDTTPLLDTNSLEEN 180
           +IDIEIHVL+QDGGIMG+L+NGI+LALIDAGI+M+DY+SGISVGLYDTTPLLD NSLEEN
Sbjct: 121 LIDIEIHVLQQDGGIMGTLLNGISLALIDAGIAMYDYVSGISVGLYDTTPLLDINSLEEN 180

Query: 181 AMSTVTLGVVGKSEKLSLLLVEDKIPLDRLENVLAIGIAGAHRVRDLMDEELRKHAQKRV 240
           AMS VTLGVVGKSEKLSLL +EDKIPLDR+ENVLAIGIAGAHR+RDLM++E+R HA+KRV
Sbjct: 181 AMSAVTLGVVGKSEKLSLLQIEDKIPLDRIENVLAIGIAGAHRIRDLMEQEIRAHAEKRV 240

Query: 241 SNA 243
           +NA
Sbjct: 241 ANA 243

>Sklu_1267.2 YGR195W, Contig c1267 529-1350
          Length = 273

 Score =  427 bits (1098), Expect = e-153,   Method: Compositional matrix adjust.
 Identities = 201/243 (82%), Positives = 229/243 (94%)

Query: 1   MSRLEIYSPEGLRLDGRRWNELRRFESSINTHPHAADGSSYMEQGNNKIITLVKGPKEPR 60
           MSRLEIYSPEGLRLDGRRWNELRRF+ SINTHP+AADGSSY+EQGNNKIITLV GP+EP 
Sbjct: 28  MSRLEIYSPEGLRLDGRRWNELRRFDCSINTHPNAADGSSYLEQGNNKIITLVNGPQEPA 87

Query: 61  LKSQMDTSKALLNVSVNITKFSKFERSKSSHKNERRVLEIQTSLVRMFEKNVMLNIYPRT 120
           L+SQ + S A +NV+VNITKFSK ERSKSSHKNERRVLE+QTSLVR FEKNVML +YPRT
Sbjct: 88  LRSQTNPSHATMNVTVNITKFSKMERSKSSHKNERRVLEMQTSLVRTFEKNVMLQLYPRT 147

Query: 121 VIDIEIHVLEQDGGIMGSLINGITLALIDAGISMFDYISGISVGLYDTTPLLDTNSLEEN 180
           +IDI+IHVL+QDGGIMG+LINGITLALIDAGI+M+DYISG+S+GLYDTTPLLD NSLEEN
Sbjct: 148 LIDIQIHVLQQDGGIMGALINGITLALIDAGIAMYDYISGVSIGLYDTTPLLDLNSLEEN 207

Query: 181 AMSTVTLGVVGKSEKLSLLLVEDKIPLDRLENVLAIGIAGAHRVRDLMDEELRKHAQKRV 240
           AMS++TLGVVGKSEKLSLLLVEDK+PLDR E+VLAIGIAGAH +RDLMD+ELR+H +KR+
Sbjct: 208 AMSSITLGVVGKSEKLSLLLVEDKVPLDRFESVLAIGIAGAHIIRDLMDKELRRHGEKRL 267

Query: 241 SNA 243
           +NA
Sbjct: 268 TNA 270

>Kwal_33.15453
          Length = 245

 Score =  421 bits (1082), Expect = e-151,   Method: Compositional matrix adjust.
 Identities = 196/242 (80%), Positives = 231/242 (95%)

Query: 1   MSRLEIYSPEGLRLDGRRWNELRRFESSINTHPHAADGSSYMEQGNNKIITLVKGPKEPR 60
           MSRLEIYSPEGLR+DGRRWNELRR E +INTH +A+DGSSY+EQGNNKIITLV GP+EP+
Sbjct: 1   MSRLEIYSPEGLRVDGRRWNELRRLECAINTHANASDGSSYLEQGNNKIITLVNGPQEPK 60

Query: 61  LKSQMDTSKALLNVSVNITKFSKFERSKSSHKNERRVLEIQTSLVRMFEKNVMLNIYPRT 120
           L+SQM+ ++A L+V+VNIT+FSK ERSKSSHKNERRVLE+QT+LVR FEKNVML++YPRT
Sbjct: 61  LRSQMNVNQATLSVAVNITRFSKIERSKSSHKNERRVLEMQTALVRTFEKNVMLHLYPRT 120

