Hit NameLength (aa)HSP LengthHSP ScoreHSP Significance
YGR098C (ESP1)1630160180490.0
Scas_716.271620160733510.0
AAR089C1618161825350.0
Kwal_55.205351636161724040.0
KLLA0D15136g1591156921240.0
CAGL0G03223g1604163115880.0
CAGL0F03861g43040751.7
YOR380W (RDR1)546129742.2
YGR133W (PEX4)18352712.2
Kwal_23.348568866724.3
BLASTP 2.2.26 [Sep-21-2011]

Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, 
Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), 
"Gapped BLAST and PSI-BLAST: a new generation of protein database search
programs",  Nucleic Acids Res. 25:3389-3402.

Reference for compositional score matrix adjustment: Altschul, Stephen F., 
John C. Wootton, E. Michael Gertz, Richa Agarwala, Aleksandr Morgulis,
Alejandro A. Schaffer, and Yi-Kuo Yu (2005) "Protein database searches
using compositionally adjusted substitution matrices", FEBS J. 272:5101-5109.

Query= YGR098C
         (1601 letters)

Database: blastdb 
           34,618 sequences; 16,596,109 total letters

Searching..................................................done

                                                                 Score    E
Sequences producing significant alignments:                      (bits) Value

YGR098C (ESP1) [2058] chr7 complement(682568..687460) Separin pr...  3105   0.0  
Scas_716.27                                                          1295   0.0  
AAR089C [275] [Homologous to ScYGR098C (ESP1) - SH] (500951..505...   981   0.0  
Kwal_55.20535                                                         930   0.0  
KLLA0D15136g complement(1276819..1281594) similar to sp|Q03018 S...   822   0.0  
CAGL0G03223g complement(300119..304933) similar to sp|Q03018 Sac...   616   0.0  
CAGL0F03861g complement(373691..374983) similar to sp|P07277 Sac...    33   1.7  
YOR380W (RDR1) [5153] chr15 (1051286..1052926) Protein with simi...    33   2.2  
YGR133W (PEX4) [2090] chr7 (756899..757450) Ubiquitin-conjugatin...    32   2.2  
Kwal_23.3485                                                           32   4.3  

>YGR098C (ESP1) [2058] chr7 complement(682568..687460) Separin protein
            required for Mcd1p and Rec8p cleavage and sister
            chromatid separation during mitosis and meiosis, also
            cleaves Slk19p and Mcd1p, also involved in regulation of
            spindle pole body duplication [4893 bp, 1630 aa]
          Length = 1630

 Score = 3105 bits (8049), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 1532/1601 (95%), Positives = 1532/1601 (95%)

Query: 1    MMVKQEEPLNEISPNTPMTSKSYLLNDTLSKVHHSGQTRPLTSVLSGDASSNSIGILAMH 60
            MMVKQEEPLNEISPNTPMTSKSYLLNDTLSKVHHSGQTRPLTSVLSGDASSNSIGILAMH
Sbjct: 1    MMVKQEEPLNEISPNTPMTSKSYLLNDTLSKVHHSGQTRPLTSVLSGDASSNSIGILAMH 60

Query: 61   NNIIRDFTKIASNNIDLAIEDITTVDHSLNSIYSLLKSHHMWGHINSTVKQHLMIIVKLI 120
            NNIIRDFTKIASNNIDLAIEDITTVDHSLNSIYSLLKSHHMWGHINSTVKQHLMIIVKLI
Sbjct: 61   NNIIRDFTKIASNNIDLAIEDITTVDHSLNSIYSLLKSHHMWGHINSTVKQHLMIIVKLI 120

Query: 121  NNNALGLASSEIIFLFNETNLFQAHSLKNILLADFSTWNDYYLSNLKILALQIILKRKLV 180
            NNNALGLASSEIIFLFNETNLFQAHSLKNILLADFSTWNDYYLSNLKILALQIILKRKLV
Sbjct: 121  NNNALGLASSEIIFLFNETNLFQAHSLKNILLADFSTWNDYYLSNLKILALQIILKRKLV 180

Query: 181  DEYLPHILELFSHDKRYLLKDPNLKAHALTKIVLSFFSVTTSCKVLFGLKFLQYIKQFKL 240
            DEYLPHILELFSHDKRYLLKDPNLKAHALTKIVLSFFSVTTSCKVLFGLKFLQYIKQFKL
Sbjct: 181  DEYLPHILELFSHDKRYLLKDPNLKAHALTKIVLSFFSVTTSCKVLFGLKFLQYIKQFKL 240

Query: 241  PFKKFISNITVECFSKNLLHKNYLEMGPNKIYLNSFYLSYSMLYDGLDKIMLLDILSYEE 300
            PFKKFISNITVECFSKNLLHKNYLEMGPNKIYLNSFYLSYSMLYDGLDKIMLLDILSYEE
Sbjct: 241  PFKKFISNITVECFSKNLLHKNYLEMGPNKIYLNSFYLSYSMLYDGLDKIMLLDILSYEE 300

Query: 301  TTEVQRAIKSKKEFNEYCNMSENRLLWSCISVDDLNVILENATNFLQNKGKHISATLKCL 360
            TTEVQRAIKSKKEFNEYCNMSENRLLWSCISVDDLNVILENATNFLQNKGKHISATLKCL
Sbjct: 301  TTEVQRAIKSKKEFNEYCNMSENRLLWSCISVDDLNVILENATNFLQNKGKHISATLKCL 360

Query: 361  VCLWSTIRLEGLPKNKDILRQFDCTVIYINSNIKSINDXXXXXXXXXXXXXXXXICIDYK 420
            VCLWSTIRLEGLPKNKDILRQFDCTVIYINSNIKSIND                ICIDYK
Sbjct: 361  VCLWSTIRLEGLPKNKDILRQFDCTVIYINSNIKSINDESAAALLSELLGVLSEICIDYK 420

Query: 421  EPKRLSNIISVLFNASVLFKSHSFLLKTANLEISNVLISNDSKTSHRTILKFEKFISSAQ 480
            EPKRLSNIISVLFNASVLFKSHSFLLKTANLEISNVLISNDSKTSHRTILKFEKFISSAQ
Sbjct: 421  EPKRLSNIISVLFNASVLFKSHSFLLKTANLEISNVLISNDSKTSHRTILKFEKFISSAQ 480

Query: 481  SAQKKIEIFSCLFNVYCMLRNDTLSFVFDFCQNAFIHCFTRLKITKFIEFSNSSEIMLSV 540
            SAQKKIEIFSCLFNVYCMLRNDTLSFVFDFCQNAFIHCFTRLKITKFIEFSNSSEIMLSV
Sbjct: 481  SAQKKIEIFSCLFNVYCMLRNDTLSFVFDFCQNAFIHCFTRLKITKFIEFSNSSEIMLSV 540

Query: 541  LYGNSSIENIPSENWSQLSRMIFCSLRGIFDLDPLELNNTFDKLHLLNKYELLIRIVYLL 600
            LYGNSSIENIPSENWSQLSRMIFCSLRGIFDLDPLELNNTFDKLHLLNKYELLIRIVYLL
Sbjct: 541  LYGNSSIENIPSENWSQLSRMIFCSLRGIFDLDPLELNNTFDKLHLLNKYELLIRIVYLL 600

Query: 601  NLDMSKHLTTNLSKITKLYINKWLQKSDEKAERISSFEMDFVKMLLCYLNFNNFDKLSIE 660
            NLDMSKHLTTNLSKITKLYINKWLQKSDEKAERISSFEMDFVKMLLCYLNFNNFDKLSIE
Sbjct: 601  NLDMSKHLTTNLSKITKLYINKWLQKSDEKAERISSFEMDFVKMLLCYLNFNNFDKLSIE 660

Query: 661  LSLCIKSKEKYYSSIVPYADNYLLEAYLSLYMIDDALMMKNQLQKTMNLSTAKIEQALLH 720
            LSLCIKSKEKYYSSIVPYADNYLLEAYLSLYMIDDALMMKNQLQKTMNLSTAKIEQALLH
Sbjct: 661  LSLCIKSKEKYYSSIVPYADNYLLEAYLSLYMIDDALMMKNQLQKTMNLSTAKIEQALLH 720

Query: 721  ASSLINVHLWDSDLTAFQIYFGKTLPAMKPELFDINNDHNLPMSLYIKVILLNIKIFNES 780
            ASSLINVHLWDSDLTAFQIYFGKTLPAMKPELFDINNDHNLPMSLYIKVILLNIKIFNES
Sbjct: 721  ASSLINVHLWDSDLTAFQIYFGKTLPAMKPELFDINNDHNLPMSLYIKVILLNIKIFNES 780

Query: 781  AKLNIKAGNVISAVIDCRXXXXXXXXXXXXXXXXXXGSRXXXXXXXXXXXXXXIKIHIRI 840
            AKLNIKAGNVISAVIDCR                  GSR              IKIHIRI
Sbjct: 781  AKLNIKAGNVISAVIDCRKAQNLALSLLKKKNKLSQGSRLALLKSLSFSFFQLIKIHIRI 840

Query: 841  GSARDCEFYSKELSRIISDLEEPIIVYRCLHFLHRYYMITEQTCLQNITLGKANKAFDYL 900
            GSARDCEFYSKELSRIISDLEEPIIVYRCLHFLHRYYMITEQTCLQNITLGKANKAFDYL
Sbjct: 841  GSARDCEFYSKELSRIISDLEEPIIVYRCLHFLHRYYMITEQTCLQNITLGKANKAFDYL 900

Query: 901  DAEADITSLTMFLYDNKEFVKLEQSLVLYFGDQLEKTFLPNLWKLHLGKDIDDSICLSEY 960
            DAEADITSLTMFLYDNKEFVKLEQSLVLYFGDQLEKTFLPNLWKLHLGKDIDDSICLSEY
Sbjct: 901  DAEADITSLTMFLYDNKEFVKLEQSLVLYFGDQLEKTFLPNLWKLHLGKDIDDSICLSEY 960

