Hit NameLength (aa)HSP LengthHSP ScoreHSP Significance
YGR194C (XKS1)60059031180.0
Scas_617.558157919160.0
CAGL0G09339g58258017300.0
Kwal_33.1543858057716570.0
Sklu_2014.363157616490.0
KLLA0E09746g58058315950.0
AGR324C56457713660.0
YML070W (DAK1)584148780.21
YHL025W (SNF6)33272750.43
Scas_703.3558557740.75
ACL069C644178711.4
CAGL0L08602g38092682.8
BLASTP 2.2.26 [Sep-21-2011]

Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, 
Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), 
"Gapped BLAST and PSI-BLAST: a new generation of protein database search
programs",  Nucleic Acids Res. 25:3389-3402.

Reference for compositional score matrix adjustment: Altschul, Stephen F., 
John C. Wootton, E. Michael Gertz, Richa Agarwala, Aleksandr Morgulis,
Alejandro A. Schaffer, and Yi-Kuo Yu (2005) "Protein database searches
using compositionally adjusted substitution matrices", FEBS J. 272:5101-5109.

Query= YGR194C
         (590 letters)

Database: blastdb 
           34,618 sequences; 16,596,109 total letters

Searching..................................................done

                                                                 Score    E
Sequences producing significant alignments:                      (bits) Value

YGR194C (XKS1) [2144] chr7 complement(886076..887878) Xylulokina...  1205   0.0  
Scas_617.5                                                            742   0.0  
CAGL0G09339g 891248..892996 similar to sp|P42826 Saccharomyces c...   671   0.0  
Kwal_33.15438                                                         642   0.0  
Sklu_2014.3 YGR194C, Contig c2014 3590-5485 reverse complement        639   0.0  
KLLA0E09746g 863295..865037 similar to sp|P42826 Saccharomyces c...   619   0.0  
AGR324C [4635] [Homologous to ScYGR194C (XKS1) - SH] (1335916..1...   530   0.0  
YML070W (DAK1) [3899] chr13 (133475..135229) Dihydroxyacetone ki...    35   0.21 
YHL025W (SNF6) [2261] chr8 (54848..55846) Component of SWI-SNF g...    33   0.43 
Scas_703.35                                                            33   0.75 
ACL069C [980] [Homologous to ScYHL032C (GUT1) - SH] (232439..234...    32   1.4  
CAGL0L08602g complement(936291..937433) similar to sp|P38698 Sac...    31   2.8  

>YGR194C (XKS1) [2144] chr7 complement(886076..887878) Xylulokinase,
           required for growth on D-xylulose [1803 bp, 600 aa]
          Length = 600

 Score = 1205 bits (3118), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 575/590 (97%), Positives = 575/590 (97%)

Query: 1   MLCSVIQRQTREVSNTMSLDSYYLGFDLSTQQLKCLAINQDLKIVHSETVEFEKDLPHYH 60
           MLCSVIQRQTREVSNTMSLDSYYLGFDLSTQQLKCLAINQDLKIVHSETVEFEKDLPHYH
Sbjct: 1   MLCSVIQRQTREVSNTMSLDSYYLGFDLSTQQLKCLAINQDLKIVHSETVEFEKDLPHYH 60

Query: 61  TKKGVYIHGDTIECPVAMWLEALDLVLSKYREAKFPLNKVMAVSGSCQQHGSVYWSSQAE 120
           TKKGVYIHGDTIECPVAMWLEALDLVLSKYREAKFPLNKVMAVSGSCQQHGSVYWSSQAE
Sbjct: 61  TKKGVYIHGDTIECPVAMWLEALDLVLSKYREAKFPLNKVMAVSGSCQQHGSVYWSSQAE 120

Query: 121 SLLEQLNKKPEKDLLHYVSSVAFARQTAPNWQDHSTAKQCQEFEECIGGPEKMAQLTGSR 180
           SLLEQLNKKPEKDLLHYVSSVAFARQTAPNWQDHSTAKQCQEFEECIGGPEKMAQLTGSR
Sbjct: 121 SLLEQLNKKPEKDLLHYVSSVAFARQTAPNWQDHSTAKQCQEFEECIGGPEKMAQLTGSR 180

Query: 181 AHFRFTGPQILKIAQLEPEAYEKTKTISLVSNFLTSILVGHLVELEEADACGMNLYDIRE 240
           AHFRFTGPQILKIAQLEPEAYEKTKTISLVSNFLTSILVGHLVELEEADACGMNLYDIRE
Sbjct: 181 AHFRFTGPQILKIAQLEPEAYEKTKTISLVSNFLTSILVGHLVELEEADACGMNLYDIRE 240

Query: 241 RKFSDELLHLIDSSSKDKTIRQKLMRAPMKNLIAGTICKYFIEKYGFNTNCKVSPMTGDN 300
           RKFSDELLHLIDSSSKDKTIRQKLMRAPMKNLIAGTICKYFIEKYGFNTNCKVSPMTGDN
Sbjct: 241 RKFSDELLHLIDSSSKDKTIRQKLMRAPMKNLIAGTICKYFIEKYGFNTNCKVSPMTGDN 300

