Hit NameLength (aa)HSP LengthHSP ScoreHSP Significance
YGR099W (TEL2)68867634800.0
Scas_716.2668668014830.0
Kwal_55.2052969169210511e-133
KLLA0D15158g66667810021e-126
AAR090W6596669391e-117
CAGL0G07755g6856808831e-109
Scas_305.137778702.4
Scas_719.9*89762659.4
BLASTP 2.2.26 [Sep-21-2011]

Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, 
Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), 
"Gapped BLAST and PSI-BLAST: a new generation of protein database search
programs",  Nucleic Acids Res. 25:3389-3402.

Reference for compositional score matrix adjustment: Altschul, Stephen F., 
John C. Wootton, E. Michael Gertz, Richa Agarwala, Aleksandr Morgulis,
Alejandro A. Schaffer, and Yi-Kuo Yu (2005) "Protein database searches
using compositionally adjusted substitution matrices", FEBS J. 272:5101-5109.

Query= YGR099W
         (676 letters)

Database: blastdb 
           34,618 sequences; 16,596,109 total letters

Searching..................................................done

                                                                 Score    E
Sequences producing significant alignments:                      (bits) Value

YGR099W (TEL2) [2059] chr7 (687901..689967) Protein involved in ...  1345   0.0  
Scas_716.26                                                           575   0.0  
Kwal_55.20529                                                         409   e-133
KLLA0D15158g 1281895..1283895 similar to sp|P53038 Saccharomyces...   390   e-126
AAR090W [276] [Homologous to ScYGR099W (TEL2) - SH] complement(5...   366   e-117
CAGL0G07755g 736112..738169 similar to sp|P53038 Saccharomyces c...   344   e-109
Scas_305.1                                                             32   2.4  
Scas_719.9*                                                            30   9.4  

>YGR099W (TEL2) [2059] chr7 (687901..689967) Protein involved in
           controlling telomere length and telomere position effect
           [2067 bp, 688 aa]
          Length = 688

 Score = 1345 bits (3480), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 661/676 (97%), Positives = 661/676 (97%)

Query: 1   MVLETLKQGLDSSQIHEALIQLDSYPREPVDLDASMVLIKFVIPVYPSLPERSKVILRRL 60
           MVLETLKQGLDSSQIHEALIQLDSYPREPVDLDASMVLIKFVIPVYPSLPERSKVILRRL
Sbjct: 1   MVLETLKQGLDSSQIHEALIQLDSYPREPVDLDASMVLIKFVIPVYPSLPERSKVILRRL 60

Query: 61  ASKSFTFLCQIVTFSRTISGRDGLQEIRIYQEILEDIISFEPGCLTFYLKASTTSKADRD 120
           ASKSFTFLCQIVTFSRTISGRDGLQEIRIYQEILEDIISFEPGCLTFYLKASTTSKADRD
Sbjct: 61  ASKSFTFLCQIVTFSRTISGRDGLQEIRIYQEILEDIISFEPGCLTFYLKASTTSKADRD 120

Query: 121 SIKALFFGSKLFNVLANRIDMAKYLGYLRLQWKFLLESNETDPPGFLGEWLVSSFLLNPV 180
           SIKALFFGSKLFNVLANRIDMAKYLGYLRLQWKFLLESNETDPPGFLGEWLVSSFLLNPV
Sbjct: 121 SIKALFFGSKLFNVLANRIDMAKYLGYLRLQWKFLLESNETDPPGFLGEWLVSSFLLNPV 180

Query: 181 LAADMLLGELFLLKESYFFSFQKIISASSLIDQKRLIAKFLLPYIQVIVTLENLNDVRKI 240
           LAADMLLGELFLLKESYFFSFQKIISASSLIDQKRLIAKFLLPYIQVIVTLENLNDVRKI
Sbjct: 181 LAADMLLGELFLLKESYFFSFQKIISASSLIDQKRLIAKFLLPYIQVIVTLENLNDVRKI 240

Query: 241 LRRFDLDKIISLSVLFEIQSLPLKEVIVRLMSNHSSTKFVSALVSKFADFTDEEVDTKTC 300
           LRRFDLDKIISLSVLFEIQSLPLKEVIVRLMSNHSSTKFVSALVSKFADFTDEEVDTKTC
Sbjct: 241 LRRFDLDKIISLSVLFEIQSLPLKEVIVRLMSNHSSTKFVSALVSKFADFTDEEVDTKTC 300

