Hit NameLength (aa)HSP LengthHSP ScoreHSP Significance
YGR193C (PDX1)41040321150.0
Scas_617.74204169101e-120
Sklu_2014.24153908641e-113
Kwal_33.154354104038551e-112
AGR323C4024018411e-110
KLLA0E09768g4053958391e-109
CAGL0G09361g4294287594e-97
Scas_694.104792202471e-22
YNL071W (LAT1)4822102408e-22
AER364W4532922381e-21
Sklu_2037.44711862186e-19
CAGL0J10186g4692542123e-18
KLLA0F04741g4732232098e-18
Kwal_23.47254722082062e-17
Kwal_56.2393444294820.040
AGL200W43687760.25
Sklu_2172.1432106760.26
KLLA0D16522g46892750.27
CAGL0E01287g413106730.53
Scas_693.2944284710.81
KLLA0E08107g182958701.3
YDR148C (KGD2)46375664.1
YBR208C (DUR1,2)183558656.0
CAGL0J11528g55752646.4
BLASTP 2.2.26 [Sep-21-2011]

Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, 
Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), 
"Gapped BLAST and PSI-BLAST: a new generation of protein database search
programs",  Nucleic Acids Res. 25:3389-3402.

Reference for compositional score matrix adjustment: Altschul, Stephen F., 
John C. Wootton, E. Michael Gertz, Richa Agarwala, Aleksandr Morgulis,
Alejandro A. Schaffer, and Yi-Kuo Yu (2005) "Protein database searches
using compositionally adjusted substitution matrices", FEBS J. 272:5101-5109.

Query= YGR193C
         (403 letters)

Database: blastdb 
           34,618 sequences; 16,596,109 total letters

Searching..................................................done

                                                                 Score    E
Sequences producing significant alignments:                      (bits) Value

YGR193C (PDX1) [2143] chr7 complement(884512..885744) Pyruvate d...   819   0.0  
Scas_617.7                                                            355   e-120
Sklu_2014.2 YGR193C, Contig c2014 2083-3330 reverse complement        337   e-113
Kwal_33.15435                                                         333   e-112
AGR323C [4634] [Homologous to ScYGR193C (PDX1) - SH] (1334333..1...   328   e-110
KLLA0E09768g 865604..866821 similar to sp|P16451 Saccharomyces c...   327   e-109
CAGL0G09361g 893614..894903 similar to sp|P16451 Saccharomyces c...   296   4e-97
Scas_694.10                                                           100   1e-22
YNL071W (LAT1) [4519] chr14 (491522..492970) Dihydrolipoamide S-...    97   8e-22
AER364W [2865] [Homologous to ScYNL071W (LAT1) - SH] complement(...    96   1e-21
Sklu_2037.4 YNL071W, Contig c2037 4059-5474 reverse complement         89   6e-19
CAGL0J10186g complement(995223..996632) highly similar to sp|P12...    86   3e-18
KLLA0F04741g complement(463107..464528) similar to sp|P12695 Sac...    85   8e-18
Kwal_23.4725                                                           84   2e-17
Kwal_56.23934                                                          36   0.040
AGL200W [4112] [Homologous to ScYDR148C (KGD2) - SH] complement(...    34   0.25 
Sklu_2172.1 YDR148C, Contig c2172 307-1605                             34   0.26 
KLLA0D16522g complement(1394850..1396256) similar to sp|P19262 S...    33   0.27 
CAGL0E01287g 120567..121808 highly similar to sp|P19262 Saccharo...    33   0.53 
Scas_693.29                                                            32   0.81 
KLLA0E08107g 730334..735823 highly similar to sp|P32528 Saccharo...    32   1.3  
YDR148C (KGD2) [993] chr4 complement(753669..755060) 2-oxoglutar...    30   4.1  
YBR208C (DUR1,2) [390] chr2 complement(636660..642167) Urea amid...    30   6.0  
CAGL0J11528g complement(1117845..1119518) similar to sp|P53870 S...    29   6.4  

>YGR193C (PDX1) [2143] chr7 complement(884512..885744) Pyruvate
           dehydrogenase complex protein X, the binding protein for
           Lpd1p [1233 bp, 410 aa]
          Length = 410

 Score =  819 bits (2115), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 403/403 (100%), Positives = 403/403 (100%)

Query: 1   MLSAISKVSTLKSCTRYLTKCNYHASAKLLAVKTFSMPAMSPTMEKGGIVSWKYKVGEPF 60
           MLSAISKVSTLKSCTRYLTKCNYHASAKLLAVKTFSMPAMSPTMEKGGIVSWKYKVGEPF
Sbjct: 1   MLSAISKVSTLKSCTRYLTKCNYHASAKLLAVKTFSMPAMSPTMEKGGIVSWKYKVGEPF 60

Query: 61  SAGDVILEVETDKSQIDVEALDDGKLAKILKDEGSKDVDVGEPIAYIADVDDDLATIKLP 120
           SAGDVILEVETDKSQIDVEALDDGKLAKILKDEGSKDVDVGEPIAYIADVDDDLATIKLP
Sbjct: 61  SAGDVILEVETDKSQIDVEALDDGKLAKILKDEGSKDVDVGEPIAYIADVDDDLATIKLP 120

Query: 121 QEANTANAKSIEIKKPSADSTEATQQHLKKATVTPIKTVDGSQANLEQTLLPSVSLLLAE 180
           QEANTANAKSIEIKKPSADSTEATQQHLKKATVTPIKTVDGSQANLEQTLLPSVSLLLAE
Sbjct: 121 QEANTANAKSIEIKKPSADSTEATQQHLKKATVTPIKTVDGSQANLEQTLLPSVSLLLAE 180

Query: 181 NNISKQKALKEIAPSGSNGRLLKGDVLAYLGKIPQDSVNKVTEFIKKNERLDLSNIKPIQ 240
           NNISKQKALKEIAPSGSNGRLLKGDVLAYLGKIPQDSVNKVTEFIKKNERLDLSNIKPIQ
Sbjct: 181 NNISKQKALKEIAPSGSNGRLLKGDVLAYLGKIPQDSVNKVTEFIKKNERLDLSNIKPIQ 240

Query: 241 LKPKIAEQAQTKAADKPKITPVEFEEQLVFHAPASIPFDKLSESLNSFMKEAYQFSHGTP 300
           LKPKIAEQAQTKAADKPKITPVEFEEQLVFHAPASIPFDKLSESLNSFMKEAYQFSHGTP
Sbjct: 241 LKPKIAEQAQTKAADKPKITPVEFEEQLVFHAPASIPFDKLSESLNSFMKEAYQFSHGTP 300