Query: 121 VIDIEIHVLEQDGGIMGSLINGITLALIDAGISMFDYISGISVGLYDTTPLLDTNSLEEN 180
            IDI+IHVL+QDGG+MGSLINGITLALIDAGI+M+DYISG+S+GLYDTTPLLD NS+EEN
Sbjct: 121 QIDIQIHVLQQDGGLMGSLINGITLALIDAGIAMYDYISGVSIGLYDTTPLLDLNSVEEN 180

Query: 181 AMSTVTLGVVGKSEKLSLLLVEDKIPLDRLENVLAIGIAGAHRVRDLMDEELRKHAQKRV 240
           AMS+VTLGVVGKSEKLSLLLVEDKIPLDRLE+VLAIGIAG+HR+R+LMD+ELRKH +KR+
Sbjct: 181 AMSSVTLGVVGKSEKLSLLLVEDKIPLDRLESVLAIGIAGSHRIRELMDQELRKHGEKRL 240

Query: 241 SN 242
           +N
Sbjct: 241 AN 242

>KLLA0D09625g complement(813773..814510) highly similar to sp|P46948
           Saccharomyces cerevisiae YGR195w SKI6 3 -5
           exoribonuclease required for 3 end formation of 5.8S
           rRNA singleton, start by similarity
          Length = 245

 Score =  398 bits (1022), Expect = e-142,   Method: Compositional matrix adjust.
 Identities = 180/243 (74%), Positives = 220/243 (90%)

Query: 1   MSRLEIYSPEGLRLDGRRWNELRRFESSINTHPHAADGSSYMEQGNNKIITLVKGPKEPR 60
           MSR EIYSPEGLR+DGRRWNELR F  SINTHP+AADGSSY+EQGNNKIITLV GP+EP 
Sbjct: 1   MSRFEIYSPEGLRVDGRRWNELRSFNCSINTHPNAADGSSYLEQGNNKIITLVAGPQEPS 60

Query: 61  LKSQMDTSKALLNVSVNITKFSKFERSKSSHKNERRVLEIQTSLVRMFEKNVMLNIYPRT 120
            +SQ++T +A L+V++N+TKF+K ERSKSSHKNERR LE Q SLVR FEKN+ML++YPRT
Sbjct: 61  SRSQVNTKQATLSVTINLTKFAKMERSKSSHKNERRTLEWQASLVRTFEKNLMLHLYPRT 120

Query: 121 VIDIEIHVLEQDGGIMGSLINGITLALIDAGISMFDYISGISVGLYDTTPLLDTNSLEEN 180
            ID+++H L+ DGGI+G+++NGITLALIDAGI+M+D++SG+SVGLYDTTPLLD NSLEEN
Sbjct: 121 SIDVQVHALQLDGGILGAMLNGITLALIDAGIAMYDFVSGVSVGLYDTTPLLDLNSLEEN 180

Query: 181 AMSTVTLGVVGKSEKLSLLLVEDKIPLDRLENVLAIGIAGAHRVRDLMDEELRKHAQKRV 240
           AMS+VT+G +GKSEKLSLL+VEDK+PLDRLE+V+AIGIAG HR+RDLMD+ELRKH + RV
Sbjct: 181 AMSSVTIGTIGKSEKLSLLMVEDKVPLDRLESVMAIGIAGTHRIRDLMDKELRKHGKTRV 240

Query: 241 SNA 243
            N+
Sbjct: 241 ENS 243

>ACR035W [1083] [Homologous to ScYGR195W (SKI6) - SH]
           complement(422233..422973) [741 bp, 246 aa]
          Length = 246

 Score =  392 bits (1007), Expect = e-140,   Method: Compositional matrix adjust.
 Identities = 181/243 (74%), Positives = 216/243 (88%)

Query: 1   MSRLEIYSPEGLRLDGRRWNELRRFESSINTHPHAADGSSYMEQGNNKIITLVKGPKEPR 60
           M + EIYSPEGLRLDGRRWNELRRFE SINTHP AADGSSY+EQGNNK+ITLV GP EP 
Sbjct: 1   MFKTEIYSPEGLRLDGRRWNELRRFECSINTHPTAADGSSYLEQGNNKLITLVTGPHEPA 60