Query: 301 ELLVLFAVHNLNHSQREEIAHDERFLNGVTKHLGSNEREARERAMFIAKLLSGGHLKYES 360
           ELLVLFAVHNLNHSQREEIAHDERFLNGVTKHLGSNEREARERAMFIAKLLSGGHLKYES
Sbjct: 301 ELLVLFAVHNLNHSQREEIAHDERFLNGVTKHLGSNEREARERAMFIAKLLSGGHLKYES 360

Query: 361 DFKINIPNVKFESNSDDKIIDFQSLKNPSICNTQTDVGKDKITEVSGHVQSLTLXXXXXX 420
           DFKINIPNVKFESNSDDKIIDFQSLKNPSICNTQTDVGKDKITEVSGHVQSLTL      
Sbjct: 361 DFKINIPNVKFESNSDDKIIDFQSLKNPSICNTQTDVGKDKITEVSGHVQSLTLDCSDSD 420

Query: 421 XXXXXXXXXIVKRIVFLKDLMKEYEKTGESRKAPLIPLLKQTVKLIRQKADFQLEVGYYA 480
                    IVKRIVFLKDLMKEYEKTGESRKAPLIPLLKQTVKLIRQKADFQLEVGYYA
Sbjct: 421 DEDENDEREIVKRIVFLKDLMKEYEKTGESRKAPLIPLLKQTVKLIRQKADFQLEVGYYA 480

Query: 481 QGILSSIVCLNNEFDEPLFEQWRINALTSILVVLPEKVNGAINILFNSELSLQQRMSLLS 540
           QGILSSIVCLNNEFDEPLFEQWRINALTSILVVLPEKVNGAINILFNSELSLQQRMSLLS
Sbjct: 481 QGILSSIVCLNNEFDEPLFEQWRINALTSILVVLPEKVNGAINILFNSELSLQQRMSLLS 540

Query: 541 ALGLSARELRGLDDPTIVKPKFDFPTNRLPWDDQSHHNSRLVEVQESTSMIKKTKTVWKS 600
           ALGLSARELRGLDDPTIVKPKFDFPTNRLPWDDQSHHNSRLVEVQESTSMIKKTKTVWKS
Sbjct: 541 ALGLSARELRGLDDPTIVKPKFDFPTNRLPWDDQSHHNSRLVEVQESTSMIKKTKTVWKS 600

Query: 601 RKLGKDREKGTQNRFRKYAGLFFYPLAHGWLNGIDVGTYNQLFKSHYLTTLRIIYSCANP 660
           RKLGKDREKGTQNRFRKYAGLFFYPLAHGWLNGIDVGTYNQLFKSHYLTTLRIIYSCANP
Sbjct: 601 RKLGKDREKGTQNRFRKYAGLFFYPLAHGWLNGIDVGTYNQLFKSHYLTTLRIIYSCANP 660

Query: 661 VHDFESMTELMNHIIS 676
           VHDFESMTELMNHIIS
Sbjct: 661 VHDFESMTELMNHIIS 676

>Scas_716.26
          Length = 686

 Score =  575 bits (1483), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 310/680 (45%), Positives = 435/680 (63%), Gaps = 21/680 (3%)

Query: 4   ETLKQGLDSSQIHEALIQLDSYPREPVDLDASMVLIKFVIPVYPSLPERSKVILRRLASK 63
           + LK   D+  I + L QL +    P  L+  +++I+ VIP+YPSL + ++ + + L S+
Sbjct: 5   KVLKDHPDAQVIEDVLQQLSNETDAPT-LEVCLLIIQHVIPIYPSLSKHTRDLTQSLVSR 63

Query: 64  SFTFLCQIVTFSRTISGRDGLQEIRIYQEILEDIISFEPGCLTFYLKASTTSKADRDSIK 123
           SFTF+ Q+V ++ T+       E ++Y+  ++++++ +P CL  YL   ++S+ +++ +K
Sbjct: 64  SFTFMSQLVNYASTVMKDKP--EGKLYRNFIKEVLATQPECLHNYLIHMSSSRMEKNYLK 121

Query: 124 ALFFGSKLFNVLANRIDMAKYLGYLRLQWKFLLESN---ETDP-PGFLGEWLVSSFLLNP 179
            LFFGS++FN L N ID+ +YL  LR QWK +L+ +   ET     FLGE LVSS +LNP
Sbjct: 122 TLFFGSRVFNSLGNDIDIIEYLELLRSQWKSVLDDDILIETLVLDSFLGELLVSSLILNP 181