Query: 301 LMDTNSKYFDPIFEDLVTLSPREPRFKFSYDLMQIPKANNMQDTYGQEDIFDLLTGSDAT 360
           LMDTNSKYFDPIFEDLVTLSPREPRFKFSYDLMQIPKANNMQDTYGQEDIFDLLTGSDAT
Sbjct: 301 LMDTNSKYFDPIFEDLVTLSPREPRFKFSYDLMQIPKANNMQDTYGQEDIFDLLTGSDAT 360

Query: 361 ASSVRPVEKNLPEKNEYILALNVSVNNKKFNDAEAKAKRFLDY 403
           ASSVRPVEKNLPEKNEYILALNVSVNNKKFNDAEAKAKRFLDY
Sbjct: 361 ASSVRPVEKNLPEKNEYILALNVSVNNKKFNDAEAKAKRFLDY 403

>Scas_617.7
          Length = 420

 Score =  355 bits (910), Expect = e-120,   Method: Compositional matrix adjust.
 Identities = 200/416 (48%), Positives = 276/416 (66%), Gaps = 16/416 (3%)

Query: 1   MLSAISKVSTLKSCTRYLTKCNYHASAKLLAVKTFSMPAMSPTMEKGGIVSWKYKVGEPF 60
           MLS  +  S L+  TR     + H S  LL+ + F+MPAMSPTMEKGGIVSWK+KVGEPF
Sbjct: 1   MLSYNAMRSCLQGQTRRSLIRSIHLSRSLLSAQKFTMPAMSPTMEKGGIVSWKFKVGEPF 60

Query: 61  SAGDVILEVETDKSQIDVEALDDGKLAKILKDEGSKDVDVGEPIAYIADVDDDLATIKLP 120
           S+GDV+LEVETDK+QIDVEA DDGKLAKILK +GSKDVDVGE IAY+ADVDDDL+T+K+ 
Sbjct: 61  SSGDVLLEVETDKAQIDVEAQDDGKLAKILKGDGSKDVDVGETIAYLADVDDDLSTLKIS 120

Query: 121 QEANTANAKSIEIKKPSADSTEATQ---QHLKKATVTPIKTVDGS---QANLEQTLLPSV 174
            E      K   + K    +T   +   Q+ KKA  +PI T        A   QTLLPSV
Sbjct: 121 AEEE-EQVKVTPVSKVEEKTTSGNKEPLQNTKKAKESPIATDKNGVLQVAKSNQTLLPSV 179

Query: 175 SLLLAENNISKQKALKEIAPSGSNGRLLKGDVLAYLGKIPQDSVNKVTEFIKKNERLDLS 234
           SLLLA NNISK+ A++ I  SG +G LLKGDVLAYLGKIP+ S+ KV+E++K  E+ D S
Sbjct: 180 SLLLAANNISKEDAIRNIKASGRDGLLLKGDVLAYLGKIPESSLIKVSEYVKNKEKQDFS 239

Query: 235 NIKPIQL---KPKIAEQAQTKAADKPKITPVEFEEQLVFHAPASIPFDKLSESLNSFMKE 291
           +I+   L   +P  +E+ + KA +K    PV    ++    P+++  ++L  ++ SF++E
Sbjct: 240 HIELGSLTKAEPPQSEKLEDKAIEKISKEPVLLHSEITLKVPSNVSRERLDNTVKSFIEE 299

Query: 292 AYQFSHGTPLMDTNSKYFDPIFEDLVTLSPREPRFKFSYDLMQIPKANNMQDTYGQEDIF 351
            ++++H  PL + NS+YFD IFEDL+T +PREPRF+ +Y+L    +         +EDIF
Sbjct: 300 GFEYTHAMPLSNINSQYFDDIFEDLITTAPREPRFQVNYELYCPVEEEERFTRKDREDIF 359

Query: 352 DLLTGSDATASSVRPV----EKNLPEKNEYILALNVSVNNKKFNDAEAKAKRFLDY 403
           DLL GS++      PV    E + P  +E+ L+L + V++ K++D++ KA+RFL+Y
Sbjct: 360 DLLAGSESRTPLRGPVVSNSEASTP-ASEWTLSLELEVSD-KYSDSKQKAERFLEY 413

>Sklu_2014.2 YGR193C, Contig c2014 2083-3330 reverse complement
          Length = 415

 Score =  337 bits (864), Expect = e-113,   Method: Compositional matrix adjust.
 Identities = 203/390 (52%), Positives = 259/390 (66%), Gaps = 21/390 (5%)

Query: 22  NYHASAKLLAVKTFSMPAMSPTMEKGGIVSWKYKVGEPFSAGDVILEVETDKSQIDVEAL 81
            +H++A L   + F+MPAMSPTMEKGG+V WKYKVGEPFSAGDV+LEVETDK+QIDVEA 
Sbjct: 26  GFHSAATLYKAQAFTMPAMSPTMEKGGVVEWKYKVGEPFSAGDVLLEVETDKAQIDVEAQ 85

Query: 82  DDGKLAKILKDEGSKDVDVGEPIAYIADVDDDLATIKLPQEANTANAKSIEIKKPSADST 141
           DDGKLA I+ D GSKD+ VGE IAY+A+VDDDLAT+++P++   A  K    K+ +A + 
Sbjct: 86  DDGKLAAIIIDNGSKDIKVGETIAYLAEVDDDLATLEIPKQ-EPAAPKPTPKKQETAPTP 144

Query: 142 EATQQHLK--KATVTPIK-TVDG--SQANLEQTLLPSVSLLLAENNISKQKALKEIAPSG 196
            AT +  K    T  P K T  G  S AN  QTL PSV  LL EN IS + AL  I  SG
Sbjct: 145 AATPEPKKDNAPTSEPKKDTPSGILSTANPSQTLFPSVQSLLHENGISVEDALNNIKASG 204

Query: 197 SNGRLLKGDVLAYLGKIPQDSVNKVTEFIKKNERLDLSNIKPIQLKPKIA-EQAQTKAAD 255
            NGR+LKGDVLAYLGKI  D V KVTE+IK  E LDL+NI+    KP++  E   +K   
Sbjct: 205 PNGRILKGDVLAYLGKISNDCVVKVTEYIKSGESLDLTNIE--LKKPELKLELGTSKTLL 262