Query: 961  MPKNVINRVHNMWQKVMSQLEEDPFFKGMFESTLGIPSSLPVIPSTMPNNILKTPSKHST 1020
            MPKNVINRVHNMWQKVMSQLEEDPFFKGMFESTLGIPSSLPVIPSTMPNNILKTPSKHST
Sbjct: 961  MPKNVINRVHNMWQKVMSQLEEDPFFKGMFESTLGIPSSLPVIPSTMPNNILKTPSKHST 1020

Query: 1021 GLKLCDSPRSSSMTPRGKNIRQKFDRIAAISKLKQMKELLESLKLDTLDNHEXXXXXXXX 1080
            GLKLCDSPRSSSMTPRGKNIRQKFDRIAAISKLKQMKELLESLKLDTLDNHE        
Sbjct: 1021 GLKLCDSPRSSSMTPRGKNIRQKFDRIAAISKLKQMKELLESLKLDTLDNHELSKISSLS 1080

Query: 1081 XXXXXXXXXXXXXHNAESSLITNFSLTDLPRHMPLLFDKVLNNIDNKNYREFRVSSLIAP 1140
                         HNAESSLITNFSLTDLPRHMPLLFDKVLNNIDNKNYREFRVSSLIAP
Sbjct: 1081 SLTLTILSNITSIHNAESSLITNFSLTDLPRHMPLLFDKVLNNIDNKNYREFRVSSLIAP 1140

Query: 1141 NNISTITESIRVSAAQKDLMESNLNINVITIDFCPITGNLLLSKLEPRRKRRTHLRLPLI 1200
            NNISTITESIRVSAAQKDLMESNLNINVITIDFCPITGNLLLSKLEPRRKRRTHLRLPLI
Sbjct: 1141 NNISTITESIRVSAAQKDLMESNLNINVITIDFCPITGNLLLSKLEPRRKRRTHLRLPLI 1200

Query: 1201 RSNSRDLDEVHLSFPEATKKLLSIINESNQTTSVEVTNKIKTREERKSWWTTRYDLDKRM 1260
            RSNSRDLDEVHLSFPEATKKLLSIINESNQTTSVEVTNKIKTREERKSWWTTRYDLDKRM
Sbjct: 1201 RSNSRDLDEVHLSFPEATKKLLSIINESNQTTSVEVTNKIKTREERKSWWTTRYDLDKRM 1260

Query: 1261 QQLLNNIENSWFNGVQGFFSPEVVDNSLFEKFKDKFYEILHQNLPSRKLYGNPAMFIKVE 1320
            QQLLNNIENSWFNGVQGFFSPEVVDNSLFEKFKDKFYEILHQNLPSRKLYGNPAMFIKVE
Sbjct: 1261 QQLLNNIENSWFNGVQGFFSPEVVDNSLFEKFKDKFYEILHQNLPSRKLYGNPAMFIKVE 1320

Query: 1321 DWVIELFLKLNPQEIDFLSKMEDLIYFVLDILLFHGEENAYDEIDFSMLHVQLEEQIKKY 1380
            DWVIELFLKLNPQEIDFLSKMEDLIYFVLDILLFHGEENAYDEIDFSMLHVQLEEQIKKY
Sbjct: 1321 DWVIELFLKLNPQEIDFLSKMEDLIYFVLDILLFHGEENAYDEIDFSMLHVQLEEQIKKY 1380

Query: 1381 RATMTTNSIFHTFLVVSSSCHLFPWECLSFLKDLSITRVPSYVCLNKLLSRFHYQLPLQV 1440
            RATMTTNSIFHTFLVVSSSCHLFPWECLSFLKDLSITRVPSYVCLNKLLSRFHYQLPLQV
Sbjct: 1381 RATMTTNSIFHTFLVVSSSCHLFPWECLSFLKDLSITRVPSYVCLNKLLSRFHYQLPLQV 1440

Query: 1441 TIEDNISMILNPNGDLSRTESKFKGMFQKIIDAKPSSQLVMNEKPEEETLLKMLQNSNLF 1500
            TIEDNISMILNPNGDLSRTESKFKGMFQKIIDAKPSSQLVMNEKPEEETLLKMLQNSNLF
Sbjct: 1441 TIEDNISMILNPNGDLSRTESKFKGMFQKIIDAKPSSQLVMNEKPEEETLLKMLQNSNLF 1500

Query: 1501 VYIGHGGGEQYVRSKEIKKCTKIAPSFLLGCSSAAMKYYGKLEPTGTIYTYLLGGCPMVL 1560
            VYIGHGGGEQYVRSKEIKKCTKIAPSFLLGCSSAAMKYYGKLEPTGTIYTYLLGGCPMVL
Sbjct: 1501 VYIGHGGGEQYVRSKEIKKCTKIAPSFLLGCSSAAMKYYGKLEPTGTIYTYLLGGCPMVL 1560

Query: 1561 GNLWDVTDKDIDKFSEELFEKMGFRCNTDDLNGNSLSVSYA 1601
            GNLWDVTDKDIDKFSEELFEKMGFRCNTDDLNGNSLSVSYA
Sbjct: 1561 GNLWDVTDKDIDKFSEELFEKMGFRCNTDDLNGNSLSVSYA 1601

>Scas_716.27
          Length = 1620

 Score = 1295 bits (3351), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 688/1607 (42%), Positives = 1011/1607 (62%), Gaps = 42/1607 (2%)

Query: 2    MVKQEEPLNEISPNTPM--TSKSYLLNDTLSKVHHSGQTRPLTSVLSGDASSNSIGILAM 59
            M KQE+PLNE+S NT    +      N+ L   +       +  + +G    +    L +
Sbjct: 1    MSKQEDPLNEVSLNTTTWHSPSKRGQNNELKNFNAYPNKENIPQLHTGRLEKD----LDL 56

Query: 60   HNNIIRDFTKIASNNIDLAIEDITTVDHSLNSIYSLLKSHHMWGHINSTVKQHLMIIVKL 119
            +   I +F K  S    L    I  +     ++Y  L   H+  H+ + VK+HL+++VKL
Sbjct: 57   YYKQISEFIKAQS----LQKPQIERIHAVFTTLYRELNRRHLLRHLRALVKEHLIVVVKL 112

Query: 120  INNNALGLASSEIIFLFNETNLFQAHSLKNILLADFSTWNDYYLSNLKILALQIILKRKL 179
            INNN    + S I+ L+N TNLF+AH LK+++LADFS  N++YLS LKIL+ Q+ILK+K 
Sbjct: 113  INNNFYDYSQSGILCLYNTTNLFKAHDLKDVILADFSESNEFYLSTLKILSFQVILKKKN 172

Query: 180  VDEYLPHILELFSHDKRYLLKDPNLKAHALTKIVLSFFSVTTSCKVLFGLKFLQYIKQFK 239
            +  Y   I++ FSHD+RY+LKDPN+K H + K++L+FFS+  + K LFGLKFLQYIKQF 
Sbjct: 173  LKMYEDTIIQAFSHDERYILKDPNIKIHTVVKLLLNFFSILPTFKTLFGLKFLQYIKQFN 232

Query: 240  LPFKKFISNITVECFSKNLLH---KNYLEMGPNKIYLNSFYLSYSMLYDGLDKIMLLDIL 296
            L F+ +I N+    F K L+    KN  ++ P   YLNS+Y++YS     L K+ML D +
Sbjct: 233  LSFQTYIKNMDSITFEKQLVRYGSKNIQQLKP---YLNSYYINYSKFNSHLTKLMLTDFV 289

Query: 297  SYEETTEVQRAIKSKKEFNEYCNMSENRLLWSCISVDDLNVILENATNFLQNKGKHISAT 356
              +  +  ++     K+  E  + S     + C+S   ++  + +    + N  +    T
Sbjct: 290  GRDLQSH-KKTFALLKDHKEISSTSTE--CYCCLSHSQMDNFVISCHALMSNNDQIHLHT 346

Query: 357  LKCLVCLWSTIRLEGLPKNKDILRQFDCTVIYINSNIKSINDXXXXXXXXXXXXXXXXIC 416
            +  +   WS IR E  P+NK +L   D T+I++NS +K +                  +C
Sbjct: 347  IDAVTFGWSIIRSENFPRNKKMLALLDSTLIFLNSQMKHLEKMQISLVKLIKMLAE--VC 404

Query: 417  IDYKEPKRLSNIISVLFNASVLFKSHSFLLKTANLEISNVLISNDSKTSHRTILKFEKFI 476
            +DY+E KR++N+I+V FN  V F++  FL  TA LE  + L+ +D     + I KFEKFI
Sbjct: 405  MDYQEYKRMTNVINVSFNCFVFFRNFDFLKLTAELESKHYLVCHDKSQWKKLIQKFEKFI 464

Query: 477  SSAQSAQKKIEIFSCLFNVYCMLRNDTLSFVFDFCQNAFIHCFTRLKITKFIEFSNSSEI 536
             SA    +KIE+FS +FN + +  +D+LSFV +F +  F+ CF+RLK+T FI+F + SE 
Sbjct: 465  GSAPEQYQKIELFSYVFNTFLLFNDDSLSFVVEFTETIFLRCFSRLKLTYFIDFHDVSEP 524

Query: 537  MLSVLYGNSSIENIPSENWSQLSRMIFCSLRGIFDLDPLELNNTFDKLHLLNKYELLIRI 596
            MLS+LYGNSSI NIP  +W+ L+ M+F  + G F+++ + +N    K + L KY+ LI+ 
Sbjct: 525  MLSILYGNSSITNIPHGDWNNLTEMLFFCVSGRFEINAININQVTTKWYYLYKYKDLIKS 584