Query: 180 VLAADMLLGELFLLKESYFFSFQKIISASSLIDQKRLIAKFLLPYIQVIVTLENLNDVRK 239
             A D+L G+LFL  E+Y     KII  +S +DQ+RL+ KFLLPY++ +    N      
Sbjct: 182 TYAMDLLFGDLFLSTETYATILNKIILNASNLDQQRLVNKFLLPYLEPLTNTSNFKSTNH 241

Query: 240 ILRRFDLDKIISLSVLFEIQSLPLKEVIVRLMSNHSSTKFVSALVSKFADFTDEEVDTKT 299
           ILR   L K I+L V+  ++S  L+E+I+R MS  +S+  + +L+SKF    DE  D   
Sbjct: 242 ILRELPLHKCITLDVILRMKSHILQEIIIRQMSEFASS-IIPSLISKFGTL-DESQDEDI 299

Query: 300 CELLVLFAVHNLNHSQREEIAHDERFLNGVTKHLGSNEREARERAMFIAKLLSGGHLKYE 359
           C + V+    NLN  QRE++AHD  FL+ +TK L     E RER MFIAKL S   L+Y+
Sbjct: 300 CIIFVMVLKFNLNEEQREQLAHDGNFLDAITKRLSHKNSEFRERTMFIAKLASNNELEYD 359

Query: 360 SDFKINIPNVKFESNSDDKIIDFQSLKNPSICN-TQTDVGKDKITEVSGHVQSLTLXXXX 418
           SDF I +P++   +N   +I       +P++   + + V   K++ +S     + L    
Sbjct: 360 SDFVIKLPDLDITNNEKIEI-------DPALFKRSSSGVSASKVSRISSGFHEMVLQEDS 412

Query: 419 XXXXXXXXXXXIVKRIVFLKDLMKEYEKTGESRKAPLIPLLKQTVKLIRQKADFQLEVGY 478
                      I+ RIVFLKDL+KE+EK G    A  IPLLK+T+ L+RQK  F LEV Y
Sbjct: 413 DDEVQDDEQE-IINRIVFLKDLVKEFEKNGNDGPAESIPLLKKTITLVRQKEHFPLEVDY 471

Query: 479 YAQGILSSIVCLNNEFDEPLFEQWRINALTSILVVLPEKVNGAINILFNSELSLQQRMSL 538
           Y  G+L++I  LNN  +E  FE+WRINAL S+LVV+PEKV   I I  +SELSLQQRMS+
Sbjct: 472 YFSGLLTNIAYLNNNLEESNFEEWRINALVSLLVVVPEKVQELIKIFLSSELSLQQRMSI 531

Query: 539 LSALGLSARELRGLDDPTIVKPKFDFPTNRLPWDDQS---HHNSRLVEVQESTSMIKKTK 595
           LS+LGLSARELRG+DD  I KPK DFPT+RLPWD ++   H   R+ E+  S S + +TK
Sbjct: 532 LSSLGLSARELRGMDDKVITKPKLDFPTSRLPWDKKTKEQHDKKRITELGNSNSTLIETK 591

Query: 596 TVWKSRKLGKDREKGTQNRFRKYAGLFFYPLAHGWLNGIDVGTYNQLFKSHYLTTLRIIY 655
           T WKS+KL    ++   NRFR+YA LFFYPLAH WLNGIDVGT++ LFK+H+LTTLRIIY
Sbjct: 592 TTWKSKKLTLAAKEDKPNRFREYATLFFYPLAHIWLNGIDVGTFDDLFKNHFLTTLRIIY 651

Query: 656 SCANPVHDFESMTELMNHII 675
            CA+PVHD+ESMT+LM  II
Sbjct: 652 MCAHPVHDYESMTQLMEQII 671

>Kwal_55.20529
          Length = 691

 Score =  409 bits (1051), Expect = e-133,   Method: Compositional matrix adjust.
 Identities = 257/692 (37%), Positives = 390/692 (56%), Gaps = 52/692 (7%)

Query: 1   MVLETLKQGLDSSQIHEALIQLDSYPREPVDLDASMVLIKFVIPVYPSLPERSKVILRRL 60
           +  ETLK    +  I E L  + S  +  + ++++ VL ++VIPVY SLP  SK++L  +
Sbjct: 12  LATETLKTQPSAEVIQECLSVIQS--QASLTVESAAVLARYVIPVYTSLPSASKMLLFTI 69

Query: 61  ASKSFTFLCQIVTFSRTISGRDGLQEIRIYQEILEDIISFEPGCLTFYLKASTTSKADRD 120
             +SF  L  ++ F + +       E +IY+  L + +S   GC+  Y++ +     +  
Sbjct: 70  FEESFLLLGHVLNFIKLLQKSS---EAKIYKRFLIEGLSHNHGCIYKYIRGAE-HITELQ 125