Query: 301 LATICSLPLRKNDXXXXXXXXXXXXXXXDKYHPSPNYHLFIHPTLPNHYMGMICYCNGSL 360
           LATICSLPLRKND               DKYHPSPNYHLFIHPTLPNHYMGMICYCNGSL
Sbjct: 301 LATICSLPLRKNDVLVSLGTSTTVLLVTDKYHPSPNYHLFIHPTLPNHYMGMICYCNGSL 360

Query: 361 ARERIRDELNKERENNYEKTNDWTLFNQAVLDDSESSENELGVYFPLGEIVPSVKAINKR 420
           ARERIRDELNKERENNYEKTNDWTLFNQAVLDDSESSENELGVYFPLGEIVPSVKAINKR
Sbjct: 361 ARERIRDELNKERENNYEKTNDWTLFNQAVLDDSESSENELGVYFPLGEIVPSVKAINKR 420

Query: 421 VIFNPKTGMIEREVAKFKDKRHDAKNIVESQALSCRVRISPLLSDSNASSQQRLNEDTIV 480
           VIFNPKTGMIEREVAKFKDKRHDAKNIVESQALSCRVRISPLLSDSNASSQQRLNEDTIV
Sbjct: 421 VIFNPKTGMIEREVAKFKDKRHDAKNIVESQALSCRVRISPLLSDSNASSQQRLNEDTIV 480

Query: 481 KFDYDESPLRDYLNKRPERTFFVGGASKNDAIVKKFAQVIGATKGNFRLETPNSCALGGC 540
           KFDYDESPLRDYLNKRPERTFFVGGASKNDAIVKKFAQVIGATKGNFRLETPNSCALGGC
Sbjct: 481 KFDYDESPLRDYLNKRPERTFFVGGASKNDAIVKKFAQVIGATKGNFRLETPNSCALGGC 540

Query: 541 YKAMWSLLYDSNKIAVPFDKFLNDNFPWHVMESISDVDNENWDRYNSKIV 590
           YKAMWSLLYDSNKIAVPFDKFLNDNFPWHVMESISDVDNENWDRYNSKIV
Sbjct: 541 YKAMWSLLYDSNKIAVPFDKFLNDNFPWHVMESISDVDNENWDRYNSKIV 590

>Scas_617.5
          Length = 581

 Score =  742 bits (1916), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 354/579 (61%), Positives = 440/579 (75%), Gaps = 12/579 (2%)

Query: 17  MSLDSYYLGFDLSTQQLKCLAINQDLKIVHSETVEFEKDLPHYHTKKGVYIHGDTIECPV 76
           MS  SYYLG DLSTQQLK LAIN+ L+IV +ETV+F+K+LPHY+T KGVYI+G+ IECPV
Sbjct: 1   MSEPSYYLGLDLSTQQLKGLAINETLEIVVTETVDFDKELPHYNTTKGVYINGNDIECPV 60

Query: 77  AMWLEALDLVLSKYREAKFPLNKVMAVSGSCQQHGSVYWSSQAESLLEQLNKKPEKDLLH 136
            MWLEALDL+  K+++  F LN V A+SGSCQQHGSVYWS  A +LL+ L    +K L+ 
Sbjct: 61  GMWLEALDLLFEKFKKKGFSLNNVRAISGSCQQHGSVYWSQNANTLLKNLGSDTDKSLVS 120

Query: 137 YVSSVAFARQTAPNWQDHSTAKQCQEFEECIGGPEKMAQLTGSRAHFRFTGPQILKIAQL 196
           ++   AF+RQTAPNWQDHST  QCQ FE  +GGP+ +A++TGSRAHFRFTGPQI+KIA+ 
Sbjct: 121 HLIPDAFSRQTAPNWQDHSTGSQCQSFERKVGGPQALAEITGSRAHFRFTGPQIMKIAEK 180

Query: 197 EPEAYEKTKTISLVSNFLTSILVGHLVELEEADACGMNLYDIRERKFSDELLHLIDSSSK 256
           EP  Y  T ++SLVS+F+TS+L G L  LEEAD+CGMNLYDIR+R+F+++LL LIDS+  
Sbjct: 181 EPGNYANTSSVSLVSSFITSLLCGELTPLEEADSCGMNLYDIRKRQFNEDLLSLIDSN-- 238

Query: 257 DKTIRQKLMRAPM---KNLIAGTICKYFIEKYGFNTNCKVSPMTGDNLATICSLPLRKND 313
           +  IR KLM  P+   K +  G+I KYF++KYGFN +C + P+TGDNLATICSLPL+ ND
Sbjct: 239 EDNIRTKLMDPPLKCDKPVRLGSISKYFVQKYGFNPSCSIFPLTGDNLATICSLPLKTND 298

Query: 314 XXXXXXXXXXXXXXXDKYHPSPNYHLFIHPTLPNHYMGMICYCNGSLARERIRDELNKER 373
                          ++Y PSPNYHLFIHPT+P+HYMGMICYCNG+LARE+IRDELN+  
Sbjct: 299 VLVSLGTSTTILLVTNQYQPSPNYHLFIHPTIPDHYMGMICYCNGALAREKIRDELNETG 358