Query: 597  VYLLNLDMSKHLTTNLSKITKLYINKWLQKSDEKAERISSFEMDFVKMLLCYLNFNNFDK 656
            +Y+LNLDM KH ++NLS++T  YI+KW+QK+    E ISS E+ F+ ML  YL FNNF+K
Sbjct: 585  IYVLNLDMKKHSSSNLSQLTSSYISKWVQKTSLLNEGISSIEVTFITMLFQYLGFNNFNK 644

Query: 657  LSIELSLCIKSKEKYYSSIVPYADNYLLEAYLSLYM---IDDALMMKNQLQKTMNLSTAK 713
              + LS  ++    Y++ +      + +++ ++L +   I+D   + + +  T  +   K
Sbjct: 645  CILTLSAALRDHINYFAPLKLEISRWNIQSSINLQLMEQINDEAKLLSTIAPTYTI--CK 702

Query: 714  IEQALLHASSLINVHLWDSDLTAFQIYFGKTLPAMKPELFDINNDHNLPMSLYIKVILLN 773
            +E+ L    + ++V  W +D   FQ  F + LP+++ E+FD+NN   +P S YIKV+L  
Sbjct: 703  LEKLLTFLEAKLDVFTWTNDYEGFQELFMEELPSVRLEVFDLNNQSKMPASQYIKVLLFM 762

Query: 774  IKIFNESAKLNIKAGNVISAVIDCRXXXXXXXXXXXXXXXXXXGSRXXXXXXXXXXXXXX 833
             K+FN S++L++   ++ ++VI+ +                   SR              
Sbjct: 763  TKLFNHSSRLHLARDDITASVIESKRALKLATSLIKKQNKLSQSSRIRLINLVLNSFTQL 822

Query: 834  IKIHIRIGSARDCEFYSKELSRIISDLEEPIIVYRCLHFLHRYYMITEQTCLQNITLGKA 893
            I+I+IR+G A++ ++Y+ +LS++I DL EP +VYR LHFLH YY + +   L+ ITL KA
Sbjct: 823  IEIYIRLGLAKEADYYADQLSKVICDLGEPSVVYRGLHFLHNYYKLVKHEALEIITLQKA 882

Query: 894  NKAFDYLDAEADITSLTMFLYDNKEFVKLEQSLVLYFGDQLEKTFLPNLWKLHLGKDIDD 953
            NK FDYLD E+DI S+ MFL+DN EF K+ +SL L+F D    +FLP  W+L +G+ IDD
Sbjct: 883  NKTFDYLDGESDIESVLMFLFDNSEFKKISESLNLFFQDDFNNSFLPLYWQLKMGRPIDD 942

Query: 954  SICLSEYMPKNVINRVHNMWQKVMSQLEEDPFFKGMFESTLGIPSSLPVIPSTMPNN--- 1010
            S+CL+     N I ++   ++ V+ QLE DPFFK +FES L +P+ +  I +T  +    
Sbjct: 943  SLCLTTLKSTNSIKKLERDYKHVLGQLESDPFFKNLFESILAVPA-VTNIHNTQSDGTMC 1001

Query: 1011 ILKTPSKHSTGLKLCDSPRSSSMTPRGKNIRQKFDRIAAISKLKQMKELLESLKLDTLDN 1070
            +++TP+K     K+ DSPR S+MTP+ KN++QKFD+  A+S L ++K  +E L L+ L++
Sbjct: 1002 LMETPTKKKLAFKVNDSPRPSNMTPKSKNLKQKFDKAVALSNLNRIKCCIEDLNLELLNH 1061

Query: 1071 HEXXXXXXXXXXXXXXXXXXXXXHNAESSLITNFSLTDLPRHMPLLFDKVLNNIDNKNYR 1130
             +                        +++L   F+L DLP+ +P+ +DK+L++ID+  Y 
Sbjct: 1062 GDLLNISSLFSLTVTMLSNISKNALEDATLFQRFNLIDLPKRVPMYYDKLLSSIDDDLYT 1121

Query: 1131 EFRVSSLIAPNNISTITESIRVSAAQKDLMES----NLNINVITIDFCPITGNLLLSKLE 1186
            + +    + P   S+  E  R   A   L ES     L+ +VITID C ITGNLLLSKL 
Sbjct: 1122 DIK----LLP--FSSNHEQTRKKQALLSLNESTEFCGLSFDVITIDICSITGNLLLSKLS 1175

Query: 1187 PRRKRRTHLRLPLIRSNSRDLDEVHLSFPEATKKLLSIINESNQTTSVEVTNKIKTREER 1246
                 ++HL +PL R+N RDLD   L+F EA K+L  II+ESN TTSVEVT+ IKT+E+R
Sbjct: 1176 ATNGHKSHLSIPLNRANLRDLDAYSLTFVEAVKELAYIIDESNSTTSVEVTSSIKTKEDR 1235

Query: 1247 KSWWTTRYDLDKRMQQLLNNIENSWFNGVQGFFSPEVVDNSLFEKFKDKFYEILHQNLPS 1306
            K+WW +RY+LD R+  LL+NIE SWF G++G F   VVD SLFE+FK KFY ILH NLPS
Sbjct: 1236 KTWWKSRYELDNRLSSLLHNIETSWFAGLKGLFDQSVVDPSLFEEFKKKFYGILHSNLPS 1295

Query: 1307 RKLYGNPAMFIKVEDWVIELFLKLNPQEIDFLSKMEDLIYFVLDILLFHGEENAYDEIDF 1366
            RK  G P  F+++ DW+IELFLKL+PQ+ +F+S +ED+IYF LDILLF GEENAYDEID 
Sbjct: 1296 RKQMGKPMTFLQINDWIIELFLKLDPQDDEFISMIEDMIYFTLDILLFQGEENAYDEIDL 1355

Query: 1367 SMLHVQLEEQIKKYRATMTTNS--IFHTFLVVSSSCHLFPWECLSFLKDLSITRVPSYVC 1424
            SM+H+QLEEQIK+Y + + +NS  + HTFLV+ S+CH FPWE LSF+ DLS++R+PS   
Sbjct: 1356 SMVHIQLEEQIKRYHSKVISNSHKVDHTFLVIGSACHTFPWESLSFMNDLSLSRIPSIKW 1415

Query: 1425 LNKLLSRFHYQLPLQVTIEDNISMILNPNGDLSRTESKFKGMFQKIIDAKPSSQLVMNEK 1484
            L   ++R + QL   V + + ISMILNP+GDL RTE +F+  F+ I+  +PSS L++NEK
Sbjct: 1416 LESAITRHYEQLIKGVPLTEKISMILNPHGDLERTELRFRETFETIVAKRPSSSLIVNEK 1475

Query: 1485 PEEETLLKMLQNSNLFVYIGHGGGEQYVRSKEIKKCTKIAPSFLLGCSSAAMKYYGKLEP 1544
            P+EE +L M+ N NLF+Y+GHGGGEQYVR++EIK+C  + PSFLLGCSSA++KYYG LEP
Sbjct: 1476 PDEEKMLHMMSNCNLFIYVGHGGGEQYVRTREIKRCDNVGPSFLLGCSSASLKYYGGLEP 1535

Query: 1545 TGTIYTYLLGGCPMVLGNLWDVTDKDIDKFSEELFEKMGFRCNTDDL 1591
            TGT+ +YLL G P+VLGNLWDVTDKDIDKFS+ +FEK+G     D++
Sbjct: 1536 TGTVNSYLLAGSPLVLGNLWDVTDKDIDKFSQSVFEKIGLVMGEDEI 1582

>AAR089C [275] [Homologous to ScYGR098C (ESP1) - SH] (500951..505807)
            [4857 bp, 1618 aa]
          Length = 1618

 Score =  981 bits (2535), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 588/1618 (36%), Positives = 898/1618 (55%), Gaps = 90/1618 (5%)

Query: 2    MVKQEEPLNEISPNTPMTSKSYLLNDTLSKVHHSGQTRPLTSVLSGDASSNSIGIL-AMH 60
            M +++E LN I+ NTP+   S+    T +    +   +PL      ++S+N +  +  + 
Sbjct: 1    MAREKEVLNVINLNTPIMRNSW----TGAAGGTTKHEKPLVEAF--NSSTNRLHFVDRLP 54

Query: 61   NNIIRDFTKIASNNIDLAIEDITTVDHSLNSIYSLLKSHHMWGHINSTVKQHLMIIVKLI 120
             ++   F ++    +     +   V  +L  +Y  LK  H  G +    +QH+ ++V+L+
Sbjct: 55   FDVTEGFREV-QRFVQEGKGEADKVREALTGLYRELKQRHQLGRVAEVSRQHMGVVVRLL 113

Query: 121  NNNALGLASSEIIFLFNETNLFQAHSLKNILLADFSTWNDYYLSNLKILALQIILKRKLV 180
                   A+ E++ L+N+TN   A  L ++L+ADF   N+ YLS  KILA+Q+I++ + V
Sbjct: 114  EAGQDAAAAREVVALYNQTNYRPAGGLGDVLMADFGVSNERYLSTAKILAMQLIIRMRQV 173

Query: 181  DEYLPHILELFSHDKRYLLKDPNLKAHALTKIVLSFFSVTTSCKVLFGLKFLQYIKQFKL 240
            + +   ++ +F+ D+RY+L+DP LK H + K++L+FFS+    KVLF LKFLQY+ QF+L
Sbjct: 174  ESHAETVVRIFAADERYILRDPKLKVHTVVKLILNFFSLLPQYKVLFALKFLQYVSQFRL 233

Query: 241  PFKKFISNITVECFSKNLLHKNYLEMGPNKIYLNSFYLSYSMLYDGLDKIMLLDI----- 295
             F  +I N+ +  F K +L      +  +  +L+ +Y SYS     + K+M  D      
Sbjct: 234  DFSTYIKNMDLAKFQKQVLKFAGAGLESSLPFLDIYYRSYSQHMTSIGKLMWQDFRVPDR 293