Query: 256 KPKITPVEFEEQLVFHAPASIPFDKLSESLNSFMKEAYQFSHGTPLMDTNSKYFDPIFED 315
           KP+  PV F E L    P+++  D+LS+SL S++ EA   SH  P+  + S Y+DPIFE+
Sbjct: 263 KPE--PVVFTETLTLRVPSAVSSDQLSKSLRSYINEANYLSHEQPVNASTSDYYDPIFEE 320

Query: 316 LVTLSPREPRFKFSYDLMQ-IPKANNMQDTYGQEDIFDLLTGSDATASSVRPVEKNLPEK 374
           L+T  PR+PRF  SY L   +P  +  Q     +DIFDLL+G+ A  SS + VE+  P K
Sbjct: 321 LITPEPRQPRFSVSYQLTPLVPVLSPKQ----HDDIFDLLSGTSAATSSPQ-VEQ--PSK 373

Query: 375 -NEYILALNVSVNNKKFNDAEAKAKRFLDY 403
             EY L ++V VN  KF+DA  KA+RF++Y
Sbjct: 374 TTEYSLDVSVQVNG-KFDDATLKAQRFIEY 402

>Kwal_33.15435
          Length = 410

 Score =  333 bits (855), Expect = e-112,   Method: Compositional matrix adjust.
 Identities = 191/403 (47%), Positives = 261/403 (64%), Gaps = 22/403 (5%)

Query: 12  KSCTRYLTKCNYHASAKLLAVKTFSMPAMSPTMEKGGIVSWKYKVGEPFSAGDVILEVET 71
           +   R +     H S  +   + F+MPAMSPTMEKGG+V WK+KVGEPFSAGDV+LEVET
Sbjct: 9   RQLNRLVYVRTLHQSGLVGKAQVFAMPAMSPTMEKGGVVEWKFKVGEPFSAGDVLLEVET 68

Query: 72  DKSQIDVEALDDGKLAKILKDEGSKDVDVGEPIAYIADVDDDLATIKLPQEANTANAKSI 131
           DK+QIDVEA DDGKLAKIL ++G+KD++VGEPIAY+A+ +DDLAT++LPQ  N  + K+ 
Sbjct: 69  DKAQIDVEAQDDGKLAKILVNDGAKDINVGEPIAYLAEPEDDLATLELPQSENKQSTKAP 128

Query: 132 EIK-----KPSADSTEATQQHLKKATVTPIKTVDGS------QANLEQTLLPSVSLLLAE 180
           E K     K SA   + ++   +K T     +          +A+  QTLLPSV LLL  
Sbjct: 129 EPKVEKDVKASAQKGQGSEPKAQKQTQVSSSSGSKDVSGVMVKADPAQTLLPSVQLLLHA 188

Query: 181 NNISKQKALKEIAPSGSNGRLLKGDVLAYLGKIPQDSVNKVTEFIKKNERLDLSNIKPIQ 240
           NNIS + AL  I  SG NGR+LKGDVL+YLGK+ Q+++ K+T++I+K E LDLSNI+   
Sbjct: 189 NNISNEDALNNIQASGPNGRILKGDVLSYLGKVSQEAIAKLTKYIQKGEVLDLSNIE--L 246

Query: 241 LKPKIAEQAQTKAADKPKITPVEFEEQLVFHAPASIPFDKLSESLNSFMKEAYQFSHGTP 300
            KP+ A +A      K    PV F EQL      ++ F++ S SL S++ EA   SHG P
Sbjct: 247 KKPEPASKAPESVVKK---EPVIFTEQLHLKVEPNVTFEQFSRSLKSYIDEARIISHGEP 303

Query: 301 LMDTNSKYFDPIFEDLVTLSPREPRFKFSYDLMQIPKANNMQDTYGQEDIFDLLTGSDAT 360
           + +  S Y+D +FE+L+T  PR+PRF  SYD+  IP      +   Q+DIFDLL G+  T
Sbjct: 304 VSNVQSDYYDALFEELITPEPRKPRFSVSYDI--IPLNARSLNAKQQDDIFDLLAGTKNT 361

Query: 361 ASSVRPVEKNLPEKNEYILALNVSVNNKKFNDAEAKAKRFLDY 403
            +S      NL + NE ++ L+V V++ KF+DA+ KA+RF+DY
Sbjct: 362 PASTE--SGNL-QSNEVLVNLSVQVSD-KFSDAKLKAERFVDY 400

>AGR323C [4634] [Homologous to ScYGR193C (PDX1) - SH]
           (1334333..1335541) [1209 bp, 402 aa]
          Length = 402

 Score =  328 bits (841), Expect = e-110,   Method: Compositional matrix adjust.
 Identities = 191/401 (47%), Positives = 253/401 (63%), Gaps = 24/401 (5%)

Query: 12  KSCTRYLTKCNYHASAKLLAVKTFSMPAMSPTMEKGGIVSWKYKVGEPFSAGDVILEVET 71
           K   R   +  +H S    A+  F MPAMSPTMEKGGIVSWK+KVGEPF AGDVILEVET
Sbjct: 8   KQSARISFRRPFHGSMAPRAITPFHMPAMSPTMEKGGIVSWKFKVGEPFQAGDVILEVET 67

Query: 72  DKSQIDVEALDDGKLAKILKDEGSKDVDVGEPIAYIADVDDDLATIKLPQEANTANAKSI 131
           DK+QIDVEA DDGKLA I+K +GSKDVDVGE +A++A+V+DDL+ +++P+   +   K  
Sbjct: 68  DKAQIDVEAQDDGKLAAIVKGDGSKDVDVGETVAFLAEVEDDLSALEIPKVVTSEAPKEA 127

Query: 132 EIKKPSADSTEATQQHLKKATVTPIKTVDGS---QANLEQTLLPSVSLLLAENNISKQKA 188
           E K     S + ++Q    A  TP KTV      QA+  QTLLPSV  LL  N ++ ++A
Sbjct: 128 EAKP----SPKVSEQAPAPARKTPSKTVSNGILQQADKNQTLLPSVITLLHANGVTVEEA 183

Query: 189 LKEIAPSGSNGRLLKGDVLAYLGKIPQDSVNKVTEFIKKNERLDLSNIKPIQLKPKIAEQ 248
              I  SG NGR+LKGDVL YLGKI  DSV KV+E+IKK E LDLSN   I+L+P    Q
Sbjct: 184 FANIKASGPNGRILKGDVLGYLGKISADSVVKVSEYIKKFEHLDLSN---IELRPA---Q 237