Query: 374 ENNYEKTNDWTLFNQAVLDDSESSENELGVYFPLGEIVPSVKAINKRVIFNPKTGMIERE 433
           E      N W LFN+AVLDD+  + +ELG+YFPLGEIVPSV AI KR  F+  TG I+  
Sbjct: 359 EG-----NSWNLFNEAVLDDTIDNSDELGIYFPLGEIVPSVSAIYKRAKFDKATGEIKAI 413

Query: 434 VAKFKDKRHDAKNIVESQALSCRVRISPLLSDSNASSQQRL--NEDTIVKFDYDESPLRD 491
           V +F +K+HDAKNIVESQALSCR+RISPLLS    S++  +  NE+  VKFDY E P+ D
Sbjct: 414 VDEFANKKHDAKNIVESQALSCRIRISPLLSKEGNSNKNEMTSNENGTVKFDYAEIPISD 473

Query: 492 YLNKRPERTFFVGGASKNDAIVKKFAQVIGATKGNFRLETPNSCALGGCYKAMWSLLYDS 551
           YL+KRP R FFVGGASKNDAIVKKFAQ+IGA +GN+RLETPNSCALGGCYKA+WS LY  
Sbjct: 474 YLSKRPNRAFFVGGASKNDAIVKKFAQIIGAQEGNYRLETPNSCALGGCYKAIWSQLYHL 533

Query: 552 NKIAVPFDKFLNDNFPWHVMESISDVDNENWDRYNSKIV 590
            +    FD +L+ +FPW  +E I + D + W+ YN KIV
Sbjct: 534 GETKESFDVYLDKHFPWGEVERICEPDEKAWELYNKKIV 572

>CAGL0G09339g 891248..892996 similar to sp|P42826 Saccharomyces
           cerevisiae YGR194c XKS1 xylulokinase, start by
           similarity
          Length = 582

 Score =  671 bits (1730), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 328/580 (56%), Positives = 411/580 (70%), Gaps = 14/580 (2%)

Query: 17  MSLDSYYLGFDLSTQQLKCLAINQDLKIVHSETVEFEKDLPHYHTKKGVYIHGDTIECPV 76
           M  + YYLG DLSTQQLKCLAI+ D++I H+E V+F++DLPHY+T KGVY HGD +ECPV
Sbjct: 1   MQGEGYYLGLDLSTQQLKCLAIDGDMQIKHTEVVDFDRDLPHYNTHKGVYSHGDVVECPV 60

Query: 77  AMWLEALDLVLSKYREAKFPLNKVMAVSGSCQQHGSVYWSSQAESLLEQLNKKPEKDLLH 136
            MWLEA+DLV  KY+ A F L++V A+SGSCQQHGSVYW + A  LL+ LN     +L+ 
Sbjct: 61  GMWLEAIDLVFEKYKGAGFDLSQVKAISGSCQQHGSVYWKTGAGDLLKHLN-DANGNLVD 119

Query: 137 YVSSVAFARQTAPNWQDHSTAKQCQEFEECIGGPEKMAQLTGSRAHFRFTGPQILKIAQL 196
            +    F+R+TAPNWQDHST KQC + E+  GGPEK+A++TGSRAHFRFTGPQI+KIA+ 
Sbjct: 120 QLYPDGFSRKTAPNWQDHSTGKQCTQIEKKAGGPEKLAEITGSRAHFRFTGPQIMKIAEN 179

Query: 197 EPEAYEKTKTISLVSNFLTSILVGHLVELEEADACGMNLYDIRERKFSDELLHLIDSSSK 256
           E + Y+ T+TISLVS+FLTSIL   LV +EEADACGMN+YDI+ +++ D LL +I     
Sbjct: 180 EEDNYKNTETISLVSSFLTSILCAKLVPIEEADACGMNIYDIKAKRYDDSLLDVISGKFG 239

Query: 257 DKTIRQKLMRAPMK---NLIAGTICKYFIEKYGFNTNCKVSPMTGDNLATICSLPLRKND 313
            + + +KL  +  K     + G I  YF+ KYGF++ C + P TGDNLATICSLPL KND
Sbjct: 240 KEDLLKKLSGSVTKCNSPQLMGNIANYFVSKYGFDSECAIYPFTGDNLATICSLPLEKND 299

Query: 314 XXXXXXXXXXXXXXXDKYHPSPNYHLFIHPTLPNHYMGMICYCNGSLARERIRDELNKER 373
                          D+YHPSPNYHLF HP + N YM MICYCNGSLARE++RD LN+ +
Sbjct: 300 ILVSLGTSTTILMVTDQYHPSPNYHLFTHPAIANCYMAMICYCNGSLAREKVRDSLNENQ 359

Query: 374 ENNYEKTNDWTLFNQAVLDDSESSENELGVYFPLGEIVPSVKAINKRVIFNPKTGMIERE 433
                 +  WT F++AVLD+S  +  EL VYFPLGEIVPSV AI KRV+++PK   I + 
Sbjct: 360 ------STSWTNFDEAVLDESLDTSGELAVYFPLGEIVPSVDAITKRVLYDPKNCEIVKY 413

Query: 434 VAKFKDKRHDAKNIVESQALSCRVRISPLLSDSNASSQQRLNEDTIVKFDYDESPLRDYL 493
           V KF + RHDAK IVESQALS RVR++PLLS +   S    +E T+V FDYD     +Y 
Sbjct: 414 VDKFDNNRHDAKIIVESQALSARVRVAPLLSGTVDESNDEKSE-TMVHFDYDSMKFSEYS 472