Query: 121 SIKALFFGSKLFNVLANRIDMAKYLGYLRLQWKFLLESNETDPPGFLGEWLVSSFLLNPV 180
            +++ FFGSK+ N + + ID+  YL  +R Q+KF+ +           ++L +   L+ +
Sbjct: 126 MLRSAFFGSKILNSVGDEIDIENYLDIVRAQFKFIFDQTPQFEDKVYADFLCAFISLHSL 185

Query: 181 LAADMLLGELFLLKESYFFSFQKIISASSLIDQKRLIAKFLLPYIQVIVTLENLNDVRKI 240
           LA +++ G L L  E +F  F +I+  +SL+ QK+L+ K L+ ++   V+  N +    I
Sbjct: 186 LAPEVVFGGLVLSSEDHFSKFVQILRCASLLSQKKLV-KALIFFLDSRVSQANTDSAFNI 244

Query: 241 LRRFDLDKIISLSVLFEIQSLPLKEVIVRLMSNHSSTKFVSALVSKFADFTDEEVDTKTC 300
            +R  ++ ++S  +L ++ +  L  V+VR ++   + K   +L+  F    + E D   C
Sbjct: 245 FQRVGVE-LLSTDILLKVHNEILSAVLVRNLTEEQALKLYHSLLVFFHRH-EAESDGTAC 302

Query: 301 ELLVLFAVHNLNHSQREEIAHDERFLNGVTKHLGSNEREARERAMFIAKLLSGGHLKYES 360
            LL L A+  L HS + E+ H E FLN VT  L S +   RER M+IAK ++    +YES
Sbjct: 303 FLLCL-ALQRLPHSVKAELGHAEEFLNAVTFRLTSQDAAIRERTMYIAKKITNDSFEYES 361

Query: 361 DFKINIPNVKFESNSDDKIIDFQSLK------------NPSICNTQTDVGKDKITEVSGH 408
           DF I  P++K   +S   IIDF +L+             PS     T V +  ++E    
Sbjct: 362 DFTIETPHIKTPKSS---IIDFSTLQAVKPLHDHERNFKPSASLDNTMV-RLSLSESETD 417

Query: 409 VQSLTLXXXXXXXXXXXXXXXIVKRIVFLKDLMKEYEKTGESRKAPLIPLLKQTVKLIRQ 468
              +TL                    VFLKDL++E+E    ++ A  + LLK TV+LIRQ
Sbjct: 418 ENGVTL--------------------VFLKDLIREFELLS-NQTASRLHLLKSTVRLIRQ 456

Query: 469 KADFQLEVGYYAQGILSSIVCLNNEFDEPLFEQWRINALTSILVVLPEKVNGAINILFNS 528
           K DF LE+  Y+  +L+ I  L N  +EP FE+WRINAL SIL   PEKV   I ILF  
Sbjct: 457 KKDFTLEISTYSPQLLAVITSLANNLEEPAFEEWRINALVSILFAAPEKVIELIKILFGQ 516

Query: 529 ELSLQQRMSLLSALGLSARELRGLDDPTIVKPKFDFPTNRLPWDD---QSHHNSRL-VEV 584
           ELSLQQRMS+LSAL L+ARELRG+DD  I+K + DFPT RLPWD    +   N +L   V
Sbjct: 517 ELSLQQRMSILSALSLAARELRGIDDSVIMKLQVDFPTKRLPWDKGKPEGMKNDKLSASV 576

Query: 585 QESTSMIKKTKTVWKSRKLGKD-REKGTQNRFRKYAGLFFYPLAHGWLNGIDVGTYNQLF 643
             S S++++ KT WKS+KL    ++  ++NRFRK A  FF+PLAHGWLNGI++GTY+ +F
Sbjct: 577 PTSKSLLQENKTTWKSKKLTTSAKDILSENRFRKVAAKFFFPLAHGWLNGINMGTYDLMF 636

Query: 644 KSHYLTTLRIIYSCANPVHDFESMTELMNHII 675
           K HYLTT++++ S A P H+F SM + M  I+
Sbjct: 637 KKHYLTTMQMVLSAAYPHHEFNSMCQQMAIIV 668

>KLLA0D15158g 1281895..1283895 similar to sp|P53038 Saccharomyces
           cerevisiae YGR099w TEL2 involved in controlling telomere
           length and position effect singleton, start by
           similarity
          Length = 666

 Score =  390 bits (1002), Expect = e-126,   Method: Compositional matrix adjust.
 Identities = 238/678 (35%), Positives = 384/678 (56%), Gaps = 37/678 (5%)