Query: 249 AQTKAADK---PKITPVEF---EEQLVFHAPASIPFDKLSESLNSFMKEAYQFSHGTPLM 302
               AADK   PK  P  +    E+L+   P  + F++ S +L  +++EA   +HG  L 
Sbjct: 238 PPKGAADKKAEPKPAPPAYRTLHERLILKVPEHVSFERFSNALKQYIREATYTAHGEALD 297

Query: 303 DTNSKYFDPIFEDLVTLSPREPRFKFSYDLMQIPKANNMQDTYGQEDIFDLLTGSDATAS 362
           +  S  FDP+FE+L+++ PREPRF+ SYD++  P          +EDIFD+L+G ++  S
Sbjct: 298 NPYSDRFDPLFEELLSVQPREPRFEVSYDVL--PLTVVPSSPKPKEDIFDILSG-NSVES 354

Query: 363 SVRPVEKNLPEKNEYILALNVSVNNKKFNDAEAKAKRFLDY 403
              P     P  +EY L L + V N KF+D+E +A RF+DY
Sbjct: 355 KPAPSSSE-PSAHEYALDLYLKVEN-KFSDSETRAARFIDY 393

>KLLA0E09768g 865604..866821 similar to sp|P16451 Saccharomyces
           cerevisiae YGR193c PDX1 pyruvate dehydrogenase complex
           protein X, start by similarity
          Length = 405

 Score =  327 bits (839), Expect = e-109,   Method: Compositional matrix adjust.
 Identities = 184/395 (46%), Positives = 255/395 (64%), Gaps = 13/395 (3%)

Query: 12  KSCTRYLTKCNYHASAKLLAVKTFSMPAMSPTMEKGGIVSWKYKVGEPFSAGDVILEVET 71
           ++C R L +C       +L  + F MPAMSPTME+GG+V WK+K G+ FSAGDV+LEVET
Sbjct: 9   RACLRQLHQCR-----TMLKAQAFGMPAMSPTMERGGVVDWKFKAGDTFSAGDVLLEVET 63

Query: 72  DKSQIDVEALDDGKLAKILKDEGSKDVDVGEPIAYIADVDDDLATIKLPQEANTA-NAKS 130
           DK+ IDVEA DDGKLAKILK+ G+KD+ VGEPIAYIADVDDDLAT++ P+       +K 
Sbjct: 64  DKATIDVEAQDDGKLAKILKENGAKDIPVGEPIAYIADVDDDLATLEFPKPVEAKKESKP 123

Query: 131 IEIKKPSADSTEATQQHLKKATVTPIKTVDGS-QANLEQTLLPSVSLLLAENNISKQKAL 189
           +E KK  A   E T +  K+ + +   + +GS QAN  QTL PSV  LL ENNIS   AL
Sbjct: 124 VETKKEEAKPVEKTDKK-KQTSASKTPSKNGSVQANASQTLFPSVLSLLEENNISTADAL 182

Query: 190 KEIAPSGSNGRLLKGDVLAYLGKIPQDSVNKVTEFIKKNERLDLSNIKPIQLKPKIAEQA 249
            +I  +G NGR+LKGDVLAYLGKI QDS+NKVTE+IK +E+LDL+NI+    +   A  A
Sbjct: 183 DKIKATGPNGRILKGDVLAYLGKISQDSLNKVTEYIKSHEKLDLTNIELRPARETAAAAA 242

Query: 250 QTKAADKPKITPVEFEEQLVFHAPASIPFDKLSESLNSFMKEAYQFSHGTPLMDTNSKYF 309
             +AA   K  P+   EQ+  H P ++ + +LS ++ S++KE    +H  PL +  S+ +
Sbjct: 243 AAQAAKPAKPLPLVLSEQITLHVPENVTYSQLSAAIASYVKECSFLAHDEPLTNDASELY 302

Query: 310 DPIFEDLVTLSPREPRFKFSYDLMQIPKANNMQDTYGQEDIFDLLTGSDAT--ASSVRPV 367
           DP+FE+L+   P +PRFK +Y+++ +      + +  Q DIFDLL+G+           V
Sbjct: 303 DPLFEELLVQEPTKPRFKVTYNIVDLEPTPRHRTSSPQPDIFDLLSGTTTQELQQEASAV 362

Query: 368 EKNLPEKNEYILALNVSVN-NKKFNDAEAKAKRFL 401
            K    ++EY  ALNVSV  ++   DA+ +A+ F+
Sbjct: 363 SKQQQTRHEY--ALNVSVAVDESLTDAKQRAENFV 395

>CAGL0G09361g 893614..894903 similar to sp|P16451 Saccharomyces
           cerevisiae YGR193c PDX1 pyruvate dehydrogenase complex
           protein X, hypothetical start
          Length = 429

 Score =  296 bits (759), Expect = 4e-97,   Method: Compositional matrix adjust.
 Identities = 175/428 (40%), Positives = 250/428 (58%), Gaps = 51/428 (11%)

Query: 5   ISKVSTLKSCTRYLTKCNYHASAKLLAVKTFSMPAMSPTMEKGGIVSWKYKVGEPFSAGD 64
           + K   L   +  L++C + ++   L V  F MPAMSPTMEKGGIVSWK+K  + F+AGD
Sbjct: 14  LCKRQCLTGVSVGLSRC-FSSTRMSLDVSPFLMPAMSPTMEKGGIVSWKFKENDSFNAGD 72

Query: 65  VILEVETDKSQIDVEALDDGKLAKILKDEGSKDVDVGEPIAYIADVDDDLATIKLPQEAN 124
           V+LEVETDK+QIDVEA DDGKLAKI++ +GSKDV VG+ IA+ AD +DDL+T+K+P+   
Sbjct: 73  VLLEVETDKAQIDVEAQDDGKLAKIIRGDGSKDVLVGDVIAFTADPEDDLSTLKIPEVTE 132

Query: 125 T----ANAKSIEIKKPSADSTEATQQHLKKATVTPIKTVDGS-----QANLEQTLLPSVS 175
           +    ++    E +KP+     A  Q  +   V+  KT   S      A+  QTLLPSV 
Sbjct: 133 SMKQVSSGSGKEDQKPAKSEEPAPLQRKEGKNVSESKTAKSSGDVLTTADASQTLLPSVV 192

Query: 176 LLLAENNISKQKALKEIAPSGSNGRLLKGDVLAYLGKIPQDSVNKVTEFIKKNERLDLSN 235
           + LA+N ISK+ AL  I  SG+NGR+LKGDVLAY GKI QDSV KV E++ +N++LDLSN
Sbjct: 193 MALADNGISKEDALANIKASGANGRILKGDVLAYAGKIQQDSVVKVAEYVNRNQKLDLSN 252