Query: 61  LKSQMDTSKALLNVSVNITKFSKFERSKSSHKNERRVLEIQTSLVRMFEKNVMLNIYPRT 120
           L+SQ++ SKA L V+VN+TKF+  ERSK+ HKNERR+LE+QT+LVR FEKNVML +YPRT
Sbjct: 61  LRSQVNPSKATLTVTVNMTKFAAAERSKTGHKNERRILEMQTALVRTFEKNVMLQLYPRT 120

Query: 121 VIDIEIHVLEQDGGIMGSLINGITLALIDAGISMFDYISGISVGLYDTTPLLDTNSLEEN 180
            ID+++HVL+ DGG++GS+INGITLALIDAGI+M++YISGISVGLYDTTPLLD N LEE 
Sbjct: 121 AIDVQVHVLQNDGGVLGSMINGITLALIDAGIAMYEYISGISVGLYDTTPLLDLNRLEEQ 180

Query: 181 AMSTVTLGVVGKSEKLSLLLVEDKIPLDRLENVLAIGIAGAHRVRDLMDEELRKHAQKRV 240
           AMS  TLGVVGKSEKLSLLLVEDK+PLDRLE+V+++GIAG HRVRD+MD+ LR+H + R+
Sbjct: 181 AMSCFTLGVVGKSEKLSLLLVEDKVPLDRLESVMSLGIAGTHRVRDMMDKVLRQHGKIRL 240

Query: 241 SNA 243
            N+
Sbjct: 241 ENS 243

>KLLA0F18304g complement(1689187..1689897) similar to sp|P48240
           Saccharomyces cerevisiae YGR158c MTR3 involved in mRNA
           transport singleton, start by similarity
          Length = 236

 Score = 52.8 bits (125), Expect = 3e-08,   Method: Compositional matrix adjust.
 Identities = 41/140 (29%), Positives = 68/140 (48%), Gaps = 26/140 (18%)

Query: 36  ADGSSYMEQGNNK-----IITLVKGPKEPRLKSQMDTSKALLNVSVNITKFSKFERSKSS 90
           A+GSSY+E  +       +++ V GP+  R   Q   SKA +++        +F+     
Sbjct: 55  ANGSSYLEYMDGTSDQVLVMSSVFGPRPLRGSFQ---SKASVSI--------QFKEVTLE 103

Query: 91  HKNERRVLEIQTSLVRMFEKNVMLNIYPRTVIDIEIHVLEQDGG----------IMGSLI 140
           H N   + EI T L  +F   + +  YP++ IDI I +++              I+ + I
Sbjct: 104 HLNTGEIKEICTFLTNVFNAVINVEKYPKSGIDIFIDLIQHSNSNPTEEANIVNILPTCI 163

Query: 141 NGITLALIDAGISMFDYISG 160
           N IT+AL+DAGI + D +S 
Sbjct: 164 NSITMALVDAGIEIIDLVSA 183

>Sklu_1989.1 YGR095C, Contig c1989 348-1019
          Length = 223

 Score = 51.6 bits (122), Expect = 7e-08,   Method: Compositional matrix adjust.
 Identities = 59/216 (27%), Positives = 95/216 (43%), Gaps = 29/216 (13%)

Query: 37  DGSSYMEQGNNKIITLVKGPKEPRLKSQMDTSKALLNVSVNITKFSKFERSKSSHKNERR 96
           DGSS +E    K+I  V GP EP+ + ++ T  A L + V  +K     R K      R 
Sbjct: 13  DGSSQVECSATKVICSVTGPVEPKARQELPTQLA-LEIVVRPSKGVPNTREKLMEDKIRG 71

Query: 97  VLEIQTSLVRMFEKNVMLNIYPRTVIDIEIHVLEQDGG-------IMGSLINGITLALID 149
           VL     LVR         +YPR +  +   VLE            +G  IN   LAL+D
Sbjct: 72  VLT--PVLVRY--------LYPRQLCQLTFQVLESGESEEQYTVKELGCCINAAYLALVD 121

Query: 150 AGISMFDYISGISVGLYDTTPLLDTNSLEENAMSTVTLGV-----VGKSEKLSLLLVEDK 204
           AGI++      + + + +   ++   +  + A S  T  +      G ++  ++LLV+  
Sbjct: 122 AGIALKSSFVSVPICILEQNKIVTNPTAHQLAQSVSTHLISMEVGSGGTQVENVLLVDSN 181

Query: 205 --IPLDRLENVLAIG----IAGAHRVRDLMDEELRK 234
                ++L +VLA G    I  A   R ++ E+L+K
Sbjct: 182 GDFQENQLFDVLAEGEKECINVASAFRKIIQEKLQK 217