Query: 494 NKRPERTFFVGGASKNDAIVKKFAQVIGATKGNFRLETPNSCALGGCYKAMWSLLYDSNK 553
           +KRP R +FVGGASKNDAIVKKF++V+GA  GNFRLETPNSCALGGC+KA+WS L+   K
Sbjct: 473 SKRPNRVYFVGGASKNDAIVKKFSEVLGAKNGNFRLETPNSCALGGCFKALWSDLWKKKK 532

Query: 554 I--AVPFDKFLNDNFPWHVMESIS-DVDNENWDRYNSKIV 590
           I   V FD FLN  FP   +E I  D   + W+ Y  KI+
Sbjct: 533 IDEKVTFDSFLNRYFPTDELEEIKVDDITKKWEAYKDKII 572

>Kwal_33.15438
          Length = 580

 Score =  642 bits (1657), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 326/577 (56%), Positives = 405/577 (70%), Gaps = 25/577 (4%)

Query: 23  YLGFDLSTQQLKCLAINQDLKIVHSETVEFEKDLPHYHTKKGVYIHGD-TIECPVAMWLE 81
           YLGFDLSTQQLKCL I+QDLK++HSE++EF+KDL  Y T+KGVY+  D T+ECPVAMWLE
Sbjct: 9   YLGFDLSTQQLKCLVIDQDLKLLHSESIEFDKDLSSYKTEKGVYLRDDGTVECPVAMWLE 68

Query: 82  ALDLVLSKYREAK-FPLNKVMAVSGSCQQHGSVYWSSQAESLLEQLN-KKPEKDLLHYVS 139
           ALDLV  +  E K   L  V A+SGSCQQHGSVYW+ +   LL  L+ K+  KD L    
Sbjct: 69  ALDLVFQRMSENKDVDLGSVRAMSGSCQQHGSVYWAEEGPKLLPTLDFKQSLKDQLF--- 125

Query: 140 SVAFARQTAPNWQDHSTAKQCQEFEECIGGPEKMAQLTGSRAHFRFTGPQILKIAQLEPE 199
             AF+R  APNWQDHST  +CQ+FE+ +GGP ++A+LTGSRAH RFTGPQ++KI++ EPE
Sbjct: 126 PDAFSRSVAPNWQDHSTGSECQQFEDSVGGPVELARLTGSRAHHRFTGPQMMKISKKEPE 185

Query: 200 AYEKTKTISLVSNFLTSILVGHLVELEEADACGMNLYDIRERKFSDELLHLIDSSSKDKT 259
            Y KT  ISLVS+FL S+L G    LEEADACGMNLY+I +R + D LL  ID       
Sbjct: 186 VYRKTAKISLVSSFLASVLAGEFTSLEEADACGMNLYNIDKRDYEDNLLRNIDDDL--SG 243

Query: 260 IRQKLMRAPM---KNLIAGTICKYFIEKYGFNTNCKVSPMTGDNLATICSLPLRKNDXXX 316
           +R+KL  AP+   K    G+I  YF++KYG N +C+V P TGDNLATICSL L+ ND   
Sbjct: 244 LREKLGGAPINCDKPTPVGSISSYFVQKYGLNADCQVFPFTGDNLATICSLRLKPNDVLV 303

Query: 317 XXXXXXXXXXXXDKYHPSPNYHLFIHPTLPNHYMGMICYCNGSLARERIRDELNKERENN 376
                       D+YHPSPNYHLFIHPT+P HYMGMICYCNG+LARE+IRD+L+      
Sbjct: 304 SLGTSTTILLVTDQYHPSPNYHLFIHPTIPKHYMGMICYCNGALAREKIRDQLS------ 357

Query: 377 YEKTNDWTLFNQAVLDDSESSENELGVYFPLGEIVPSVKAINKRVIF-NPKTG--MIERE 433
              ++DW  FN AV   +  ++NE+  YFPLGEIVP+V ++ +R  F   +TG  +    
Sbjct: 358 --DSHDWEPFNAAVTSTTIENDNEIACYFPLGEIVPNVPSVCRRATFEKSETGDSVKLNI 415

Query: 434 VAKFKDKRHDAKNIVESQALSCRVRISPLLSDSNASSQQRLNEDTIVKFDYDESPLRDYL 493
           +  F +  HDA+NIVESQALSCRVRISPLLS     +   +  D+ V FDYD  PL +Y 
Sbjct: 416 LESFANVAHDARNIVESQALSCRVRISPLLSSDCTDTNSEMG-DSKVLFDYDNFPLSEY- 473

Query: 494 NKRPERTFFVGGASKNDAIVKKFAQVIGATKGNFRLETPNSCALGGCYKAMWSLLYDSNK 553
            KRP R FFVGGASKNDAIV  FAQV+GAT GNFRLETPNSCALGGCY+A+WS L+ SN 
Sbjct: 474 RKRPRRAFFVGGASKNDAIVNLFAQVLGATDGNFRLETPNSCALGGCYRALWSHLHYSNL 533