Query: 6   LKQGLDSSQIHEALIQLDSYPREPVDLDASMVLIKFVIPVYPSLPERSKVILRRLASKSF 65
           L +  D   I++ L ++ S  ++    +  + +IK V+P+YPSLP   K+ LRRL   ++
Sbjct: 9   LNEKCDKDTIYQVLERMSS--KKQHSSNEILPIIKNVVPIYPSLPRELKMALRRLCGNNY 66

Query: 66  TFLCQIVTFSRTISGRDGLQEIRIYQEILEDIISFEPGCLTFYLKASTTSKADRDSIKAL 125
            F+  ++ +++ + G++  +E  I+   L D++ +E  CL  YL+ S  S+ D   IK++
Sbjct: 67  IFISLVIEYAKEL-GKN--RETSIFYGFLTDVLKYESDCLFNYLEHS--SRRDLPFIKSI 121

Query: 126 FFGSKLFNVLANRIDMAKYLGYLRLQWKFLL-ESNETDPPGFLGEWLVSSFLLNPVLAAD 184
            FGS+ +N L++ I + +YL ++++QW+F+  E+ + D      E  VS   LN     D
Sbjct: 122 LFGSRCYNALSSSISIVEYLKFMKMQWEFVFKETKQYDKTHL--EMFVSCLQLNIPYGVD 179

Query: 185 MLLGELFLLKESYFFSFQKIISASSLIDQKRLIAKFLLPYIQVIVTLENLNDVRKILRRF 244
           + +  L    E  + +   ++S  + + Q+R     L+P+++ +   +N + +  +L + 
Sbjct: 180 IFIEGLATTSEFSWNALIMMLSKGTSVQQRRFFMYHLVPFLEKVTNPDNSSTIFTLLSQL 239

Query: 245 DLDKIISLSVLFEIQSLPLKEVIVRLMSNHSSTKFVSALVSKFADFTDEEVDTKTCELLV 304
             D   S+   F+  +   K V +  MS     +    L+  F +  D   D    E+LV
Sbjct: 240 PFDIPTSIDC-FKWGNPYFKIVYLHGMSEAKRAQLFRELLPCF-ELMDLYTDDSLAEILV 297

Query: 305 LFAVHNLNHSQREEIAHDERFLNGVTKHLGSNEREARERAMFIAKLLSGGHLKYESDFKI 364
           +  +  ++   R+E++HD   LN VTK L S +   RER MF+AK L+   L+YESDF I
Sbjct: 298 MI-LDAMSKDSRDELSHDAISLNFVTKRLHSEDHLVRERTMFVAKKLTNDQLQYESDFTI 356

Query: 365 NIPNVKFESNSDDKIIDFQSLKNPSICNTQT-DVGKDKITEVSGHVQSLTLXXXXXXXXX 423
           ++P ++        +I    L+ P     Q    G     E+     ++TL         
Sbjct: 357 DLPRIE--------LIKLSKLEFPIKEGLQNLPKGNSTKNELVQQFNTITLQDSDDESDE 408

Query: 424 XXXXXXIVKRIVFLKDLMKEYEKTGESRKAPLIPLLKQTVKLIRQKADFQLEVGYYAQGI 483
                   + I+FLKDL+ E+EK  ++  + L  LLK+TVKL+RQK +F  EV +Y++ +
Sbjct: 409 ED-----SRDILFLKDLLLEFEKVIKNDGSEL-RLLKETVKLVRQKKNFPTEVSFYSKEL 462

Query: 484 LSSIVCLNNEFDEPLFEQWRINALTSILVVLPEKVNGAINILFNSELSLQQRMSLLSALG 543
           L  I  ++N+FDE  FE+W+ NAL SILVV P+K+     ILFN+ELSLQQRM +L++  
Sbjct: 463 LKKIATISNKFDEKSFEEWKANALVSILVVCPDKIVDLYAILFNNELSLQQRMVILTSAA 522

Query: 544 LSARELRGLDDPTIVKPKFDFPTNRLPWD----DQSHHNSRLVEVQESTSMIKKTKTVWK 599
           LSARELRG DD  +VKPK+DFPTNRLPWD    +Q   N+++ ++ E T     +K  W+
Sbjct: 523 LSARELRGFDDEFVVKPKYDFPTNRLPWDESATEQQPENNKIQDITEITG----SKVTWR 578