Query: 296  ----LSYEETTEVQRAIKSKK-----EFNEYCNMSENRLLWSCISVDDLNVILENATNFL 346
                L+ E+   +Q+ +  ++     EF+ Y      +L       D           FL
Sbjct: 294  GDTKLNPEDPIILQQILHGRRTLDNAEFDAYTKHITTKLSKGVSPTD----------AFL 343

Query: 347  QNKGKHISATLKCLVCLWSTIRLEGLPKNKDILRQFDCTVIYINSNIKSINDXXXXXXXX 406
                      LK  +   S  RL  L K   IL   D   I+IN+N+  ++         
Sbjct: 344  --------GALKVYILNCSLKRLR-LQKAHVIL--LDKIAIFINTNVVHVS----VESIH 388

Query: 407  XXXXXXXXICIDYKEPKRLSNIISVLFNASVLFKSHSFLLKTANLEISNVLISNDSKTSH 466
                      ID KE KRL+N++++ FNA V++K  S +   A+LE+    +    K   
Sbjct: 389  TILKSLAEYFIDAKEYKRLNNVVNISFNAYVMYKHESLIRLAADLEL---FLFMSVKQDW 445

Query: 467  RTILKFEKFISSAQSAQKKIEIFSCLFNVYCMLRNDTLSFVFDFCQNAFIHCFTRLKITK 526
                KFEKFIS A S    + +F   FNVY M  + +L+ ++D C N  + CF +L +T 
Sbjct: 446  SMFTKFEKFISVA-SGDISVSLFEQCFNVYVMFADPSLAGLWDVCLNKSLKCFKKLGLTS 504

Query: 527  FIEFSNSSEIMLSVLYGN--SSIENIPSENWSQLSRMIFCSLRGIFDLDPLELNNTFDKL 584
            + +F  SSE ML ++Y    S I  IP   W+ LS+M+F +L G++    ++++     +
Sbjct: 505  YTDFKASSEPMLVLVYSGFVSDIFTIPYNGWAPLSKMLFMALNGVYKFGYMDVDCKIKSV 564

Query: 585  HLLNKYELLIRIVYLLNLDMSKHLTTNLSKITKLYINKWLQKSDEKAERISSFEMDFVKM 644
             +L KYE+LI+  Y LN++M  H T  LSKI  +Y+++W+  S    ERIS  E+ FVK 
Sbjct: 565  DVLAKYEMLIKSTYSLNMEMETHGTLQLSKIANMYVSRWVS-SLPTDERISGLEVRFVKA 623

Query: 645  LLCYLNFNNFDKLSIELSLCIKSKEKYYSSIVPYADNYLLEAYLSLYMIDDALMMKNQLQ 704
            L+ YL FN F K  IEL   +KSK +YY S       +LLEAY +L M+      K Q+Q
Sbjct: 624  LVQYLRFNKFHKKLIELCQLLKSKGEYYESFKNDIRVWLLEAYTALKMVQAT---KLQIQ 680

Query: 705  KTMNL-STAKIEQA-------LLHASSLINVHLWDSDLTAFQIYFGKTLPAMKPELFDIN 756
              + + S+  IE+A        L+A  LI    W+ D  +F  +  + L   +   FDIN
Sbjct: 681  SVLKIHSSFSIERATFDSLYEYLYARLLIIS--WERDNDSFN-HLVQELRVSQTNFFDIN 737

Query: 757  NDHNLPMSLYIKVILLNIKIFNESAKLNIKAGNVISAVIDCRXXXXXXXXXXXXXXXXXX 816
            N+ NLP+S ++K++LLNI+I   ++ L     N+  ++++ +                  
Sbjct: 738  NNSNLPVSQFLKLLLLNIRIEKLASLLQFHNNNMFESLLEAKKALKLCQSLIKKQQKLSQ 797

Query: 817  GSRXXXXXXXXXXXXXXIKIHIRIGSARDCEFYSKELSRIISDLEEPIIVYRCLHFLHRY 876
              R              I I+I++G ++DCEFY K+  R++ +L++   +Y CL F++ Y
Sbjct: 798  FHRLEVISLLQDLFAQVIGIYIQVGVSKDCEFYVKDFMRVVGELQDWTPIYDCLCFVYDY 857

Query: 877  YMITEQTCLQNITLGKANKAFDYLDAEADITSLTMFLYDNKEFVKLEQSLVLYFGDQLEK 936
            Y +TEQ  L + TL + N+ FD LD   +I +L  F+Y N E  KL  SL L+F   LE 
Sbjct: 858  YKLTEQNQLASATLSRLNRTFDMLDGSENIDALAKFMYYNDEPDKLRNSLALFFSGDLED 917

Query: 937  TFLPNLWKLHLGKDIDDSICLSEYMPKNVINRVHNMWQKVMSQLEEDPFFKGMFESTLGI 996
            TFL + W L LG  I+++    +    + +N+ + ++ +++ Q+E DPFF  M ES + I
Sbjct: 918  TFLVDEWNLRLGIVIENTREQPQLKALSDVNKSNELYLRILKQMELDPFFSNMCESVIAI 977

Query: 997  PSSL-PVIPSTMPNNILKTPSKHSTGLKLCDSPRSSSMTPRGKNIRQKFDRIAAISKLKQ 1055
            PS   P +    P       +  S       SPR SS+TPRGK +RQKFDR  AI+ L+ 
Sbjct: 978  PSCFSPKVEEIRP----AVSNVWSPAGSPYHSPRPSSLTPRGKCLRQKFDRSNAINNLQM 1033

Query: 1056 MKELLESLKLDTLDNHEXXXXXXXXXXXXXXXXXXXXXHNAESSLITNFSLTDLPRHMPL 1115
            +K L+ES+ LD + NHE                      +   +LI  F++ +LP++MP+
Sbjct: 1034 IKRLIESVNLDEMQNHEVSKTSCLYSLSLSFLSNISSKTDFRHALIKRFTMAELPKYMPM 1093

Query: 1116 LFDKVLNNIDNKNYREF---RVSSLIAPNNISTITESIRVSAAQKDLMESNLNINVITID 1172
             +DK+ + + N+ Y  F    V S+  P      T   +V   Q +    +     I++D
Sbjct: 1094 YYDKMFSRMGNEVYGSFMPMEVKSMCTP----FFTVQQKVDGIQTNFNSWDEPFQAISVD 1149

Query: 1173 FCPITGNLLLSKLEPRRKRRTHLRLPLIRSNSRDLDEVHLSFPEATKKLLSIINESNQTT 1232
             C   G+LLLSK+     +  HLRLPL R  SRDL +  L+F    ++L  II ++N+TT
Sbjct: 1150 ICKYNGDLLLSKVVSTTGKHFHLRLPLNRHESRDLSQETLTFALLMEELNDIIEKNNRTT 1209

Query: 1233 SVEVTNKIKTREERKSWWTTRYDLDKRMQQLLNNIENSWFNGVQGFFSPEVVDNSLFEKF 1292
            S+EVT+ IKT+E+R+ WW  RY LDKRM  L+  IE+SW  G  GFFS + +D + F  F
Sbjct: 1210 SIEVTSVIKTKEDRREWWEERYSLDKRMCDLMRRIEDSWICGFCGFFSQKQLDKNHFALF 1269

Query: 1293 KDKFYEILHQNLPSRKLYGNPAMFIKVEDWVIELFLKLN----PQE--IDFLSKMEDLIY 1346
            K  F ++L QNLP+R+ YGNP+MF++V+D+++ELFLK++    P E  ++F   MEDLIY
Sbjct: 1270 KLGFQKVLQQNLPTRRQYGNPSMFLQVDDFILELFLKVDWDALPHEKKVEF---MEDLIY 1326

Query: 1347 FVLDILLFHGEENAYDEIDFSMLHVQLEEQIKKYRATMT-TNSIFHTFLVVSSSCHLFPW 1405
            F+ DILLFHGEENAYDEID  ++H+QLEE I  Y A       + HTFLV+SS C L PW
Sbjct: 1327 FIFDILLFHGEENAYDEIDVHLIHIQLEELIHDYHAKAPEAPRLGHTFLVISSECSLVPW 1386

Query: 1406 ECLSFLKDLSITRVPSYVCLNKLLSRFHYQLPLQVTIEDNISMILNPNGDLSRTESKFKG 1465
            E LS   D S++RVPS   L++LL++F  ++  ++ ++  +S++LNP+GDL+RTE +FK 
Sbjct: 1387 ESLSIFSDASVSRVPSINFLHELLTKFRGEISPKINLDSRLSIVLNPHGDLTRTELRFKE 1446

Query: 1466 MFQKIIDAKPSSQLVMNEKPEEETLLKMLQNSNLFVYIGHGGGEQYVRSKEIKKCTKIAP 1525
             F ++     S+++V   KPEE+  ++M+ NS+ F+YIGHGGGEQY RSK +K     AP
Sbjct: 1447 HFTRLCCDLGSTRIVTGSKPEEDEFVRMITNSSTFIYIGHGGGEQYFRSKTLKLQDNAAP 1506

Query: 1526 SFLLGCSSAAMKYYGKLEPTGTIYTYLLGGCPMVLGNLWDVTDKDIDKFSEELFEKMG 1583
            SFLLGCSSA M  YGKLEP+  +Y+YLLGG PMV+GNLWDVTDKDID F+E +  K+G
Sbjct: 1507 SFLLGCSSAYMIQYGKLEPSSVLYSYLLGGSPMVIGNLWDVTDKDIDAFTEAMSHKLG 1564

>Kwal_55.20535
          Length = 1636

 Score =  930 bits (2404), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 575/1617 (35%), Positives = 893/1617 (55%), Gaps = 64/1617 (3%)

Query: 2    MVKQEEPLNEISPNTPMTSKSYLLNDTLSKV----------HHSGQTRPLTSVLSGDASS 51
            M  +   LN+IS N+P    S L  DT   V             G+     S    + S 
Sbjct: 1    MAGKNIALNDISLNSPCKIVSSLEGDTSDCVKLKNAEILNTRMDGENMVYDSFWGFECSR 60