Query: 554 IAVPFDKFLNDNFPWHV-MESISDVDNENWDRYNSKI 589
           I+ PFD+FLN+ F W   ++S+   D ++W  YN+KI
Sbjct: 534 ISSPFDQFLNEAFRWDFDVQSLGLTDEKDWKHYNTKI 570

>Sklu_2014.3 YGR194C, Contig c2014 3590-5485 reverse complement
          Length = 631

 Score =  639 bits (1649), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 316/576 (54%), Positives = 396/576 (68%), Gaps = 20/576 (3%)

Query: 21  SYYLGFDLSTQQLKCLAINQDLKIVHSETVEFEKDLPHYHTKKGVYIHGD-TIECPVAMW 79
            Y+LGFDLSTQQLKCL ++Q L++VHSE V+F++DLP YHT KGVY + D +IE PVAMW
Sbjct: 58  GYFLGFDLSTQQLKCLVVDQQLQLVHSEVVDFDRDLPEYHTHKGVYFNDDGSIEAPVAMW 117

Query: 80  LEALD-LVLSKYREAKFPLNKVMAVSGSCQQHGSVYWSSQAESLLEQLNKKPEKDLLHYV 138
            +ALD L      +  F L++V+ +SGSCQQHGSVYWS   E  L  L+   ++ LL  +
Sbjct: 118 CDALDHLFAGLANQNVFSLDRVLGISGSCQQHGSVYWSKDGEEALRNLDA--QQTLLTQL 175

Query: 139 SSVAFARQTAPNWQDHSTAKQCQEFEECIGGPEKMAQLTGSRAHFRFTGPQILKIAQLEP 198
           +  AF+R  APNWQDHST  +C+ FE   GGP+ +A +TGSRAH+RFTGPQI K+A  EP
Sbjct: 176 APKAFSRSVAPNWQDHSTGNECKLFESSCGGPQGLAAITGSRAHYRFTGPQICKVAHREP 235

Query: 199 EAYEKTKTISLVSNFLTSILVGHLVELEEADACGMNLYDIRERKFSDELLHLIDSSSKDK 258
           E Y  T  I+LVSNFL S+L G++  LEEADACGMNLYDI  R +   LL  ID     +
Sbjct: 236 EVYANTANITLVSNFLASLLCGYIAPLEEADACGMNLYDIVNRDYDSGLLQNIDPDV--E 293

Query: 259 TIRQKLMRAPMKNLIAG---TICKYFIEKYGFNTNCKVSPMTGDNLATICSLPLRKNDXX 315
           +I++KL  +P     AG    +  Y++ +YG N  C+V P TGDNLATICSLPL+KND  
Sbjct: 294 SIKRKLKGSPTPADNAGPLSCVSSYYVRRYGLNPQCQVFPFTGDNLATICSLPLKKNDVL 353

Query: 316 XXXXXXXXXXXXXDKYHPSPNYHLFIHPTLPNHYMGMICYCNGSLARERIRDELNKEREN 375
                        D+Y+PSPNYHLFIHPT+P  YMGMICYCNGSLARE +RD L+ +   
Sbjct: 354 VSLGTSTTILIVTDQYYPSPNYHLFIHPTIPGLYMGMICYCNGSLARENVRDLLSADHS- 412

Query: 376 NYEKTNDWTLFNQAVLDDSESSENELGVYFPLGEIVPSVKAINKRVIFNPKTGMIERE-V 434
                  W  FN+A+LD S  + +E+GVYFPL EIVPSV++  KR  F      I  E V
Sbjct: 413 -------WDPFNKALLDSSVDNHDEIGVYFPLSEIVPSVRSCTKRAKFTKSDNDINLEPV 465

Query: 435 AKFKDKRHDAKNIVESQALSCRVRISPLLSDSNASSQQRLNEDTIVKFDYDESPLRDYLN 494
            +F D +HD KNIVESQALSCRVRISPLLSD+ A++    +    VKFDYD  P+ +Y  
Sbjct: 466 EQFSDIKHDVKNIVESQALSCRVRISPLLSDNCAAASNNSSTSYTVKFDYDTFPISEY-R 524

Query: 495 KRPERTFFVGGASKNDAIVKKFAQVIGATKGNFRLETPNSCALGGCYKAMWSLLYDSNKI 554
           KRP R FFVGGAS+NDAIV+ FAQVIGAT+GN++LETPNSCALGGCYKA+WS +Y     
Sbjct: 525 KRPRRAFFVGGASRNDAIVRTFAQVIGATEGNYKLETPNSCALGGCYKALWSYMYSGGFT 584

Query: 555 AVPFDKFLNDNFPW-HVMESISDVDNENWDRYNSKI 589
            + FD FLN++F W H  E I D + E+W+ YN+KI
Sbjct: 585 KLSFDLFLNEHFDWQHDAEFICDSETESWEYYNTKI 620

>KLLA0E09746g 863295..865037 similar to sp|P42826 Saccharomyces
           cerevisiae YGR194c XKS1 xylulokinase singleton, start by
           similarity
          Length = 580

 Score =  619 bits (1595), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 320/583 (54%), Positives = 410/583 (70%), Gaps = 26/583 (4%)