Query: 236 IKPIQLKPKIAE--------------------QAQTKAADKP-KITPVEFEEQLVFHAPA 274
           I+ I L+    E                      +T    KP ++ P+  +E+++     
Sbjct: 253 IERIVLEVNSEEGGDGQAQAQAQAQAQGQGQDSGKTGKLAKPAQVEPIRIQEEILLEVRR 312

Query: 275 SIPFDKLSESLNSFMKEAYQFSHGTPLMDTNSKYFDPIFEDLVTLSPREPRFKFSYDLMQ 334
            + F +   ++  ++ + YQ++H  PL +T S+ +D +FEDLVT+ PR  RF   Y L++
Sbjct: 313 GVDFTRFERAVREYIDDIYQYTHEQPLENTMSERYDSLFEDLVTVDPRSARFDVEYSLLE 372

Query: 335 IPKANNMQDTYGQEDIFDLLTGSDATASSVRPVEKNLPEKNEYILALNVSVNNKKFNDAE 394
                    T G EDIFDLL   +               K  Y L ++V+VN+ K++DA 
Sbjct: 373 T--------TDGSEDIFDLLGPGEVKEG-----------KQVYSLEVSVTVND-KYDDAV 412

Query: 395 AKAKRFLD 402
            KA RF++
Sbjct: 413 EKADRFME 420

>Scas_694.10
          Length = 479

 Score = 99.8 bits (247), Expect = 1e-22,   Method: Compositional matrix adjust.
 Identities = 79/220 (35%), Positives = 119/220 (54%), Gaps = 20/220 (9%)

Query: 1   MLSAISKVST--LKSCTRYLTKCNYHAS-AKLLAVKTFSMPAMSPTMEKGGIVSWKYKVG 57
           +L AI + S+  L+S  R   +    AS A   A     MP++SPTM  G +V+W  +VG
Sbjct: 4   LLRAIPRFSSTSLRSQLRTQLRLQLTASYASYPAHTIIGMPSLSPTMTHGNLVAWSKQVG 63

Query: 58  EPFSAGDVILEVETDKSQIDVEALDDGKLAKILKDEGSKDVDVGEPIAYIADVDDDLATI 117
           +  + GDV+ E+ETDK+Q+D E  DDG LAKIL  EG+KDV + +PIA   +  DD+A  
Sbjct: 64  DQLAPGDVLAELETDKAQMDFEFQDDGYLAKILVPEGTKDVPINKPIAVYVEDADDVAAF 123

Query: 118 KLPQEANTAN----AKSIEIK--KPSA-DSTEATQQHLKKA---TVTPIKTVDGSQANLE 167
           K  +  ++A+      + E+K  KP   +   A QQ  +K+     +P+   D +   + 
Sbjct: 124 KDFKIEDSADAAATTTTTEVKEEKPQQPEKINAQQQPTQKSKEQKSSPVTQEDTTGRIIA 183

Query: 168 QTLLPSVSLLLAENNISKQKALKEIAPSGSNGRLLKGDVL 207
             L   ++L   EN +    ALK    SG +GR++K DVL
Sbjct: 184 SPLAKKIAL---ENGV----ALKGFKGSGPHGRIVKDDVL 216

>YNL071W (LAT1) [4519] chr14 (491522..492970) Dihydrolipoamide
           S-acetyltransferase component (E2) of pyruvate
           dehydrogenase complex [1449 bp, 482 aa]
          Length = 482

 Score = 97.1 bits (240), Expect = 8e-22,   Method: Compositional matrix adjust.
 Identities = 72/210 (34%), Positives = 107/210 (50%), Gaps = 12/210 (5%)

Query: 5   ISKVSTLKSCTRYLTKCNYHASAKLLAVKTFSMPAMSPTMEKGGIVSWKYKVGEPFSAGD 64
           IS+ S L    R   +C  +AS     +    MPA+SPTM +G + +W  K G+  S G+
Sbjct: 11  ISRSSVLTRSLRLQLRC--YASYPEHTI--IGMPALSPTMTQGNLAAWTKKEGDQLSPGE 66

Query: 65  VILEVETDKSQIDVEALDDGKLAKILKDEGSKDVDVGEPIA-YIADVDDDLATIKLPQEA 123
           VI E+ETDK+Q+D E  +DG LAKIL  EG+KD+ V +PIA Y+ D  D  A      E 
Sbjct: 67  VIAEIETDKAQMDFEFQEDGYLAKILVPEGTKDIPVNKPIAVYVEDKADVPAFKDFKLED 126

Query: 124 NTANAKSIEIKKPSADSTEATQQHLKKATVTPIKTVDGSQANLEQTLL---PSVSLLLAE 180
           + +++K+    +P+    E  Q+   + T T       S     Q  +   P    +  E
Sbjct: 127 SGSDSKTSTKAQPAEPQAEKKQEAPAEETKTSAPEAKKSDVAAPQGRIFASPLAKTIALE 186

Query: 181 NNISKQKALKEIAPSGSNGRLLKGDVLAYL 210
             IS    LK++  +G  GR+ K D+ +YL
Sbjct: 187 KGIS----LKDVHGTGPRGRITKADIESYL 212

>AER364W [2865] [Homologous to ScYNL071W (LAT1) - SH]
           complement(1312487..1313848) [1362 bp, 453 aa]
          Length = 453

 Score = 96.3 bits (238), Expect = 1e-21,   Method: Compositional matrix adjust.
 Identities = 86/292 (29%), Positives = 142/292 (48%), Gaps = 29/292 (9%)

Query: 15  TRYLTKCNYHASAKLLAVKTFS---------MPAMSPTMEKGGIVSWKYKVGEPFSAGDV 65
           TR   K    AS   + ++T++         MPA+SPTM +G +  W  K G+  S G+V
Sbjct: 5   TRIAPKVRTLASVARMQLRTYASYPPHTIIGMPALSPTMTQGNLAVWTKKEGDKLSPGEV 64

Query: 66  ILEVETDKSQIDVEALDDGKLAKILKDEGSKDVDVGEPIAYIADVDDDLATIK-LPQEAN 124
           + EVETDK+Q+D E  ++G LAKIL  EG+KDV V +PIA   + + D+A  K    E +
Sbjct: 65  LAEVETDKAQMDFEFQEEGFLAKILVPEGAKDVPVNKPIAVYVEEEGDVAAFKDFKVEES 124