Query: 52   NSIGILAMHNNIIR----DFTKIASNNIDLAIEDITTVDHSLNSIYSLLKSHHMWGHINS 107
                 +A +++IIR    DF +         IED+  V      +Y      H +  +  
Sbjct: 61   -----IAPNSDIIRKRVRDFLQRP------CIEDVQEVSLGFKRLYRTYLWKHQFNLVKE 109

Query: 108  TVKQHLMIIVKLINNNALGLASSEIIFLFNETNLFQAHSLKNILLADFSTWNDYYLSNLK 167
             VKQ+++ I+K++   +   A  E++ ++NETN  +A SL+  LLAD +T NDYYLS LK
Sbjct: 110  LVKQNMLAIIKIVELQSYDAAVQEVLNIYNETNHHKAESLEQFLLADLTTSNDYYLSALK 169

Query: 168  ILALQIILKRKLVDEYLPHILELFSHDKRYLLKDPNLKAHALTKIVLSFFSVTTSCKVLF 227
            +LALQII+K K  D Y   IL+LF++D RY+L+   +K   LTKI+L+FFS+    K LF
Sbjct: 170  LLALQIIIKGKRQDFYGETILKLFANDSRYILRTEKIKIQPLTKILLNFFSLLPDFKALF 229

Query: 228  GLKFLQYIKQFKLPFKKFISNITVECFSKNLLHKNYLEMGPNKI--YLNSFYLSYSMLYD 285
             LKF+QY+KQF L F+ +I N+ +  F + +L   + +  P K   +L  FY SYS  + 
Sbjct: 230  SLKFMQYVKQFDLNFESYIKNMDMPKFQEMILI--WAQRSPTKTNGFLGLFYSSYSQYFQ 287

Query: 286  GLDKIMLLDILSYEETTEVQRAIKSKKEFNEYCNMSENRLLWSCISVDDLNVILENATNF 345
             +DKIML D+++      ++   K     + +   S+    ++ +S+ + N +LE   + 
Sbjct: 288  SVDKIMLHDLVNPSSRDRIKVISKGFNSLSSH-EWSQGIETFTNLSIIERNSLLEFIESQ 346

Query: 346  LQNK---GKHISATLKCLVCLWSTIRLEGLPKNKDILRQFDCTVIYINSNIKSINDXXXX 402
            L+ K    + ++  L+  + L +    E  P  + + R  D   ++INSN+ S++     
Sbjct: 347  LEEKKFDSQKVAILLRWFLQLANN---ELSPATRQLWRIVDRITVFINSNLHSLS----I 399

Query: 403  XXXXXXXXXXXXICIDYKEPKRLSNIISVLFNASVLFKSHSFLLKTANLEISNVLISNDS 462
                        +CI   EPKRL N+ +V FN+ ++FK+  F+L+ A  +++   I    
Sbjct: 400  HIVKELLDIIYDLCIVNLEPKRLLNVANVAFNSFIVFKNDIFVLQAAKFDLARQTIF--- 456

Query: 463  KTSHRTILKFEKFISSAQSAQKKIEIFSCLFNVYCMLRNDTLSFVFDFCQNAFIHCFTRL 522
            K     + + EKF+SSA +  + I++F+ +FNV+     ++L  + +   + F  C   +
Sbjct: 457  KQGGLDLTRLEKFLSSASNGHR-IKLFTDVFNVFTCFEYESLGSLTE-VTSRFAKCLRSV 514

Query: 523  KITKFIEFSNSSEIMLSVLYGNSSIENIPSENWSQLSRMIFCSLRGIFDLDPLELNNTFD 582
             I    E S +SE+M+ +L     +E      WS L+RM++ SL   +  D  +     D
Sbjct: 515  NIRASTELSGASELMICLLSTLRPLEPDSISCWSPLTRMLYHSLTN-YAKDNNKTEKCRD 573

Query: 583  KLHLLNKYELLIRIVYLLNLDMSKHLTTNLSKITKLYINKWLQKSDEKAERISSFEMDFV 642
             L  L  YE+LI+ +Y L L++ K  +  L+K++  +   W+++ + +   + S E   +
Sbjct: 574  TLDPLKHYEVLIKTIYSLGLEIKKSSSHCLAKVSDNFTENWVKRLNFRESTMISLEYSAI 633

Query: 643  KMLLCYLNFNNFDKLSIELSLCIK-SKEKYYSSIVPYADNYLLEAYLSLYMIDDALMMKN 701
            + L  YL FN F K  I+L+L +K S   YY      A   L+  Y+ L M    L   +
Sbjct: 634  RTLFGYLRFNKFHKKVIDLALALKNSPHPYYEYCAENAQEQLIRGYVGLQMKTRILEGCS 693

Query: 702  QLQKTMN---LSTAKIEQALLHASSLINVHLWDSDLTAFQIYFGKTLPAMKPELFDINND 758
            +L +      L   K +Q  ++A + + +  W  D   F   F + LP   PE+ D+ N 
Sbjct: 694  ELMRLAQNPRLENLKRDQIFMYAETQLEICFWKRDFDTFNKIFVEGLPITNPEVMDVTNT 753

Query: 759  HNLPMSLYIKVILLNIKIFNESAKLNIKAGNVISAVIDCRXXXXXXXXXXXXXXXXXXGS 818
              LP  LY+K ++L+I I   ++ L I AGN+I A+++ +                    
Sbjct: 754  LKLPTKLYLKCLVLSINIVGIASNLQIHAGNLIEALVEAKRSIKLCQTLLKKVTQLDQEI 813

Query: 819  RXXXXXXXXXXXXXXIKIHIRIGSARDCEFYSKELSRIISDLEEPIIVYRCLHFLHRYYM 878
            +              I I+ ++G +RDC+FY  E  R+   +++P++++ CL     YY 
Sbjct: 814  KWKVLTSLGTAFANIINIYTQLGVSRDCDFYVTEYLRVSCSMKDPVVIHECLQKCVGYYR 873

Query: 879  ITEQTCLQNITLGKANKAFDYLDAEADITSLTMFLYDNKEFVKLEQSLVLYFGDQLEKTF 938
            +T+Q  L +  L KAN  F+ LD   +   L +FL +N E  KL  SL L+F D   ++ 
Sbjct: 874  LTDQLSLADALLRKANGIFNQLDGSENFDDLALFLLNNGEHEKLANSLRLFFKDYFSESL 933

Query: 939  LPNLWKLHLGKDIDDSICLSEYMPKNVINRVHNMWQKVMSQLEEDPFFKGMFESTLGIPS 998
            L ++W L LG  ++     +     + IN    +++K+  Q++ D FF  + ES   IPS
Sbjct: 934  LVDIWSLALGGTLNRYHEDATLRRLSGINEGKQLYEKISKQMDTDAFFGSVKESVTTIPS 993

Query: 999  S-LPVI-----PSTMPNNILKTPSKHSTGLKLCD--SPRSSSMTPRGKNIRQKFDRIAAI 1050
              LP +     P+T       TP+K+  G+   +  SPR SS+TPRGK+++QKFDR  A+
Sbjct: 994  CVLPALEVRKHPATSVCE-FGTPTKNK-GIPFTNLNSPRPSSLTPRGKSLKQKFDRAKAL 1051

Query: 1051 SKLKQMKELLESLKLDTLDNHEXXXXXXXXXXXXXXXXXXXXXHNAESSLITNFSLTDLP 1110
            + L+ +K L+ SL  D + N+E                       + S++    +L +LP
Sbjct: 1052 NDLETVKRLVGSLSTDGMKNYEIVEASDLYSLVLSLLSSITTSRLSSSAIEQMLTLAELP 1111

Query: 1111 RHMPLLFDKVLNNIDNKNYREFRVSSLIAPNNISTITESIRVSAAQKDL-MESNLNI-NV 1168
            +  PL FDK+L++  N+ Y  F +   +    IS   +   +   Q D+   S+ ++ NV
Sbjct: 1112 KMRPLHFDKILSSQGNEIYGSF-IPLQVDCKRISIDNQLQDIVRNQTDMSFNSDPHLFNV 1170

Query: 1169 ITIDFCPITGNLLLSKLEPRRKRRTHLRLPLIRSNSRDLDEVHLSFPEATKKLLSIINES 1228
            + ID C ITG+L+L++ +  R +   LRLPL R +SRD+DEV LSF +A ++L SII ES
Sbjct: 1171 VCIDVCGITGDLILTRTDSGRNKVMCLRLPLSRGSSRDVDEVALSFHDAMEELKSIIKES 1230

Query: 1229 NQTTSVEVTNKIKTREERKSWWTTRYDLDKRMQQLLNNIENSWFNGVQGFFSPEVVDNSL 1288
            N TTS +VT  I T+++RK WW  RYDLD R++ L+  IENSWF+G + FF  E ++   
Sbjct: 1231 NITTSSDVTAAINTKDDRKQWWQRRYDLDARLRNLILKIENSWFSGFKTFFKQETIEQRH 1290

Query: 1289 FEKFKDKFYEILHQNLPSRKLYGNPAMFIKVEDWVIELFLKLNPQEIDFLSKMEDLIYFV 1348
             ++F+ K  EIL ++LP+RK +GNPA F +++D V++LFLKL+P + DF+  MEDLI+FV
Sbjct: 1291 LDRFRVKLEEILQESLPTRKQFGNPANFFRIDDVVLDLFLKLDPSDSDFMEMMEDLIFFV 1350

Query: 1349 LDILLFHGEENAYDEIDFSMLHVQLEEQIKKYRATM-TTNSIFHTFLVVSSSCHLFPWEC 1407
             D+LLFHGEENAYDEID +M+H+Q+EE IK++R T+     + HTFLVV S+ HL PWE 
Sbjct: 1351 FDLLLFHGEENAYDEIDVNMIHIQIEEFIKEFRTTVPPPPKLAHTFLVVCSAGHLMPWES 1410