Query: 17  MSLDSYYLGFDLSTQQLKCLAINQDLKIVHSETVEFEKDLPHYHTKKGVYIHGD-TIECP 75
           MS   YYLGFDLSTQQLKCLAI+  L IV +  +EF+KD PHY+T+KGVYI  +  I+ P
Sbjct: 1   MSESGYYLGFDLSTQQLKCLAIDDQLNIVTTAAIEFDKDFPHYNTRKGVYIKDEGVIDAP 60

Query: 76  VAMWLEALDLVLSKYREAKFPLNKVMAVSGSCQQHGSVYWSSQAESLLEQLNKKPEKDLL 135
           VAMWLEA+DL   +  +    L KV ++SGSCQQHG+V+W+   + L + L  +P  +L+
Sbjct: 61  VAMWLEAIDLCFERLGKC-IDLKKVKSMSGSCQQHGTVFWN--CDHLPKDL--QPSSNLV 115

Query: 136 HYVSSVAFARQTAPNWQDHSTAKQCQEFEECIGGPEKMAQLTGSRAHFRFTGPQILKIAQ 195
             ++S  F+R  APNWQDHST KQC E  + +GGP+++A++TGS +H+RF+G QI K+ +
Sbjct: 116 KQLAS-CFSRDVAPNWQDHSTRKQCDELTDKVGGPQELARITGSSSHYRFSGSQIAKVHE 174

Query: 196 LEPEAYEKTKTISLVSNFLTSILVGHLVELEEADACGMNLYDIRERKFSDELLHLIDSSS 255
            EPE Y  TK ISLVS+FL S+LVG +V LEEADACGMNLY I + +F+++LL ++D   
Sbjct: 175 TEPEVYANTKKISLVSSFLASVLVGDIVPLEEADACGMNLYGIEKHEFNEDLLSVVDEDI 234

Query: 256 KDKTIRQKLMRAPM-----KNLIAGTICKYFIEKYGFNTNCKVSPMTGDNLATICSLPLR 310
              +I++KL   P      K+L  G +  YF EKYG N +C++ P TGDNLATICSLPL+
Sbjct: 235 --ASIKRKLFDPPTSSDEPKSL--GPVSTYFQEKYGVNPDCQIYPFTGDNLATICSLPLQ 290

Query: 311 KNDXXXXXXXXXXXXXXXDKYHPSPNYHLFIHPTLPNHYMGMICYCNGSLARERIRDELN 370
           KND               D+YH SPNYHLFIHPT+PNHYMGMICYCNGSLARE+IRD++N
Sbjct: 291 KNDVLISLGTSTTILLITDQYHSSPNYHLFIHPTVPNHYMGMICYCNGSLAREKIRDDIN 350

Query: 371 KERENNYEKTNDWTLFNQAVLDDSESSENELGVYFPLGEIVPSVKAINKRVIFN-PKTGM 429
            E +     T+DWT FN+A+LD+S S++NE+G+YFPLGEIVP++ A+ KR  F      +
Sbjct: 351 GESQ-----THDWTKFNEALLDNSLSNDNEIGLYFPLGEIVPNMDAVTKRCYFKYIDNKV 405

Query: 430 IEREVAKFKDKRHDAKNIVESQALSCRVRISPLLS-DSNASSQ-QRLNEDTIVKFDYDES 487
           +   V  F DKR DAKNIVESQALSCRVRISPLLS ++NA ++ Q L  +  VKFDYD  
Sbjct: 406 VLTNVNMFPDKRLDAKNIVESQALSCRVRISPLLSEEANAINETQVLKSELKVKFDYDFF 465

Query: 488 PLRDYLNKRPERTFFVGGASKNDAIVKKFAQVIGATKGNFRLETPNSCALGGCYKAMWSL 547
           PL  Y  KRP R FFVGGASKN+AI+K  A VIGA  GN+RLET NSCALGGCYKA+WSL
Sbjct: 466 PLASYA-KRPNRAFFVGGASKNEAIIKTMANVIGAKNGNYRLETANSCALGGCYKALWSL 524

Query: 548 LYDSNKIAVPFDKFLNDNFPWHV-MESISDVDNENWDRYNSKI 589
           L + N     FD++LN  F W    E + + D   W+ YN+KI
Sbjct: 525 LKEQNPETPSFDRWLNAFFNWERDCEFVCNSDAAKWENYNNKI 567

>AGR324C [4635] [Homologous to ScYGR194C (XKS1) - SH]
           (1335916..1337610) [1695 bp, 564 aa]
          Length = 564

 Score =  530 bits (1366), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 283/577 (49%), Positives = 360/577 (62%), Gaps = 25/577 (4%)

Query: 17  MSLDSYYLGFDLSTQQLKCLAINQDLKIVHSETVEFEKDLPHYHTKKGVYIHGD-TIECP 75
           M+    YLGFDLSTQQLKCLAI++DL I  +  V+F++DL  Y T KGVY   D  +E P
Sbjct: 1   MAESKLYLGFDLSTQQLKCLAIDEDLAIKCTAVVDFDRDLAGYETVKGVYTREDNVVESP 60