Query: 125 TANAKSIEIKKPSADSTEATQQHLKKATVTPIKTVDGSQANLEQTLLPSVSLLLAENNIS 184
            A +K    K+ +A +  A                 GS A+  + +   ++  +A   + 
Sbjct: 125 AAESKDAPAKEEAAPAKAAPAAAAPAKAAK---KSTGSAASGGRIMASPLAKTIA---LE 178

Query: 185 KQKALKEIAPSGSNGRLLKGDVLAYLGKIPQDSVNKVTEFIKKNERLDLSNIKPIQLKPK 244
           K  +LKE+  +G NGR+ K DV  YL K P+ + +         E + +SN++ + +  +
Sbjct: 179 KGISLKEVTGTGPNGRITKEDVEKYLAKAPKKTESAAAPAAATYEDVPISNMRRV-IGSR 237

Query: 245 IAEQAQTKAADKPKITPVEFEEQLVFHAPASIPFDKLSESLNSFMKEAYQFS 296
           + +  Q+     P  + +   + L           KL +SLN+  K+ Y+ S
Sbjct: 238 LLQSCQS-IPSYPISSDISVAKLL-----------KLRQSLNAAGKDQYKLS 277

>Sklu_2037.4 YNL071W, Contig c2037 4059-5474 reverse complement
          Length = 471

 Score = 88.6 bits (218), Expect = 6e-19,   Method: Compositional matrix adjust.
 Identities = 64/186 (34%), Positives = 99/186 (53%), Gaps = 9/186 (4%)

Query: 35  FSMPAMSPTMEKGGIVSWKYKVGEPFSAGDVILEVETDKSQIDVEALDDGKLAKILKDEG 94
             MPA+SPTM +G +  W  KVG+  S G+VI E+ETDK+Q+D E  ++G LAKIL  EG
Sbjct: 35  IGMPALSPTMTQGNLAVWSKKVGDSLSPGEVIAEIETDKAQMDFEFQEEGFLAKILVPEG 94

Query: 95  SKDVDVGEPIAYIADVDDDLATIKLPQEANTANAKSIEIKKPSADSTEATQQHLKKATVT 154
           +KD+ V +PIA   + + D+   K     ++A+    E  K      E  Q   K A+ T
Sbjct: 95  TKDIPVNKPIAVYVEEEGDVEAFKDFTVDDSASPAKKEAPK-EEAPKEEEQAATKPASST 153

Query: 155 PIK-----TVDGSQANLEQTLLPSVSLLLAENNISKQKALKEIAPSGSNGRLLKGDVLAY 209
           P +     +   S A+  +     ++  +A   + K  ALK +  +G +GR+ K D+  +
Sbjct: 154 PSQNKSSSSSSSSSAHAGRIFASPLAKTIA---LEKGIALKNVTGTGPHGRITKADIETF 210

Query: 210 LGKIPQ 215
           L K P+
Sbjct: 211 LAKGPE 216

>CAGL0J10186g complement(995223..996632) highly similar to sp|P12695
           Saccharomyces cerevisiae YNL071w LAT1 dihydrolipoamide
           S-acetyltransferase, start by similarity
          Length = 469

 Score = 86.3 bits (212), Expect = 3e-18,   Method: Compositional matrix adjust.
 Identities = 77/254 (30%), Positives = 117/254 (46%), Gaps = 23/254 (9%)

Query: 1   MLSAISKVSTLKSCTRYLTKCNYHASAKLLAVKTFSMPAMSPTMEKGGIVSWKYKVGEPF 60
           +L A+ +VS      R +T       A         MPA+SPTM +G +  W  K G+  
Sbjct: 4   LLRALPQVSRTALRGRLVTPMTLRLYASFPPHTVIGMPALSPTMSQGNLAVWSKKEGDSL 63

Query: 61  SAGDVILEVETDKSQIDVEALDDGKLAKILKDEGSKDVDVGEPIAYIADVDDDLATIK-- 118
           + GDV+ E+ETDK+Q+D E  D+G LAKIL   G+KDV V  PIA   + + D+A  K  
Sbjct: 64  APGDVLAEIETDKAQMDFEFQDEGYLAKILVPAGTKDVAVSRPIAVYVEDEADVAAFKDF 123

Query: 119 LPQEANTANAKS-------IEIKKPSADSTEATQQHLKKATVTPIKTVDGSQANLEQTLL 171
             ++A  + + S        E  K      E +++   K+  TP     G +  +   L 
Sbjct: 124 TVEDAGGSQSSSAPAAEEQKEEPKKEEVKEEKSEKKAAKSNSTPSSVASGDRI-IASPLA 182

Query: 172 PSVSLLLAENNISKQKALKEIAPSGSNGRLLKGDVLAYLGKIPQD------SVNKVTEFI 225
            +++L        K  ALK +  +G  GR+ K DV  YL   P+       S    T   
Sbjct: 183 KTIAL-------EKGIALKSVKGTGPRGRITKADVEKYLESAPKSTSTAAPSATPSTTGG 235

Query: 226 KKNERLDLSNIKPI 239
              E L+++N++ I
Sbjct: 236 ASYEDLEITNMRQI 249

>KLLA0F04741g complement(463107..464528) similar to sp|P12695
           Saccharomyces cerevisiae YNL071w LAT1 dihydrolipoamide
           S-acetyltransferase, start by similarity
          Length = 473

 Score = 85.1 bits (209), Expect = 8e-18,   Method: Compositional matrix adjust.
 Identities = 66/223 (29%), Positives = 104/223 (46%), Gaps = 32/223 (14%)

Query: 15  TRYLTKCNYHASAKLLAVKTFS---------MPAMSPTMEKGGIVSWKYKVGEPFSAGDV 65
           +R   + +  A A  L ++T++         MPA+SPTM +GG+  W   VG+    GDV
Sbjct: 6   SRVAPRMSVLACAARLQLRTYASYPPYTIIGMPALSPTMVQGGLTEWSKNVGDRLEPGDV 65

Query: 66  ILEVETDKSQIDVEALDDGKLAKILKDEGSKDVDVGEPIAYIADVDDDLATIKLPQEAN- 124
           + EVETDK+Q+D E  ++G LAKIL   G+KD+ V +P+A   + + D     +P  AN 
Sbjct: 66  LAEVETDKAQMDFEFQEEGYLAKILVPAGTKDIPVNKPLAVYVEEESD-----VPAFANF 120

Query: 125 ----------TANAKSIEIKKPSADSTEATQQHLKKATVTPIKTVDGSQANLEQTLL--- 171
                        A     K+P+ + ++   +   K    P        +    T +   
Sbjct: 121 TAADAESATAAKEAAKNGAKQPAKEESKEESKEGAKPASKPAAKKSSGSSASSGTRIFAS 180