Query: 1408 LSFLKDLSITRVPSYVCLNKLLSRFHYQLPLQVTIEDNISMILNPNGDLSRTESKFKGMF 1467
            L FL   SI+R+PS   L  L+ +  + +   V +E NIS+ILNP+GDL RT++ F   F
Sbjct: 1411 LEFLAKNSISRIPSTQILFDLIEKEQHLISPLVELEQNISVILNPDGDLVRTQADFICPF 1470

Query: 1468 QKIIDAKPSSQLVMNEKPEEETLLKMLQNSNLFVYIGHGGGEQYVRSKEIKKCTKIAPSF 1527
            ++     P S+L++ EKP+E+T L+ML  +  F+Y+GHGGGEQ+VR K+IK+   IAPSF
Sbjct: 1471 EEWCSHAPGSRLIVGEKPDEKTFLEMLTKAKTFIYVGHGGGEQFVRLKKIKQQNCIAPSF 1530

Query: 1528 LLGCSSAAMKYYGKLEPTGTIYTYLLGGCPMVLGNLWDVTDKDIDKFSEELFEKMGF 1584
            LLGCSSA M+ +GKLEP+G  Y+YLLGG  MV+GNLWDVTDKDIDKFS  +FEK+G 
Sbjct: 1531 LLGCSSAYMQNFGKLEPSGIAYSYLLGGSSMVVGNLWDVTDKDIDKFSRTMFEKLGL 1587

>KLLA0D15136g complement(1276819..1281594) similar to sp|Q03018
            Saccharomyces cerevisiae YGR098c ESP1 required for sister
            chromatid separation singleton, hypothetical start
          Length = 1591

 Score =  822 bits (2124), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 530/1569 (33%), Positives = 827/1569 (52%), Gaps = 102/1569 (6%)

Query: 49   ASSNSIGIL-AMHNNI--IRDFTKIAS--NNIDLAIEDITTVDHSLNSIYSLLKSHHMWG 103
            A+SNS  I  A  NN   + D+ K+    +N     E+   V+ S   +Y  L   H   
Sbjct: 31   ATSNSSKITTAQENNTNSLIDWKKLYDFVDNKSKDFENYIQVNDSFIQLYRQLIWRHQLK 90

Query: 104  HINSTVKQHLMIIVKLINNNALGLASSEIIFLFNETNLFQAHSLKNILLADFSTWNDYYL 163
             +    K+H+  I+ L+  N L  AS++I+ L+NETNL +A  + ++LL+DFS  N+ YL
Sbjct: 91   KLQELPKKHMNWIIFLMERNKLTQASNQILMLYNETNLIKAKGIDDVLLSDFSAGNENYL 150

Query: 164  SNLKILALQIILKRKLVDEYLPHILELFSHDKRYLLKDPNLKAHALTKIVLSFFSVTTSC 223
            + LK++ +Q+ILK    + +   +LE F+HD RYLLKDPN+K HAL K++L+FF++ T  
Sbjct: 151  ATLKVITMQLILKTGTTERHAESLLECFAHDTRYLLKDPNVKVHALVKLILNFFTLLTGF 210

Query: 224  KVLFGLKFLQYIKQFKLPFKKFISNITVECFSKNLLHKNYLEMGPN-KIYLNSFYLSYSM 282
            K LFGLKF+QY+ QFKL F  +I N+    F + +      ++  N  IYL  +Y  Y+ 
Sbjct: 211  KPLFGLKFVQYVNQFKLEFGNYIKNMDSSTFQRQITKLLRKDISVNCHIYLPKYYDEYTK 270

Query: 283  LYDGLDKIMLLDILSYEETTEVQRAIKSKKEFNEYCNMSENRLLWSCISVDDLNVILENA 342
              +  D++ L + L  +   +            + C    N+L     S   ++ +L   
Sbjct: 271  HMEN-DQVNLTEFLRTDVIGK------------DVCTEIRNQLRLQSFSAGKIDALLRP- 316

Query: 343  TNFLQNKGKHISATLKCLVCLWSTIRLEGLPKNKDILRQFDCTVIYINSNIKSINDXXXX 402
              FL     + S++  C                       D  +I +N++IK +N+    
Sbjct: 317  --FLYQAALNKSSSRLC-----------------------DSLIISVNNSIKDLNEEAVI 351

Query: 403  XXXXXXXXXXXXICIDYKEPKRLSNIISVLFNASV-----LFKSHSFLLK-TANLEISNV 456
                        I + +++ KR  N+ +VL+N  V     LF  H+ ++   A L  SN+
Sbjct: 352  YVLVYLSK----IFLSFEDFKRTDNVAAVLYNCFVTKRKLLFLEHAAMVNYRAYLRTSNI 407

Query: 457  LISNDSKTSHRTILKFEKFISSAQSAQKKIEIFSCLFNVYCMLRNDTLSFVFDFCQNAFI 516
            L             KFE+ I   Q    +  +FS + NV+ + + +TL  +++  + + +
Sbjct: 408  L---------EHFKKFERIIGCCQDRNVQKLLFSYVCNVFMIFKENTLQDMWNLTRKSLV 458

Query: 517  HCFTRLKITKFIEFSNSSEIMLSVLYGNSSIENIPSENWSQLSRMIFCSLRGIFDLDPLE 576
             CF R+K+ KF  F+ SSE ML +LY  S         WS L +M+   +  +   D L+
Sbjct: 459  PCFRRMKLDKFEIFNFSSEPMLCLLYSGSHFSY--QFKWSHLCQMLTDIVTDVKQSD-LQ 515

Query: 577  LNNTFDKLHLLNKYELLIRIVYLLNLDMSKHLTTNLSKITKLYINKWLQKSDEKAERISS 636
            ++   + L   +KYE+LI+ ++ LN +M+++    L K++ +Y+ KW+ K +E   ++S 
Sbjct: 516  IDMKINTLDSFSKYEVLIKSMFCLNSEMNRNSCLKLQKVSNIYLEKWVNKGNET--KLSD 573

Query: 637  FEMDFVKMLLCYLNFNNFDKLSIELSLCIKSKEKYYSSIVPYADNYLLEAYLSLYM---I 693
             E+  ++ ++ +L  N   KL+ E+   ++S ++Y +SI      +LLE+Y+ L +   +
Sbjct: 574  LELMLLESMMPFLLQNKIYKLTAEICTQLRSVQRY-ASIPDLISYWLLESYVGLQIGPKV 632

Query: 694  DDALMMKNQLQKTMNLSTAKIEQALLHAS--SLINVHLWDSDLTAFQIYFGKTLPAMKPE 751
            + ++M      K    S  ++    LH +   L+   LW  D+  F       L   +P 
Sbjct: 633  ELSIMETVSALKYQPSSFTEMNVDQLHTTLCILLTQVLWKKDIETFNKLIHDDLTRFRPN 692

Query: 752  LFDINNDHNLPMSLYIKVILLNIKIFNESAKLNIKAGNVISAVIDCRXXXXXXXXXXXXX 811
            LFDI N   +P++ Y+K+++LNIKI   ++ L +   NV  ++ +C+             
Sbjct: 693  LFDIQNKTKMPVAEYLKILMLNIKITRCASILQLSQNNVYMSLKECKRSLKICRLLIKKE 752

Query: 812  XXXXXGSRXXXXXXXXXXXXXXIKIHIRIGSARDCEFYSKELSRIISDLEEPIIVYRCLH 871
                   R              I I++  G  +DC F+  E   +I  L+ P  ++    
Sbjct: 753  AVLSAKYRFEVISLLDDIFQRIISIYVHTGIFKDCAFFITEYQEVIGSLDNPTALFNMFS 812

Query: 872  FLHRYYMITEQTCLQNITLGKANKAFDYLDAEADITSLTMFLYDNKEFVKLEQSLVLYFG 931
             L  YY + E++   +++L K N AFD +D  A+I +L  FLY NKE  KL  S+ L+FG
Sbjct: 813  CLCSYYQLIEESENASLSLTKMNAAFDQIDGSANIEALATFLYFNKESEKLNNSMRLFFG 872

Query: 932  DQLEKTFLPNLWKLHLGKDIDDSICLSEYMPKNVINRVHNMWQKVMSQLEEDPFFKGMFE 991
            D +  + +   W L   +         ++     +N    ++ KV  Q+  D FF+ M E
Sbjct: 873  DDVFISDIVEYWLLRSCQKTSTETTRKDFEAMVCMNNAKILYNKVQKQMATDTFFRSMGE 932

Query: 992  STLGIPSSLPVIPSTMPNNILKTPSKHSTGLK-LCDSPRSSSMTPRGKNIRQKFDRIAAI 1050
            S + IP+       ++              LK + DSPR SS+TPRGK++   FDR  AI
Sbjct: 933  SVMAIPACYDCDSISVDGRHKSLSLTSVQTLKSVNDSPRPSSLTPRGKSLAYSFDRSTAI 992

Query: 1051 SKLKQMKELLESLKLDTLDNHEXXXXXXXXXXXXXXXXXXXXXHNAESSLITNFSLTDLP 1110
            + L+     +++  +  L  HE                        ES L  NF L D P
Sbjct: 993  NNLQMTDRFIQNADIKALKAHEIRELASLHSLTLSLFFNMSTKTRLESQLGQNFRLRDHP 1052

Query: 1111 RHMPLLFDKVLNNIDNKNYREFRVSSLIAPNNISTITESIRVSAAQKDLME--------- 1161
            R + LL++K  +++  + Y  F       P  I+T  ES+ +S    +L           
Sbjct: 1053 RSLSLLYEKAFSDMGTEIYDSF------IPETIAT--ESVEMSECNMNLATIHSEFGKKW 1104