Query: 600 SRKLGKDRE-KGTQNRFRKYAGLFFYPLAHGWLNGIDVGTYNQLFKSHYLTTLRIIYSCA 658
           S++L  D +    QN FRKYA LFFYPLAH WLNGI++G ++++FK HY++ L+II +CA
Sbjct: 579 SKRLETDSKITQQQNNFRKYATLFFYPLAHAWLNGINLGAFDKVFKRHYISMLKIILTCA 638

Query: 659 NPVHDFESMTELMNHIIS 676
           +P ++ E M  LM  I+S
Sbjct: 639 SPHYELEEMQILMQEILS 656

>AAR090W [276] [Homologous to ScYGR099W (TEL2) - SH]
           complement(506082..508061) [1980 bp, 659 aa]
          Length = 659

 Score =  366 bits (939), Expect = e-117,   Method: Compositional matrix adjust.
 Identities = 240/666 (36%), Positives = 368/666 (55%), Gaps = 37/666 (5%)

Query: 15  IHEALIQLDSYPREPVDLDASMVLIKFVIPVYPSLPERSKVILRRLASKSFTFLCQIVTF 74
           + + L +L+  P  P   +A++V+++ V+  Y SLP R + +LRRL  KS   + Q+V  
Sbjct: 15  MEQVLSELEQSPMAP---EAALVVLQRVVTAYESLPSRLQAMLRRLCGKSSVLMSQVVVA 71

Query: 75  SRTISGRDGLQEIRIYQEILEDIISFEPGCLTFYLKASTTSKADRDSIKALFFGSKLFNV 134
           ++ + GR    E  IYQ +L + +  EPG L   L     ++  R  + ALFFGS++FNV
Sbjct: 72  AQQVRGRP---EAGIYQRVLRETLEREPGALAHQLAGGGPTQ--RRLVTALFFGSRVFNV 126

Query: 135 LANRIDMAKYLGYLRLQWKFLLESNETDPPGFLGEWLVSSFLLNPVLAADMLLGELFLLK 194
           LA+ +  A Y+  L  Q +   E     P     E LV+    +P  AAD L+    +L 
Sbjct: 127 LAHTLSAAAYVSLLTPQLQTWFEKGAGAPED--AEVLVALLRFHPTQAADALVD--LVLC 182

Query: 195 ESYFFSFQKIISASSLIDQKRLIAKFLLPYIQVIVTLENLNDVRKILRRFDLDKIISLSV 254
           E  +  F KI +    + Q++L+  FLL  +  +V   N+     +L   D  ++ +L  
Sbjct: 183 EVRWQIFCKICNQRVGVVQRQLVNGFLLRTLGRLVEASNVQAAYDLLLTLDY-RLFNLLE 241

Query: 255 LFEIQSLPLKEVIVRLMSNHSSTKFVSALVSKFADFTDEEVDTKTCELLVLFAVHNLNHS 314
           L ++ S+ L+  IV+++        +   +  F   T +  D K C L  +  +  +   
Sbjct: 242 LHKVNSVHLQSAIVQVLPESGCEALLKICLGMFG--TPDTDDEKRCNLFAIL-IARMAGP 298

Query: 315 QREEIAHDERFLNGVTKHLGSNEREARERAMFIAKLLSGGHLKYES-DFKINIPNVKFES 373
           + E+I HD++FL+ VT  L S +   R+R M IAK ++G  LKYE+   K+ +P ++ + 
Sbjct: 299 ELEKIVHDQQFLSAVTFRLASEDGAVRDRTMSIAKAVAGESLKYEAAHIKLPVPPLRPKG 358

Query: 374 NSDDKIIDFQSLKNPSICNTQTDVGKDKITEVSGHVQSLTLXXXXXXXXXXXXXXXIVKR 433
                 I F+ +  P       +      + V   + +LTL                 + 
Sbjct: 359 T-----ICFEEITTPRASAYVNN------SAVEPQLGALTLEDSDDSDVDSDGERR-GRE 406

Query: 434 IVFLKDLMKEYEKTGESRKAPLIPLLKQTVKLIRQKADFQLEVGYYAQGILSSIVCLNNE 493
           IVFLKDL+ E E    S + PL  LLK T+KL+RQK  F  EV +YA  +L+++  ++N 
Sbjct: 407 IVFLKDLLVELEAPDLSERGPLR-LLKLTIKLVRQKQAFVSEVSFYAPAMLTAVATISNS 465

Query: 494 FDEPLFEQWRINALTSILVVLPEKVNGAINILFNSELSLQQRMSLLSALGLSARELRGLD 553
             E  FE++RINAL S+LV +PEKV   +++LF ++LSLQQRM++LSAL L+ARELRGL+
Sbjct: 466 QSEQDFEEYRINALVSLLVAVPEKVTDLLHLLFQADLSLQQRMAILSALALAARELRGLE 525