Query: 172 PSVSLLLAENNISKQKALKEIAPSGSNGRLLKGDVLAYLGKIP 214
           P    +  E+ +S    LKE+  +G  GR+ K DV A+L   P
Sbjct: 181 PLAKSIALEHGVS----LKEVEGTGPRGRITKDDVEAFLASAP 219

>Kwal_23.4725
          Length = 472

 Score = 84.0 bits (206), Expect = 2e-17,   Method: Compositional matrix adjust.
 Identities = 63/208 (30%), Positives = 94/208 (45%), Gaps = 1/208 (0%)

Query: 5   ISKVSTLKSCTRYLTKCNYHASAKLLAVKTFSMPAMSPTMEKGGIVSWKYKVGEPFSAGD 64
           +  V  +++      +    A A         MPA+SPTM +G +  W  K G+    G+
Sbjct: 5   VRSVPQIRNAVLRSARLQLRAYASYPPHTVIGMPALSPTMTQGNLAVWLKKAGDKLEPGE 64

Query: 65  VILEVETDKSQIDVEALDDGKLAKILKDEGSKDVDVGEPIAYIADVDDDLATIKLPQEAN 124
            I E+ETDK+Q++ E  +DG LAKIL  EGSKD+ VG+PIA   + + D+          
Sbjct: 65  AIAEIETDKAQMEFEFQEDGYLAKILVPEGSKDLPVGKPIAVYVEEEGDVGAFADFTAEE 124

Query: 125 TANAKSIEIKKPSADSTEATQQHLKKATVTPIKTVDGSQANLEQTLLPSVSLLLAENNIS 184
            A  K     +   D  +  Q   K+ +  P K   G+ +          S L     + 
Sbjct: 125 AAPEKPAAAPEKKQDEPQ-QQAAQKEESGKPAKKSSGATSAAPSGDRIIASPLAKTIALD 183

Query: 185 KQKALKEIAPSGSNGRLLKGDVLAYLGK 212
           K  +LK +  +G  GR+ K DV  YL K
Sbjct: 184 KGISLKAVTGTGPRGRITKADVEEYLSK 211

>Kwal_56.23934
          Length = 442

 Score = 36.2 bits (82), Expect = 0.040,   Method: Compositional matrix adjust.
 Identities = 28/94 (29%), Positives = 46/94 (48%), Gaps = 11/94 (11%)

Query: 30  LAVKTFSMPAMSPTMEKGGIVSWKYKVGEPFSAGDVILEVETDKSQIDVEALDDGKLAKI 89
           +A  T  +P M+ ++ +G +  +  +VGE     +++  +ETDK  ++V A   GK+ K 
Sbjct: 53  MASTTVKVPPMAESLTEGSLKEYTKQVGEFIKQDELLATIETDKIDVEVNAPTSGKVTK- 111

Query: 90  LKDEGSKDVDVGEPIAYIADVDDDLATIKLPQEA 123
           L  +    V VG          DDLA I+   EA
Sbjct: 112 LNFQPEDTVTVG----------DDLAEIEAGAEA 135

>AGL200W [4112] [Homologous to ScYDR148C (KGD2) - SH]
           complement(321080..322390) [1311 bp, 436 aa]
          Length = 436

 Score = 33.9 bits (76), Expect = 0.25,   Method: Compositional matrix adjust.
 Identities = 25/87 (28%), Positives = 44/87 (50%), Gaps = 3/87 (3%)

Query: 24  HASAKLLAVKTFSMPAMSPTMEKGGIVSWKYKVGEPFSAGDVILEVETDKSQIDVEALDD 83
           H      A  +  +P M+ ++ +G +  +  +VGE     +++  +ETDK  I+V A   
Sbjct: 52  HLCGLRYASTSVQVPPMAESLTEGSLKEFTKQVGEYIEQDELLATIETDKIDIEVNAPVS 111

Query: 84  GKLAKI-LKDEGSKDVDVGEPIAYIAD 109
           G + K+  K E +  V VGE +A I +
Sbjct: 112 GTVTKLNFKPEDT--VTVGEELAQIEE 136

>Sklu_2172.1 YDR148C, Contig c2172 307-1605
          Length = 432

 Score = 33.9 bits (76), Expect = 0.26,   Method: Compositional matrix adjust.
 Identities = 26/106 (24%), Positives = 53/106 (50%), Gaps = 4/106 (3%)

Query: 4   AISKVSTLKS--CTRYLTKCNYHASAKLLAVKTFSMPAMSPTMEKGGIVSWKYKVGEPFS 61
           ++S++S + S   T Y   C    +A+  +     +P M+ ++ +G +  +  +VGE   
Sbjct: 24  SVSRLSPIASPFVTSYKVSCRRIIAARYQST-VVKVPPMAESLTEGSLKEFTKQVGEFIE 82

Query: 62  AGDVILEVETDKSQIDVEALDDGKLAKILKDEGSKDVDVGEPIAYI 107
             +++  +ETDK  ++V +   G + K L  +    V VG+ +A I
Sbjct: 83  QDELLATIETDKIDVEVNSPVSGTITK-LAFQPEDTVTVGDELAQI 127

>KLLA0D16522g complement(1394850..1396256) similar to sp|P19262
           Saccharomyces cerevisiae YDR148c KGD2 2-oxoglutarate
           dehydrogenase complex E2 component, start by similarity
          Length = 468

 Score = 33.5 bits (75), Expect = 0.27,   Method: Compositional matrix adjust.
 Identities = 25/92 (27%), Positives = 48/92 (52%), Gaps = 5/92 (5%)

Query: 20  KCN-YHASAKLLAVK---TFSMPAMSPTMEKGGIVSWKYKVGEPFSAGDVILEVETDKSQ 75
           +C+    + + +AV+   +  +P M+ ++ +G +  +  KVG+     +++  +ETDK  
Sbjct: 63  RCSPSQLNTRFMAVRHATSVPVPPMAESLTEGSLKEYTKKVGDFIEKDELLATIETDKID 122

Query: 76  IDVEALDDGKLAKILKDEGSKDVDVGEPIAYI 107
           ++V +   G +AK L       V VGE IA I
Sbjct: 123 VEVISPISGTIAK-LNFSPDDTVTVGEEIAQI 153

>CAGL0E01287g 120567..121808 highly similar to sp|P19262
           Saccharomyces cerevisiae YDR148c oxoglutarate
           dehydrogenase complex E2 component, hypothetical start
          Length = 413