Query: 76  VAMWLEALDLVLSKYREAKFPLNKVMAVSGSCQQHGSVYWSSQAESLLEQLNKKPEKDLL 135
           V MWLEALDL   +    +  L  V A+SGSCQQH SVYW+   ++ + +L+ +     L
Sbjct: 61  VEMWLEALDLCFERLAR-EVDLGAVEAISGSCQQHASVYWTEDVKTRIRELDSRSG---L 116

Query: 136 HYVSSVAFARQTAPNWQDHSTAKQCQEFEECIGGPEKMAQLTGSRAHFRFTGPQILKIAQ 195
                   +R  APNWQDHST  Q ++FE   GGP+++AQLTGS+AHFRFTG QI KI  
Sbjct: 117 RAQLGPCLSRANAPNWQDHSTEAQREQFEAHCGGPQELAQLTGSKAHFRFTGLQIKKIRD 176

Query: 196 LEPEAYEKTKTISLVSNFLTSILVGHLVELEEADACGMNLYDIRERKFSDELLHLIDSSS 255
            EP     T +ISL S+FL S+LVG LV  EEADACGM LY+I + ++ + LL ++D + 
Sbjct: 177 TEPATLTATPSISLASSFLASVLVGKLVPPEEADACGMILYNIAQHRYVEGLLQMVDDAL 236

Query: 256 KDKTIRQKLMRAPMKNLIAGTICKYFIEKYGFNTNCKVSPMTGDNLATICSLPLRKNDXX 315
            DK     +    ++ L  GT+ +YF EKYG NT+C +  +TGDNLATICSLPL+KND  
Sbjct: 237 FDKLCGNPVRCDNVRPL--GTVSRYFKEKYGINTSCNIYQLTGDNLATICSLPLQKNDLL 294

Query: 316 XXXXXXXXXXXXXDKYHPSPNYHLFIHPTLPNHYMGMICYCNGSLARERIRDELNKEREN 375
                        +KY PSPNYH+FIHPT+P +YMGM+CYCNG+LARERI+D L  E   
Sbjct: 295 VSLGTSTTVLAVTEKYSPSPNYHMFIHPTIPGNYMGMVCYCNGALARERIKDTLGDE--- 351

Query: 376 NYEKTNDWTLFNQAVLDDSESSENELGVYFPLGEIVPSVK-AINKRVIFNPKTGMIEREV 434
                + W  F++A+ DDS  +  ELGVYFPL EIVPSV   + KRV  +PK G+  +EV
Sbjct: 352 -----SGWAAFSKALEDDSVDTSAELGVYFPLPEIVPSVDHPLVKRVRISPK-GL--QEV 403

Query: 435 AKFKDKRHDAKNIVESQALSCRVRISPLLSDSNASSQQRLNEDTIVKFDYDESPLRDYLN 494
             F    HDAKNIVESQALSCRVR++PLLS     S    +      FD  +  + ++  
Sbjct: 404 ESFASPAHDAKNIVESQALSCRVRVAPLLSTPPEIS----DTGGHAAFDGQQRDVAEF-T 458

Query: 495 KRPERTFFVGGASKNDAIVKKFAQVIGATKGNFRLETPNSCALGGCYKAMWSLLYDSNKI 554
           +RP R FFVGGASKNDAIV+    ++GA  GN+RLET NSCALGGCYKA WS L    K 
Sbjct: 459 RRPNRVFFVGGASKNDAIVRAMPNILGAKGGNYRLETSNSCALGGCYKAFWSDLLYKQKT 518

Query: 555 AVPFDKFLNDNFPW-HVMESISDVDNENWDRYNSKIV 590
              F  +L+  F W    + +   DN  W     KI 
Sbjct: 519 NASFADWLDSVFKWDRDCKMLCKTDNRKWAASLGKIA 555

>YML070W (DAK1) [3899] chr13 (133475..135229) Dihydroxyacetone
           kinase, involved in detoxification of dihydroxyacetone
           [1755 bp, 584 aa]
          Length = 584

 Score = 34.7 bits (78), Expect = 0.21,   Method: Compositional matrix adjust.
 Identities = 38/148 (25%), Positives = 60/148 (40%), Gaps = 19/148 (12%)

Query: 174 AQLTGSRAHFRFTGP---QILKIAQLEPEAYEKTKTISLVSNFLTSILVGHL-VELEEAD 229
             L+G+     F  P   QIL   +L  E    +  + +V N+   +L  H  +  E A 
Sbjct: 65  GMLSGAVVGEIFASPSTKQILNAIRLVNE--NASGVLLIVKNYTGDVL--HFGLSAERAR 120

Query: 230 ACGMNLYDIRERKFSDELLHLIDSSSKDKTIRQKLMRAPMKNLIAGTICKYFIEKYGFNT 289
           A G+N    R     D++   +         R+ L    + + I G   + +  KYG + 
Sbjct: 121 ALGINC---RVAVIGDDVA--VGREKGGMVGRRALAGTVLVHKIVGAFAEEYSSKYGLDG 175

Query: 290 NCKVSPMTGDNLATI------CSLPLRK 311
             KV+ +  DNL TI      C +P RK
Sbjct: 176 TAKVAKIINDNLVTIGSSLDHCKVPGRK 203