>KLLA0D14993g complement(1266752..1267429) similar to sp|P53256
           Saccharomyces cerevisiae YGR095c RRP46 involved in rRNA
           processing singleton, hypothetical start
          Length = 225

 Score = 50.8 bits (120), Expect = 1e-07,   Method: Compositional matrix adjust.
 Identities = 38/135 (28%), Positives = 63/135 (46%), Gaps = 17/135 (12%)

Query: 37  DGSSYMEQGNNKIITLVKGPKEPRLKSQMDTSKALLNVSVNITKFSKFERSKSSHKNERR 96
           DGSS +     K+I  V GP EP+ + ++ T  A L + V   +  +  R K      R 
Sbjct: 12  DGSSVVSNSGTKVICSVSGPMEPKSRQELPTQLA-LEIIVKPAEGVQSTREKLMEDQIRS 70

Query: 97  VLEIQTSLVRMFEKNVMLNIYPRTVIDIEIHVLE----QDGGI--MGSLINGITLALIDA 150
           VL   T ++  +       ++PR  + I + VLE    +D  +  +   +N   LAL+DA
Sbjct: 71  VL---TPVLARY-------LHPRQFVQICLQVLEAGESRDYTVKEVSVCVNAAVLALVDA 120

Query: 151 GISMFDYISGISVGL 165
           G+ +    SG  +G+
Sbjct: 121 GVPLLSMCSGTCIGI 135

>Sklu_1879.1 YGR158C, Contig c1879 329-1045 reverse complement
          Length = 238

 Score = 49.7 bits (117), Expect = 4e-07,   Method: Compositional matrix adjust.
 Identities = 41/141 (29%), Positives = 66/141 (46%), Gaps = 27/141 (19%)

Query: 36  ADGSSYME-------QGNNKIITLVKGPKEPRLKSQMDTSKALLNVSVNITKFSKFERSK 88
           ++GSSY+E       Q +  +IT V GP+  R      TS+A L +        KF   +
Sbjct: 51  SNGSSYLEVTDENKTQYHALLITSVYGPRPIRGSF---TSRASLTIQFKEVTLEKFTTGE 107

Query: 89  SSHKNERRVLEIQTSLVRMFEKNVMLNIYPRTVIDIEIHVLEQD---------GGIMGSL 139
                   + E+   L  +F   V L  YP++ IDI +++++             ++ + 
Sbjct: 108 --------IKEVCNFLTNIFNAVVNLERYPKSGIDIFLNLIQHSSTDNQETDIASVIPTC 159

Query: 140 INGITLALIDAGISMFDYISG 160
           INGITLAL +AGI + D +S 
Sbjct: 160 INGITLALTNAGIEILDMVSA 180

>YGR095C (RRP46) [2055] chr7 complement(675673..676344) Protein
           component of the exosome 3'-5' exoribonuclease complex
           involved in 3'end processing of multiple small RNA
           species [672 bp, 223 aa]
          Length = 223

 Score = 48.1 bits (113), Expect = 1e-06,   Method: Compositional matrix adjust.
 Identities = 41/140 (29%), Positives = 60/140 (42%), Gaps = 18/140 (12%)

Query: 37  DGSSYMEQGNNKIITLVKGPKEPRLKSQMDTSKALLNVSVNITKFSKFERSKSSHKNERR 96
           DGSS     + K+I  V GP EP+ + ++ T  A L + V   K     R K      R 
Sbjct: 14  DGSSEFVSQDTKVICSVTGPIEPKARQELPTQLA-LEIIVRPAKGVATTREKVLEDKLRA 72

Query: 97  VLEIQTSLVRMFEKNVMLNIYPRTVIDIEIHVLE--QDGG-----IMGSLINGITLALID 149
           VL   T L+         + YPR +  I   +LE  +D        +   IN   LAL+D
Sbjct: 73  VL---TPLITR-------HCYPRQLCQITCQILESGEDEAEFSLRELSCCINAAFLALVD 122

Query: 150 AGISMFDYISGISVGLYDTT 169
           AGI++    + I + +   T
Sbjct: 123 AGIALNSMCASIPIAIIKDT 142

>Scas_716.30
          Length = 228

 Score = 47.0 bits (110), Expect = 3e-06,   Method: Compositional matrix adjust.
 Identities = 37/136 (27%), Positives = 59/136 (43%), Gaps = 18/136 (13%)