 Score = 32.7 bits (73), Expect = 0.53,   Method: Compositional matrix adjust.
 Identities = 27/106 (25%), Positives = 52/106 (49%), Gaps = 8/106 (7%)

Query: 4   AISKVSTLKSCTRYLTKCNYHASAKLLAVKTFSMPAMSPTMEKGGIVSWKYKVGEPFSAG 63
           A  K+   K    YL++  + ++       +  +P+M+ ++ +G +  +  KVGE     
Sbjct: 19  AAWKLPVQKVVPAYLSQYRWAST-------SVKVPSMAESLTEGSLKEFTKKVGEFVEQD 71

Query: 64  DVILEVETDKSQIDVEALDDGKLAKILKDEGSKDVDVGEPIAYIAD 109
           +++  +ETDK  I+V +   G + K L  E    V VG+ +A I +
Sbjct: 72  ELLATIETDKIDIEVNSPVSGTVTK-LNFEPEDTVTVGDELAQIEE 116

>Scas_693.29
          Length = 442

 Score = 32.0 bits (71), Expect = 0.81,   Method: Compositional matrix adjust.
 Identities = 24/84 (28%), Positives = 45/84 (53%), Gaps = 3/84 (3%)

Query: 27  AKLLAVKTFSMPAMSPTMEKGGIVSWKYKVGEPFSAGDVILEVETDKSQIDVEALDDGKL 86
           A+  A  +  +P M+ ++ +G +  +   VG+     +++  +ETDK  I+V A   G +
Sbjct: 58  AQRWASTSVKVPQMAESLTEGSLKEFTKAVGDFIEQDELLATIETDKIDIEVIAPVSGTV 117

Query: 87  AKI-LKDEGSKDVDVGEPIAYIAD 109
           +K+  K E +  V VGE +A I +
Sbjct: 118 SKLNFKPEDT--VTVGEELATIEE 139

>KLLA0E08107g 730334..735823 highly similar to sp|P32528 Saccharomyces
            cerevisiae YBR208c DUR1_2 urea amidolyase, start by
            similarity
          Length = 1829

 Score = 31.6 bits (70), Expect = 1.3,   Method: Compositional matrix adjust.
 Identities = 21/58 (36%), Positives = 32/58 (55%), Gaps = 3/58 (5%)

Query: 52   WK--YKVGEPFSAGDVILEVETDKSQIDVEALDDGKLAKILKDEGSKDVDVGEPIAYI 107
            WK    VG+   AGD ++ +E  K+++ V A   GK+ KIL   G   V+ G+ +A I
Sbjct: 1772 WKPVAAVGDHVEAGDGVIIIEAMKTEMVVGATKSGKVYKILHKNGDM-VEAGDLVAVI 1828

>YDR148C (KGD2) [993] chr4 complement(753669..755060) 2-oxoglutarate
           dehydrogenase (alpha-ketoglutarate dehydrogenase)
           complex KE2 component dihydrolipoamide
           S-succinyltransferase [1392 bp, 463 aa]
          Length = 463

 Score = 30.0 bits (66), Expect = 4.1,   Method: Compositional matrix adjust.
 Identities = 20/75 (26%), Positives = 40/75 (53%), Gaps = 3/75 (4%)

Query: 34  TFSMPAMSPTMEKGGIVSWKYKVGEPFSAGDVILEVETDKSQIDVEALDDGKLAKI-LKD 92
           +  +P M+ ++ +G +  +   VG+     +++  +ETDK  I+V +   G + K+  K 
Sbjct: 75  SIEVPPMAESLTEGSLKEYTKNVGDFIKEDELLATIETDKIDIEVNSPVSGTVTKLNFKP 134

Query: 93  EGSKDVDVGEPIAYI 107
           E +  V VGE +A +
Sbjct: 135 EDT--VTVGEELAQV 147

>YBR208C (DUR1,2) [390] chr2 complement(636660..642167) Urea
            amidolyase, contains urea carboxylase and allophanate
            hydrolase activities fused together in a single
            polypeptide [5508 bp, 1835 aa]
          Length = 1835

 Score = 29.6 bits (65), Expect = 6.0,   Method: Compositional matrix adjust.
 Identities = 20/58 (34%), Positives = 30/58 (51%), Gaps = 3/58 (5%)

Query: 52   WK--YKVGEPFSAGDVILEVETDKSQIDVEALDDGKLAKILKDEGSKDVDVGEPIAYI 107
            WK    VG+   AG  +L +E  K+++ + A   GK+ KI    G   VD G+ +A I
Sbjct: 1775 WKSIASVGDVIEAGQGLLIIEAMKAEMIISAPKSGKIIKICHGNGDM-VDSGDIVAVI 1831

>CAGL0J11528g complement(1117845..1119518) similar to sp|P53870
           Saccharomyces cerevisiae YNL193w, hypothetical start
          Length = 557

 Score = 29.3 bits (64), Expect = 6.4,   Method: Compositional matrix adjust.
 Identities = 16/52 (30%), Positives = 26/52 (50%)

Query: 235 NIKPIQLKPKIAEQAQTKAADKPKITPVEFEEQLVFHAPASIPFDKLSESLN 286
           +IK + +K  + E   +   D  +ITP   EEQ  F +  S  +  +S+ LN
Sbjct: 373 DIKILSVKADLIETILSTLDDGQQITPANVEEQWFFSSMLSKIYQTISKQLN 424

  Database: blastdb
    Posted date:  Apr 3, 2006  3:33 PM
  Number of letters in database: 16,596,109
  Number of sequences in database:  34,618
  
Lambda     K      H
   0.311    0.129    0.351 

Gapped
Lambda     K      H
   0.267   0.0410    0.140 

Matrix: BLOSUM62
Gap Penalties: Existence: 11, Extension: 1
Number of Sequences: 34618
Number of Hits to DB: 13,093,317
Number of extensions: 604449
Number of successful extensions: 1953
Number of sequences better than 10.0: 85
Number of HSP's gapped: 1923
Number of HSP's successfully gapped: 85
Length of query: 403
Length of database: 16,596,109
Length adjustment: 104
Effective length of query: 299
Effective length of database: 12,995,837
Effective search space: 3885755263
Effective search space used: 3885755263
Neighboring words threshold: 11
Window for multiple hits: 40
X1: 16 ( 7.2 bits)
X2: 38 (14.6 bits)
X3: 64 (24.7 bits)
S1: 42 (21.8 bits)
S2: 63 (28.9 bits)