Query: 554 DPTIVKPKFDFPTNRLPWDDQSHHNSRLVEVQESTS----MIKKTKTVWKSRKLGKDREK 609
           D  ++KP FDFPT RLP +D     SR +E +ES +     I    TVW+SRKL      
Sbjct: 526 DKYVLKPVFDFPTRRLPRNDAP---SRALESRESGTSSEGTISAHHTVWRSRKLDSAPAP 582

Query: 610 GTQNRFRKYAGLFFYPLAHGWLNGIDVGTYNQLFKSHYLTTLRIIYSCANPVHDFESMTE 669
              N FRK+A  FF+PLAH WLNGID+GT++ LFK HYL+TLR+I + ANP  +F+ M+E
Sbjct: 583 ERPNAFRKHAPAFFFPLAHAWLNGIDLGTFDALFKKHYLSTLRLILAAANPHAEFDRMSE 642

Query: 670 LMNHII 675
           LM++++
Sbjct: 643 LMSYVL 648

>CAGL0G07755g 736112..738169 similar to sp|P53038 Saccharomyces
           cerevisiae YGR099w TEL2 involved in controlling telomere
           length and position effect, hypothetical start
          Length = 685

 Score =  344 bits (883), Expect = e-109,   Method: Compositional matrix adjust.
 Identities = 234/680 (34%), Positives = 373/680 (54%), Gaps = 19/680 (2%)

Query: 3   LETLKQGLDSSQIHEALIQLDSYPREP---VDLDASMVLIKFVIPVYPSLPERSKVILRR 59
           LE  K+     ++ E +  LD+  +E     ++D  + +IK+V+  +  +P+   + L  
Sbjct: 5   LEEYKKLTTQLEVDELVTTLDTVFQEKDSLTNIDVILTVIKYVVSHHQVMPKSVILKLNW 64

Query: 60  LASKSFTFLCQIVTFSRTISGRDGLQEIRIYQEILEDIISFEPGCLTFYLKASTTSKADR 119
             + S     Q++ F   I  +   Q   IY E +   +      L  YL   T ++   
Sbjct: 65  FFAHSLIGFSQLIKFGSDIDAKQSEQ--LIYIEYVTQFLKSSTTYLQNYLIECTENRTKE 122

Query: 120 DSIKALFFGSKLFNVLANRIDMAKYLGYLRLQWKFLLE---SNETDPPGFLGEWLVSSFL 176
             +K  F GS +FN +  +++  +Y+  L  Q  F L+   S   D   +LG  + S   
Sbjct: 123 LILKRTFTGSTVFNFVKGKLNPLEYIELLNNQLVFALDKLDSRSGDFHKYLGNHIASLCD 182

Query: 177 LNPVLAADMLLGELFLLKESYFFSFQKIISASSLIDQKRLIAKFLLPYIQVIVTLENLND 236
            + + A D++L + FL+K+    +    +  +S   + ++  K+LLPY+  + +  N   
Sbjct: 183 FHNIFAPDVILSKTFLIKQERLETLSLFMKKTSEYTRYKIGIKYLLPYLDKVCSDTNAQL 242

Query: 237 VRKILRRFDLDKIISLSVLFEIQSLPLKEVIVRLMSNHSSTKFVSALVSKFADFTDEEVD 296
           V  IL    + K+I +  +F + S  L++ I+ ++ +      +  L+ KF    + E D
Sbjct: 243 VHHILGTLGIGKLILVQDIFRLNSFTLQKTILAILDSKKIDSVMDFLLMKFHSI-EYESD 301

Query: 297 TKTCELLVLFAVHNLNHSQREEIAHDERFLNGVTKHLGSNEREARERAMFIAKLLSGGHL 356
             TC+L+V    ++LN S + ++ H ++FLN +TK L   ++  RER+M+IAK+ S   +
Sbjct: 302 NNTCQLIVTILKNHLNDSGKIKVCHSDQFLNAITKRLSDQDKIIRERSMYIAKIASNHKI 361

Query: 357 KYESDFKINIPNVKFESNSDDKIIDFQSLKNPSICNTQTDVGKDKITEVSGHVQSLTLXX 416
            YESDF I+I       N +    D+  + N    N  T+     I+  +  +++L L  
Sbjct: 362 DYESDFTIDIGKSIAHENYEVPESDWSLILNSVNSNVNTNSSDTNISTSTHALEALNLDD 421