Query: 37  DGSSYMEQGNNKIITLVKGPKEPRLKSQMDTSKALLNVSVNITKFSKFERSKSSHKNERR 96
           DGSS +E    KII  V GP EP+ + ++ T  AL              R  +   N R 
Sbjct: 14  DGSSLIESKQTKIICSVTGPIEPKSRQELPTQLAL----------EIIIRPAAGVPNTRE 63

Query: 97  VLEIQTSLVRMFEKNVMLNIYPRTVIDIEIHV-------LEQDGGIMGSLINGITLALID 149
            L ++  L  +    +   +YPR +  I + +       LE     + + IN   +ALID
Sbjct: 64  KL-MEDKLRAVITPIITRYLYPRQLCQITLQILNSGESELEFAQRELATCINATLIALID 122

Query: 150 AGISMFDYISGISVGL 165
           AGI++    + + + L
Sbjct: 123 AGIALNSMCACVPIAL 138

>Scas_621.17
          Length = 239

 Score = 46.2 bits (108), Expect = 7e-06,   Method: Compositional matrix adjust.
 Identities = 36/129 (27%), Positives = 66/129 (51%), Gaps = 15/129 (11%)

Query: 36  ADGSSYMEQGNNKIITLVKGPKEPRLKSQMDTSKALLNVSVNITKFSKFERSKSSHKNER 95
            +GS+ +E     ++T V GPK  R      TS+  + + +       ++ ++       
Sbjct: 56  CNGSTLIESSKFSLLTSVYGPKSIR---GSFTSQGTITIQLKNGVVENYQTTE------- 105

Query: 96  RVLEIQTSLVRMFEKNVMLNIYPRTVIDIEIH-VLEQDGGI---MGSLINGITLALIDAG 151
            + E+ + LV +F   V L  YP++ IDI ++ ++++ G I   +  LI GI LAL+D G
Sbjct: 106 -LKEVSSWLVGIFNSVVNLENYPKSGIDIFVNLIIDKQGDISKLIPFLIMGICLALVDGG 164

Query: 152 ISMFDYISG 160
           I + D ++G
Sbjct: 165 IEIIDIVTG 173

>CAGL0G03113g complement(289747..290448) similar to sp|P53256
           Saccharomyces cerevisiae YGR095c RRP46 involved in rRNA
           processing, hypothetical start
          Length = 233

 Score = 45.1 bits (105), Expect = 1e-05,   Method: Compositional matrix adjust.
 Identities = 33/138 (23%), Positives = 63/138 (45%), Gaps = 18/138 (13%)

Query: 37  DGSSYMEQGNNKIITLVKGPKEPRLKSQMDTSKALLNVSVNITKFSKFERSKSSHKNERR 96
           DGS+ +   +  ++  V GP EP+ + ++ T  A L V V   K     R K     E +
Sbjct: 16  DGSAKLLMNSTNVLCAVTGPVEPKARQELPTEMA-LEVIVRPAKGVPTPREKYL---EDK 71

Query: 97  VLEIQTSLVRMFEKNVMLNIYPRTVIDIEIHVLE-------QDGGIMGSLINGITLALID 149
           +  I T L+   +       YPR +  I   ++E        +   + + +N   LAL++
Sbjct: 72  IRAIFTPLITRHK-------YPRQLCQITCQIMEAGENEQLHNQKELSACVNSALLALVN 124

Query: 150 AGISMFDYISGISVGLYD 167
           AG+++ D  + +++ + D
Sbjct: 125 AGVALNDLAAAVTIAVID 142

>AFR109W [3301] [Homologous to ScYGR158C (MTR3) - SH]
           complement(632965..633678) [714 bp, 237 aa]
          Length = 237

 Score = 44.7 bits (104), Expect = 2e-05,   Method: Compositional matrix adjust.
 Identities = 36/139 (25%), Positives = 66/139 (47%), Gaps = 25/139 (17%)

Query: 36  ADGSSYME----QGNNKIITLVKGPKEPRLKSQMDTSKALLNVSVNITKFSKFERSKSSH 91
           A+GSSY+E      N  ++T   GP+  R      TS+A ++V        +++  +   
Sbjct: 54  ANGSSYLEVKAETHNTLLVTTAYGPRPIRGSF---TSRAAISVHFKEVTLERWDSGE--- 107