Query: 1162 SNLNINVITIDFCPITGNLLLSKLEPRRKRRTHLRLPLIRSNSRDLDEVHLSFPEATKKL 1221
            S+L+ NV+ ID C +TG+LL+++ +  R +  HLRLPL R NSRDL E  L F  A  +L
Sbjct: 1105 SHLSFNVVEIDICQLTGDLLITRFDTVRNKHLHLRLPLNRHNSRDLSEEVLGFEAALDEL 1164

Query: 1222 LSIINESNQTTSVEVTNKIKTREERKSWWTTRYDLDKRMQQLLNNIENSWFNGVQGFFSP 1281
              II+ +N TTS+EVT+ I T+E+RK+WW  RY L+ R+Q LL  IE+SWF G +G F+P
Sbjct: 1165 NHIISSNNCTTSIEVTSVITTKEQRKNWWDERYALNNRLQTLLTKIEDSWFCGFKGVFNP 1224

Query: 1282 EVVDNSLFEKFKDKFYEILHQNLPSRKLYGNPAMFIKVEDWVIELFLKLN----PQEIDF 1337
             +VD   FE FK  F  ILH +LPSRK       F++V++ +IELF+ L+    P E   
Sbjct: 1225 RIVDQQQFEIFKKGFQSILHTHLPSRKSSRQSDSFLQVDNMLIELFVLLDVINQPTE-KA 1283

Query: 1338 LSKMEDLIYFVLDILLFHGEENAYDEIDFSMLHVQLEEQIKKYRATMTT--NSIFHTFLV 1395
            +S MEDLIYFV DILLFHGE+NAYDEID +++HV+ EE +++Y A   T   ++ HTFL+
Sbjct: 1284 VSMMEDLIYFVFDILLFHGEQNAYDEIDVNLMHVKFEELLQEYNAESKTKDQTLDHTFLI 1343

Query: 1396 VSSSCHLFPWECLSFLKDLSITRVPSYVCLNKLLSRFHYQLPLQVTIEDNISMILNPNGD 1455
            + + CH  PWE L FLK +SI+RVPS   L++LL++ H +L   V + +N+S +LNP  D
Sbjct: 1344 LGNKCHSIPWESLDFLKSISISRVPSIKMLDELLTK-HSELSPCVNVSENLSFVLNPGND 1402

Query: 1456 LSRTESKFKGMFQKIIDAKPSSQLVMNEKPEEETLLKMLQNSNLFVYIGHGGGEQYVRSK 1515
            L RTE+ F   F  +  ++ +S+  + + P  +     + +SNLFVY+GH GGEQYV+ K
Sbjct: 1403 LGRTETVFSSEFIAMA-SRTNSKAFIGKPPTVDEFFHSVADSNLFVYVGHSGGEQYVKLK 1461

Query: 1516 EIKKCTKIAPSFLLGCSSAAMKYYGKLEPTGTIYTYLLGGCPMVLGNLWDVTDKDIDKFS 1575
            +++KC  +APS LLGCSSA +KY G  E +GTIY+YLLGG PMV+GNLWDVTDKD DK S
Sbjct: 1462 DLRKCNHLAPSLLLGCSSAHLKYCGTFESSGTIYSYLLGGSPMVVGNLWDVTDKDTDKLS 1521

Query: 1576 EELFEKMGF 1584
              +FEK GF
Sbjct: 1522 VSVFEKTGF 1530

>CAGL0G03223g complement(300119..304933) similar to sp|Q03018
            Saccharomyces cerevisiae YGR098c ESP1 required for sister
            chromatid separation, hypothetical start
          Length = 1604

 Score =  616 bits (1588), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 483/1631 (29%), Positives = 798/1631 (48%), Gaps = 98/1631 (6%)

Query: 2    MVKQEEPLNEISPNTPMTSKSYLLNDTLSKVHHSGQTRPLTSVLSGDASSNSIGILAMHN 61
            MV+ +  L+E+  N  +  +   L+ +L +               G    N+     MH 
Sbjct: 1    MVRFDNSLHEVDLNAQLGDEYKTLSHSLKR---------------GVTHDNNCTHHLMHQ 45

Query: 62   NIIRDFTKIASNNIDLAIED---ITTVDHSLNSIYSLLKSHHMWGHINSTVKQHLMIIVK 118
              + + +   SN   L + D    + ++ +L++ YS     H    IN   KQHL++IVK
Sbjct: 46   YTVSNLSYAVSN---LTVSDEGSSSEIETTLSNTYSYYYRIHGLRVINLITKQHLLLIVK 102

Query: 119  LINNNALGLASSEIIFLFNETNLFQAHSLKNILLADFSTWNDYYLSNLKILALQIILKRK 178
            LIN N L  AS  II L+N TN      ++ +LL D++  N  YLS+LKIL LQ +LK+ 
Sbjct: 103  LINGNCLNSASRNIISLYNNTNRNSISEIQQLLLCDYTKNNKEYLSSLKILVLQTLLKKH 162

Query: 179  LVDEYLPHILELFSHDKRYLLKDPNLKAHALTKIVLSFFSVTTSCKVLFGLKFLQYIKQF 238
             V E +  +++LF++D++ LL+D  LK + + K++L+++S     ++LFGLKFLQYI QF
Sbjct: 163  DVSESIISVIKLFAYDRKLLLEDHKLKKNTVIKLILNYYSKFKEYRLLFGLKFLQYIAQF 222

Query: 239  KLPFKKFISNITVECFSKNLLHKNYLEMGPNKIYLNSFYLSYSMLYDGLDKIMLLDILSY 298
               + +FI N+T + F + L  +          YL+ FY SY M Y   +   L    S 
Sbjct: 223  NFRYDEFIKNMTRDAFLQQLGRQKTSNNTLTSRYLSMFYFSYQMQYKS-NNDQLFSSTSA 281

Query: 299  EETTE----VQRAI----KSKKEFNEYCNMSENRLLWSCISVDDLNVILENATNFLQNKG 350
            E   E    +Q  +    ++++ F++Y  MS  +L       D +N+I E    F +   
Sbjct: 282  EHVPEGFFNLQNVVTNLERNERFFDKYM-MSTKQL------NDLINIIAEEGRVFEKELD 334

Query: 351  KHISATLKCLVCLWSTIRLEGLPKNKDILRQFDCTVIYINSNIKSINDXXXXXXXXXXXX 410
            +    ++  +  + S  +++    +K +L+  D  +I +NSN+K +++            
Sbjct: 335  E---KSILLIQRILSIFQIKCYEISKPVLKFLDKIIILLNSNVKYLSNDISPLIKLIESM 391

Query: 411  XXXXICIDYKEPKRLSNIISVLFNASVLFKSHSFLLKTANLEISNVLIS--NDSKTSHRT 468
                 C      K   N ++V +N ++  K+   LL  +  E S +L++     K     
Sbjct: 392  IQ--FCTTNSLHKTFENTMAVAYNIALKTKNSELLLLVSKFEFSRLLLNYKETEKIKPSD 449

Query: 469  ILKFEKFISSAQSAQKKIEIFSCLFNVYCMLRNDTLSFVFDFCQNAFIHCFTRLKIT--K 526
            + KF  F+S+ +  + + +I    ++       +  + V+  C+  +I    + KI   K
Sbjct: 450  LNKFNVFLSATKEIRNRYKILQIFYHHTLFDGKEHFNEVYAVCE--YIAAIVKRKIGTLK 507

Query: 527  FIEFSNSSEIMLSVLYGNSSIENIPSENWSQLSRMIFCSLRGIFD---LDPLELNNTFDK 583
            +      SE+M  ++ G   + N    N   +   I       F    L   E N++ ++
Sbjct: 508  WENLECKSEVMKGIIAG---VTNDRYPNNECMEPCILLLQSSFFPEKVLTSEEYNDSSNQ 564

Query: 584  LHLLNKYELLIRIVYLLNLDMSKHLTTNLSKITKLYINKWLQKSDEKAERISSFEMDFVK 643
              ++     L++  YLLN D++K  T  L ++TK +        D K    S  E DF+K
Sbjct: 565  DGIVYDVFPLLKCNYLLNNDIAKGRTMYLVQVTKTFCQ--FATKDNKVNYCSRIENDFIK 622

Query: 644  MLLCYLNFNNFDKLSIELSLCIKSKEKYYSSIVPYADNYLLEAYLSLYMIDDALMMKNQL 703
             LL YL+ N + KL + +   ++ + +YY ++   +++Y+     S       L +KN+ 
Sbjct: 623  KLLNYLSINGYHKLLLSVVGILEKRTEYYKTL---SNDYITYKAHSCM----RLKLKNRT 675

Query: 704  QKTMNLSTAKIEQALLHASSLINVHL--------WDSDLTAFQIYFGKTLPAMKPELFDI 755
            +   +  T +  +        I  HL        W+     F     +    +K  + D 
Sbjct: 676  KHVFDQFTNQKGEIKFDDEKDIYNHLIMSLLYASWEDSPELFTSSNERVPKDIKEHILDF 735

Query: 756  NNDHNLPMSLYIKVILLNIKIFNESAKLNIKAGNVISAVIDCRXXXXXXXXXXXXXXXXX 815
            + +    ++ Y + ++ NIK  N  A L  +      AV   +                 
Sbjct: 736  STNDKSNLNKYFQKLIFNIKFANYYASLLNQKKCYSYAVEVSKKGLKIGKSVLKIIEKLD 795

Query: 816  XGSRXXXXXXXXXXXXXXIKIHIRIGSARDCEFYSKELSRIISDLEEPIIVYRCLHFLHR 875
               R              IKI+  +G A+  ++Y KE+++++   ++PI ++     L  
Sbjct: 796  LNDRLTVLNQLVSSYSNLIKIYTAVGLAKGAQYYCKEVTKLLPVFDQPIFLFSVHVLLFE 855