Query: 417 XXXXXXXXXXXXXIVKRIVFLKDLMKEYEKTGESRKAPLIPLLKQTVKLIRQKADFQLEV 476
                           + VFLKDL    E   +     L  +LK TVKL+RQK  F+ EV
Sbjct: 422 SDDEEDEEGDQL----KYVFLKDLTAALENKSQR---GLTNILKNTVKLVRQKKLFRSEV 474

Query: 477 GYYAQGILSSIVCLNNEFDEPLFEQWRINALTSILVVLPEKVNGAINILFNSELSLQQRM 536
            YYA  ++ +IV LNN+ DE  FE+ R+NAL SILVV+PEK++  + +LF +ELSLQQR+
Sbjct: 475 AYYAGAMIRNIVILNNDLDEKQFEELRVNALVSILVVVPEKIDELLKMLFTAELSLQQRL 534

Query: 537 SLLSALGLSARELRGLDDPTIVKPKFDFPTNRLPWDDQSHHNSRLVEVQESTS-MIKKTK 595
           SLL ++ +SARELRG DD  I+KP+FDFPT+ LPW D+   N+R+ E+ ++ S      K
Sbjct: 535 SLLLSVSMSARELRGYDDKQILKPQFDFPTSMLPW-DRRQENNRIEEIDDNGSDNTSGGK 593

Query: 596 TVWKSRKLGKDREKGTQNRFRKYAGLFFYPLAHGWLNGIDVGTYNQLFKSHYLTTLRIIY 655
            +WKS KL K+ E+   NRFR+YA  FFYPLA+GWLNGID+GT+++LFK++YL+TL+ +Y
Sbjct: 594 VLWKSSKLTKNTEE-INNRFREYASKFFYPLANGWLNGIDLGTFDKLFKTYYLSTLKTVY 652

Query: 656 SCANPVHDFESMTELMNHII 675
           +CA  VHDFE MT  M+ I+
Sbjct: 653 NCAYLVHDFEDMTTTMDTIL 672

>Scas_305.1
          Length = 377

 Score = 31.6 bits (70), Expect = 2.4,   Method: Compositional matrix adjust.
 Identities = 24/78 (30%), Positives = 37/78 (47%), Gaps = 13/78 (16%)

Query: 497 PLFEQWRINALTSILV-------VLPEKVNGAINILFNSELSLQQRMSLLSALGLSAREL 549
           P+ EQ  + A    LV       +  EK+  A N LF+S   L ++ +L++  G +  EL
Sbjct: 226 PVLEQELVRAEAESLVAEAQLSNITREKLKAAYNYLFDSMRELAEKFALIAGYGKALLEL 285

Query: 550 RGLDD----PTIVKPKFD 563
             LDD    P   +P +D
Sbjct: 286 --LDDSPVTPGEARPAYD 301

>Scas_719.9*
          Length = 897

 Score = 29.6 bits (65), Expect = 9.4,   Method: Compositional matrix adjust.
 Identities = 19/62 (30%), Positives = 35/62 (56%), Gaps = 3/62 (4%)

Query: 458 LLKQTVKLIRQKADF---QLEVGYYAQGILSSIVCLNNEFDEPLFEQWRINALTSILVVL 514
           LLK+  KL++ +A++   Q+ V    + +  +I  L N  D+ +F +  I  L++IL+  
Sbjct: 567 LLKRDSKLLKTRANYIIGQICVKLSPERVYRTISSLLNSCDDLIFVRMMIQILSNILITS 626

Query: 515 PE 516
           PE
Sbjct: 627 PE 628

  Database: blastdb
    Posted date:  Apr 3, 2006  3:33 PM
  Number of letters in database: 16,596,109
  Number of sequences in database:  34,618
  
Lambda     K      H
   0.321    0.137    0.392 

Gapped
Lambda     K      H
   0.267   0.0410    0.140 

Matrix: BLOSUM62
Gap Penalties: Existence: 11, Extension: 1
Number of Sequences: 34618
Number of Hits to DB: 20,782,998
Number of extensions: 879847
Number of successful extensions: 2514
Number of sequences better than 10.0: 17
Number of HSP's gapped: 2568
Number of HSP's successfully gapped: 19
Length of query: 676
Length of database: 16,596,109
Length adjustment: 108
Effective length of query: 568
Effective length of database: 12,857,365
Effective search space: 7302983320
Effective search space used: 7302983320
Neighboring words threshold: 11
Window for multiple hits: 40
X1: 16 ( 7.4 bits)
X2: 38 (14.6 bits)
X3: 64 (24.7 bits)
S1: 41 (21.9 bits)
S2: 65 (29.6 bits)