>YHL025W (SNF6) [2261] chr8 (54848..55846) Component of SWI-SNF
           global transcription activator complex, acts to assist
           gene-specific activators through chromatin remodeling
           [999 bp, 332 aa]
          Length = 332

 Score = 33.5 bits (75), Expect = 0.43,   Method: Compositional matrix adjust.
 Identities = 21/72 (29%), Positives = 29/72 (40%), Gaps = 11/72 (15%)

Query: 52  FEKDLPHYHTKKGVYIH-----------GDTIECPVAMWLEALDLVLSKYREAKFPLNKV 100
           FE+D    +   GV +H           GD  E P   W  A   VL++Y EAK  + + 
Sbjct: 191 FEQDSHLRYQPDGVVVHRDDPALVGKLRGDLREAPADYWTHAYRDVLAQYHEAKERIRQK 250

Query: 101 MAVSGSCQQHGS 112
              +G  Q   S
Sbjct: 251 EVTAGEAQDEAS 262

>Scas_703.35
          Length = 585

 Score = 33.1 bits (74), Expect = 0.75,   Method: Compositional matrix adjust.
 Identities = 18/57 (31%), Positives = 26/57 (45%), Gaps = 6/57 (10%)

Query: 261 RQKLMRAPMKNLIAGTICKYFIEKYGFNTNCKVSPMTGDNLATI------CSLPLRK 311
           R+ L    + + I G   + +  KYG     KV+ +  DNL TI      C +P RK
Sbjct: 148 RRALAGTVLVHKIVGAFAEKYSSKYGLEGTAKVARIVNDNLVTIGSSLDHCKVPGRK 204

>ACL069C [980] [Homologous to ScYHL032C (GUT1) - SH]
           (232439..234373) [1935 bp, 644 aa]
          Length = 644

 Score = 32.0 bits (71), Expect = 1.4,   Method: Compositional matrix adjust.
 Identities = 37/178 (20%), Positives = 65/178 (36%), Gaps = 30/178 (16%)

Query: 434 VAKFKDKRHDAKNIVESQALSCRVRISPLLSDS--NASSQQRLNEDTIVKFDYDESPLRD 491
           +++F    H A+  +E      R  +  + SD+    +      E+ +    Y+ SPL  
Sbjct: 462 MSQFTTASHIARAAIEGVCFQARAILKAMSSDAFGEGAKDHDFLEEIVDTGTYEHSPLSV 521

Query: 492 YLNKRPERTFFVGGASKNDAIVKKFAQVIGATKGNFRLETPNSCALGGCYKA-------- 543
                       GG SK+D +++  A ++G      R  T  S ALG    A        
Sbjct: 522 LAVD--------GGMSKSDEVMQIQADILGPCVKVRRSPTAESTALGAAIAACMAYKDPN 573

Query: 544 --MWSLLYDSNKI----------AVPFDKFLNDNFPWHVMESISDVDNENWDRYNSKI 589
             +W  L D+ K           A+     ++        +S+  V  +NW R+ + I
Sbjct: 574 ERVWKDLNDAKKWIFYGGLEKEEALRTPDNVSSKLKIFASQSVDTVRRKNWKRWEAAI 631

>CAGL0L08602g complement(936291..937433) similar to sp|P38698
           Saccharomyces cerevisiae YHR201c PPX1
           exopolyphosphatase, start by similarity
          Length = 380

 Score = 30.8 bits (68), Expect = 2.8,   Method: Compositional matrix adjust.
 Identities = 20/92 (21%), Positives = 42/92 (45%), Gaps = 6/92 (6%)

Query: 33  LKCLAINQDLKIVHSETVEFEKDLPHYHTKKGVYIHGDTIECPVAMWLEALDLVLSKYRE 92
           L  L I+QDL     + +E+ K    ++T   V +  + +  P    +  +  ++  + +
Sbjct: 81  LNKLDISQDLLFFREDLMEYNK---QFNTINAVIVDHNELPKPTKQLITDVIGIIDHHAD 137

Query: 93  AKFPLN---KVMAVSGSCQQHGSVYWSSQAES 121
            +   N   +++ V+GSC    + +WS   ES
Sbjct: 138 KQLYPNANPRIITVTGSCSSLVTNFWSKNLES 169

  Database: blastdb
    Posted date:  Apr 3, 2006  3:33 PM
  Number of letters in database: 16,596,109
  Number of sequences in database:  34,618
  
Lambda     K      H
   0.318    0.133    0.398 

Gapped
Lambda     K      H
   0.267   0.0410    0.140 

Matrix: BLOSUM62
Gap Penalties: Existence: 11, Extension: 1
Number of Sequences: 34618
Number of Hits to DB: 19,906,513
Number of extensions: 878268
Number of successful extensions: 2320
Number of sequences better than 10.0: 22
Number of HSP's gapped: 2338
Number of HSP's successfully gapped: 22
Length of query: 590
Length of database: 16,596,109
Length adjustment: 107
Effective length of query: 483
Effective length of database: 12,891,983
Effective search space: 6226827789
Effective search space used: 6226827789
Neighboring words threshold: 11
Window for multiple hits: 40
X1: 16 ( 7.3 bits)
X2: 38 (14.6 bits)
X3: 64 (24.7 bits)
S1: 41 (21.7 bits)
S2: 64 (29.3 bits)