Query: 92  KNERRVLEIQTSLVRMFEKNVMLNIYPRTVIDIEIHVLEQD----------GGIMGSLIN 141
                V E+   L  +F   + +  YP++ IDI +++++              ++   I+
Sbjct: 108 -----VTEMCNFLNTVFSAAINVERYPKSGIDIFLNLIQHSNVRDDKTLNLAEVLPDCIS 162

Query: 142 GITLALIDAGISMFDYISG 160
           GITLAL+DAGI + D ++ 
Sbjct: 163 GITLALMDAGIELKDVVAA 181

>Kwal_23.3969
          Length = 224

 Score = 43.1 bits (100), Expect = 6e-05,   Method: Compositional matrix adjust.
 Identities = 59/226 (26%), Positives = 92/226 (40%), Gaps = 40/226 (17%)

Query: 37  DGSSYMEQGNNKIITLVKGPKEPRLKSQMDTSKALLNVSVNITKFSKFERSKSSHKNERR 96
           DGS  ++ G   ++  V GP EP+ + ++ +  A L + V   K     R K      R 
Sbjct: 13  DGSCKIQCGETSVLCSVTGPIEPKARQELPSQLA-LEIVVRPCKGVPNTREKLLEDQIRG 71

Query: 97  VLEIQTSLVRMFEKNVMLNIYPRTVIDIEIHVLEQ---DGGI----MGSLINGITLALID 149
           VL   T ++  +       +YPR +  I   +LE    D       + S IN   LALID
Sbjct: 72  VL---TPILARY-------LYPRQLCQICFQILESGEPDESYSVKELNSCINAAYLALID 121

Query: 150 AGISMFDYISGISVGLYDTTPLLDTNSLEENAMSTVTLGVVGKSEKLSLLLVEDKIPLDR 209
           +GI +    +  SV L    P    N +  N  S   +    +S    LL +E      +
Sbjct: 122 SGIGLQSSFA--SVCLSVNGP---NNEICINPASDQLI----RSTSSHLLALEMGPGSKK 172

Query: 210 LENVLAIGIAGAHRVRDLMD-------------EELRKHAQKRVSN 242
            + VL I   GA   + L+D             +ELR   ++++SN
Sbjct: 173 TQKVLLIESHGAFTEQQLLDVLSKGEEACLQVAQELRSAVERKISN 218

>CAGL0E03223g complement(297800..298546) similar to sp|P48240
           Saccharomyces cerevisiae YGR158c MTR3 involved in mRNA
           transport, start by similarity
          Length = 248

 Score = 40.4 bits (93), Expect = 5e-04,   Method: Compositional matrix adjust.
 Identities = 42/147 (28%), Positives = 64/147 (43%), Gaps = 37/147 (25%)

Query: 36  ADGSSYMEQGNNKI-------ITLVKGPKEPRLKSQMDTSKALLNVSVNITKFSKFERSK 88
            +GS+ +E  + KI       IT V GPK  R      TS+A L++ +      K+E   
Sbjct: 51  CNGSALVEIKDTKITHHQTSLITSVYGPKSVRGSF---TSQASLSIQLKNGLLEKYE--- 104

Query: 89  SSHKNERRVLEIQTSLVRMFEKNVMLNIYPRTVIDIEIHVL---------EQDGG----- 134
                 R + E+   L  +F   + L  YP++ IDI I++          EQ+       
Sbjct: 105 -----SRELKEVANFLTSIFNSVINLKRYPKSGIDIFIYITYEKSLENFKEQEPAAPVRK 159

Query: 135 -----IMGSLINGITLALIDAGISMFD 156
                I+   I+ IT+ALIDA I + D
Sbjct: 160 SNIYKILPHCISSITMALIDADIEIID 186

>YGR158C (MTR3) [2112] chr7 complement(805272..806024) Protein
           involved in mRNA transport, component of the exosome
           complex responsible for 3'-5' degradation of mRNA and
           for 3'-end processing of multiple small RNA species [753
           bp, 250 aa]
          Length = 250

 Score = 34.3 bits (77), Expect = 0.067,   Method: Compositional matrix adjust.
 Identities = 32/128 (25%), Positives = 54/128 (42%), Gaps = 31/128 (24%)