Query: 876  YYMITEQTCLQNITLGKANKAFDYLDAEADITSLTMFLYDNKEFVKLEQSLVLYFGDQLE 935
            +Y+              AN  FD L+AE DI + T FLY N+E+ K+++SL LYFG  L 
Sbjct: 856  FYLENGDYDSALTHKKNANYVFDNLNAEHDIINTTSFLYINEEYDKIQESLRLYFGYDLN 915

Query: 936  KTFLPNLWKLHLGKDIDDSICLSEYMPKNVINRVHNMWQKVMSQLEEDPFFKGMFESTLG 995
             T     WKL LG   D+  C ++Y   N  N++ ++ Q+++ +++ DPF K + E+   
Sbjct: 916  DTDFFLSWKLKLGNICDE--CPTQYSNMNFFNKIVHINQRLVLEIDADPFLKSLNET--- 970

Query: 996  IPSSLPVIPSTMPNNILKTPSKHSTGLKLCDSPRSSSMTPRGKNIRQKFDRIAAISKLKQ 1055
            I ++L  +     +NIL         +    + RSS+MTP+ +    K ++   +  L +
Sbjct: 971  ILANLNCVSPGSLSNILDVGM-----ISSNSTNRSSNMTPKRRPTSFKTNKHIVMDILDE 1025

Query: 1056 MKELLESLKLDTLDNHEXXXXXXXXXXXXXXXXXXXXXHNAESSLI--TNFSLTDLPRHM 1113
                  +++ +  + +                        +   LI  T   L +LP  +
Sbjct: 1026 FFTTFNAMRQELTERNVILKVSDIYRLNYFYLISLLSVPESRKQLIEETITQLNELPSEI 1085

Query: 1114 PLLFDKVL--NNIDNKNYREFRVSS----LIAPNNISTITESIRVSAAQKDLME-SNLNI 1166
               ++ +L   N D      F + S    ++   N++   E       +  L++  N+ +
Sbjct: 1086 THTYESLLADKNCDIYGKTIFELESSNYEIMKSKNVTLNWEE---QIGKDRLLDLCNITV 1142

Query: 1167 NVITIDFCPITGNLLLSKLEPRRKRRTHLRLPLIRSNSRDLDEVHLSFPEATKKLLSIIN 1226
             VI ID C +T  L++ ++     +    ++P+ R+ SRDLD   L+F +A++ L  IIN
Sbjct: 1143 EVICIDICKLTNTLIIRRISNLDSKNIMAKIPIDRNVSRDLDADSLTFQQASESLQKIIN 1202

Query: 1227 ESNQTTSVEVTNKIKTREERKSWWTTRYDLDKRMQQLLNNIENSWFNGVQGFFSPEVVDN 1286
            +SN++ S  VT  IK + + ++WW  RYDLD+ +  L+  IE +W NG+ G  +    D 
Sbjct: 1203 DSNESVSKNVTETIKDKNDVRNWWKRRYDLDELLGNLIERIEKTWLNGLSGILNGLYCDK 1262

Query: 1287 SLFEKFKDKFYEILHQNLPSRKLYGNPAMFIKVEDWVIELFLKLNPQEIDFLSKMEDLIY 1346
                +F+ K   IL+Q LPSR+   N A F+++++W+I L L L+P ++ F + +ED+IY
Sbjct: 1263 DALLEFQSKITAILNQILPSRRNCCNRANFLQLDEWIISLLLDLDPSDLGFFTALEDVIY 1322

Query: 1347 FVLDILLFHGEENAYDEIDFSMLHVQLEEQIKKYRATMTT-NSIFHTFLVVSSSCHLFPW 1405
            F+LD L   GEENAYDEIDF +LHV LEE+I+K R        I HTFLVV  SCH FPW
Sbjct: 1323 FILDTLSHKGEENAYDEIDFGLLHVLLEEEIRKVRVNKKLFTKIEHTFLVVGPSCHTFPW 1382

Query: 1406 ECLSFLKDLSITRVPSYVCLNKLLSRFHYQLPLQVTIEDNISMILNPNGDLSRTESKFKG 1465
            E +  LK  S+TRVPS   L+ LLS     LP+++   ++ISMILN N DL RTE  FK 
Sbjct: 1383 EIMKPLKGRSVTRVPSLTILSNLLSSIKGNLPVKIERTNDISMILNSNSDLVRTEKTFKD 1442

Query: 1466 MFQKIIDAKPSSQLVMNEKPEEETLLKMLQNSNLFVYIGHGGGEQYVRSKEIKKCTKIAP 1525
            +F++I D++  S+L++N+KP EE  +  L NS +F+Y+GHGGGEQYVR+  I++C K+ P
Sbjct: 1443 IFERIQDSRAGSRLLVNQKPTEEEYMDYLTNSKVFLYVGHGGGEQYVRNCTIERCDKLPP 1502

Query: 1526 SFLLGCSSAAMKYYGKLEPTGTIYTYLLGGCPMVLGNLWDVTDKDIDKFSEELFEKMGFR 1585
             FL+GCSSAA K  G L P     +Y+ G   MVLGNLWDVTDKDIDKFS E+ EK    
Sbjct: 1503 VFLMGCSSAATKLNGNLNPNCVAESYMYGNSVMVLGNLWDVTDKDIDKFSIEMLEK---- 1558

Query: 1586 CNTDDLNGNSL 1596
            CN  D   N++
Sbjct: 1559 CNLLDAKPNTV 1569

>CAGL0F03861g complement(373691..374983) similar to sp|P07277
            Saccharomyces cerevisiae YMR208w ERG12 mevalonate kinase,
            hypothetical start
          Length = 430

 Score = 33.5 bits (75), Expect = 1.7,   Method: Compositional matrix adjust.
 Identities = 17/40 (42%), Positives = 23/40 (57%), Gaps = 1/40 (2%)

Query: 1554 GGCPMVLGNLWDVTDKDIDKFSEELFEKMGFRCNTDDLNG 1593
            GGC   + N  DV   ++DKF EEL +K G+   T +L G
Sbjct: 344  GGCAFTVLN-KDVPQTEVDKFKEELSKKHGYLSFTSELGG 382

>YOR380W (RDR1) [5153] chr15 (1051286..1052926) Protein with
           similarity to transcription factors, has Zn[2]-Cys[6]
           fungal-type binuclear cluster domain in the N-terminal
           region [1641 bp, 546 aa]
          Length = 546

 Score = 33.1 bits (74), Expect = 2.2,   Method: Compositional matrix adjust.
 Identities = 32/129 (24%), Positives = 58/129 (44%), Gaps = 15/129 (11%)

Query: 32  VHHSGQTRPLTSVLSGDASSNSIGILAMHNNIIRDFTKIASNNIDLAIEDITTVDHSLNS 91
           VH S    P  S+  GD   +    L + N+I+         N+ L I DI     +L++
Sbjct: 382 VHESPNAHPFLSLTKGDICLSLYRRLRLLNHIL-------DKNVVLQIIDIGNT--ALSA 432

Query: 92  IYSLLKSHHMWGHINSTVKQHLMIIVKLINNNALGLASSEIIFLFNETNL------FQAH 145
            Y+L+K    W ++ ST  Q++ +++ +    +L   ++ +  L N T +      F+A 
Sbjct: 433 AYALVKLDQAWWNVLSTSFQYVCVLLAIDTPESLSHVATAMKTLDNITQILGTRIAFEAQ 492

Query: 146 SLKNILLAD 154
               +LL D
Sbjct: 493 KTAKLLLED 501

>YGR133W (PEX4) [2090] chr7 (756899..757450) Ubiquitin-conjugating
            enzyme and peroxisomal biogenesis protein (peroxin) [552
            bp, 183 aa]
          Length = 183

 Score = 32.0 bits (71), Expect = 2.2,   Method: Compositional matrix adjust.
 Identities = 18/52 (34%), Positives = 27/52 (51%), Gaps = 3/52 (5%)

Query: 973  WQKVMSQLEEDPFFKGMFESTLGIPSSLPVIP---STMPNNILKTPSKHSTG 1021
            W+ ++S   + P+    F   + +PSS P+ P   S M NNIL    K +TG
Sbjct: 61   WEAIISGPSDTPYENHQFRILIEVPSSYPMNPPKISFMQNNILHCNVKSATG 112

>Kwal_23.3485
          Length = 688

 Score = 32.3 bits (72), Expect = 4.3,   Method: Compositional matrix adjust.
 Identities = 21/66 (31%), Positives = 30/66 (45%)

Query: 1298 EILHQNLPSRKLYGNPAMFIKVEDWVIELFLKLNPQEIDFLSKMEDLIYFVLDILLFHGE 1357
            E L +N+ S K+  +    +   D  I +FL    Q   F S +E+     L +LLF G 
Sbjct: 280  ETLAENIESFKVSKDIERLLTTRDRTIFVFLATLDQADPFWSDLEEWCTIRLKLLLFRGR 339

Query: 1358 ENAYDE 1363
            EN   E
Sbjct: 340  ENTEKE 345

  Database: blastdb
    Posted date:  Apr 3, 2006  3:33 PM
  Number of letters in database: 16,596,109
  Number of sequences in database:  34,618
  
Lambda     K      H
   0.321    0.136    0.395 

Gapped
Lambda     K      H
   0.267   0.0410    0.140 

Matrix: BLOSUM62
Gap Penalties: Existence: 11, Extension: 1
Number of Sequences: 34618
Number of Hits to DB: 51,605,459
Number of extensions: 2353061
Number of successful extensions: 7792
Number of sequences better than 10.0: 38
Number of HSP's gapped: 8034
Number of HSP's successfully gapped: 40
Length of query: 1601
Length of database: 16,596,109
Length adjustment: 115
Effective length of query: 1486
Effective length of database: 12,615,039
Effective search space: 18745947954
Effective search space used: 18745947954
Neighboring words threshold: 11
Window for multiple hits: 40
X1: 16 ( 7.4 bits)
X2: 38 (14.6 bits)
X3: 64 (24.7 bits)
S1: 41 (21.9 bits)
S2: 69 (31.2 bits)