Query: 49  IITLVKGPKEPRLKSQMDTSKALLNVSVNITKFSKFERSKSSHKNERRVLEIQTSLVRMF 108
           +IT V GP+  R      TS+  +++ +      K+        N   + E+ + L+ +F
Sbjct: 73  LITAVYGPRSIRGSF---TSQGTISIQLKNGLLEKY--------NTNELKEVSSFLMGIF 121

Query: 109 EKNVMLNIYPRTVIDIEIHVL--------------------EQDGGIMGSLINGITLALI 148
              V L+ YP++ IDI +++                      Q   ++   I  ITLAL 
Sbjct: 122 NSVVNLSRYPKSGIDIFVYLTYDKDLTNNPQDDDSQSKMMSSQISSLIPHCITSITLALA 181

Query: 149 DAGISMFD 156
           DAGI + D
Sbjct: 182 DAGIELVD 189

>Scas_568.15
          Length = 562

 Score = 30.8 bits (68), Expect = 1.2,   Method: Compositional matrix adjust.
 Identities = 16/54 (29%), Positives = 28/54 (51%), Gaps = 7/54 (12%)

Query: 151 GISMFDYISGISVGLYDTTPLLDTNSLEENAMSTVTLGVVGKSEKLSLLLVEDK 204
           GI  F Y +G + G +DT       +LE  + + VT GV   S+ +   ++E++
Sbjct: 457 GIGKFSYYAGDATGTFDT-------NLEPKSSNVVTWGVFPNSQVIQTTIIEEE 503

>AGL162C [4150] [Homologous to ScYDR164C (SEC1) - SH]
           (392348..394431,394501..394531) [2115 bp, 704 aa]
          Length = 704

 Score = 29.3 bits (64), Expect = 3.3,   Method: Compositional matrix adjust.
 Identities = 23/76 (30%), Positives = 36/76 (47%), Gaps = 15/76 (19%)

Query: 19  WNELRRFESSINTHPHAADGSSYMEQGNNKIITLVKGPKEPRL--KSQMDTSKALLNVSV 76
           W EL+        H H AD S Y+    N++I      K P L  +S++ T+  LL+V  
Sbjct: 302 WLELK--------HQHIADASEYLNSKINEMIA-----KNPLLVDRSKVKTTTDLLSVVA 348

Query: 77  NITKFSKFERSKSSHK 92
           ++  F +  R  + HK
Sbjct: 349 HLKDFDEERRRITVHK 364

>CAGL0M03685g complement(413333..414814) weakly similar to sp|P48564
           Saccharomyces cerevisiae YNL295w, hypothetical start
          Length = 493

 Score = 28.5 bits (62), Expect = 5.8,   Method: Compositional matrix adjust.
 Identities = 26/84 (30%), Positives = 36/84 (42%), Gaps = 15/84 (17%)

Query: 60  RLKSQMDTSKALLNVSVNITKFSKFERSKSSHKNERRVLEIQTSLVRMFEKNVMLNIYPR 119
           R K   D    +LN S NI+  S  +R K      +++  IQ   +R      + NI P 
Sbjct: 361 RKKLYRDVISVMLNFSSNISDQSMIKRFK------KKLYNIQEETIR-----DLTNILPS 409

Query: 120 TVIDIEIHVLEQDGGIMGSLINGI 143
           T    E   LE D  IM S ++G 
Sbjct: 410 T----EFEALEADCCIMKSPVSGF 429

  Database: blastdb
    Posted date:  Apr 3, 2006  3:33 PM
  Number of letters in database: 16,596,109
  Number of sequences in database:  34,618
  
Lambda     K      H
   0.316    0.134    0.364 

Gapped
Lambda     K      H
   0.267   0.0410    0.140 

Matrix: BLOSUM62
Gap Penalties: Existence: 11, Extension: 1
Number of Sequences: 34618
Number of Hits to DB: 7,423,059
Number of extensions: 305418
Number of successful extensions: 1065
Number of sequences better than 10.0: 28
Number of HSP's gapped: 1051
Number of HSP's successfully gapped: 28
Length of query: 243
Length of database: 16,596,109
Length adjustment: 99
Effective length of query: 144
Effective length of database: 13,168,927
Effective search space: 1896325488
Effective search space used: 1896325488
Neighboring words threshold: 11
Window for multiple hits: 40
X1: 16 ( 7.3 bits)
X2: 38 (14.6 bits)
X3: 64 (24.7 bits)
S1: 41 (21.6 bits)
S2: 60 (27.7 bits)