Hit NameLength (aa)HSP LengthHSP ScoreHSP Significance
YGR096W (TPC1)31430916340.0
Scas_716.293163128141e-108
KLLA0D15015g3173066971e-90
CAGL0G03135g3073086924e-90
AAR036W3173046726e-87
Kwal_23.39653073046291e-80
YPR011C3263252652e-26
CAGL0J01661g3273202468e-24
KLLA0E02772g2843052431e-23
Sklu_2363.23233222432e-23
YHR002W (LEU5)3573222363e-22
Kwal_14.22103153202301e-21
Sklu_2334.23193142222e-20
Kwal_55.208683803072242e-20
Scas_578.3*5243212252e-20
CAGL0K02915g3423242204e-20
Kwal_55.213353173112194e-20
Scas_717.203563202189e-20
YJR095W (SFC1)3223082151e-19
AGL047C3163082115e-19
Kwal_23.30425423202156e-19
Scas_709.93653082118e-19
Scas_589.103162892081e-18
YNL083W5453252112e-18
Sklu_2432.52882912062e-18
Scas_632.92923172026e-18
CAGL0J05522g5193212068e-18
Sklu_2127.52783002001e-17
ADL009W3793012022e-17
YIL006W3733032012e-17
KLLA0C11363g5173202022e-17
CAGL0K10362g3013181983e-17
Sklu_2037.23103151983e-17
AGL311C3623141967e-17
Kwal_26.86692962781931e-16
YOR130C (ORT1)2923241921e-16
AER419W4931901942e-16
Kwal_33.140503143221913e-16
CAGL0M09020g3483271923e-16
CAGL0K11616g3203251895e-16
YOR100C (CRC1)3272991895e-16
CAGL0G08910g2891941861e-15
Scas_691.43343131871e-15
Scas_714.183053281851e-15
YJL133W (MRS3)3143021852e-15
YKR052C (MRS4)3042981833e-15
Sklu_2374.75131991863e-15
Scas_379.23012941823e-15
ACR109W2993001824e-15
KLLA0C13431g3282871816e-15
YEL006W3353201809e-15
Scas_667.43083051799e-15
Scas_582.73292941801e-14
Scas_721.273743561801e-14
KLLA0E18788g3813311792e-14
KLLA0F04697g3073161772e-14
CAGL0L05742g3053001772e-14
AGL065C3353211763e-14
Kwal_27.124813042851753e-14
KLLA0D07073g2972721744e-14
AGR383W2933081744e-14
KLLA0D14036g4313331764e-14
CAGL0J02002g3613021754e-14
ACR260W3112981745e-14
Sklu_2431.53703521746e-14
Scas_718.243372881746e-14
AFR146W2813051726e-14
YKL120W (OAC1)3243191736e-14
Scas_640.253062831737e-14
CAGL0B04543g3173041729e-14
KLLA0E23705g3683371739e-14
AFR131C3442661721e-13
Scas_721.1293233171711e-13
YBR085W (AAC3)3072891692e-13
Kwal_26.79723582811702e-13
CAGL0F04213g3062861683e-13
Scas_697.473283001683e-13
KLLA0E15532g3263131674e-13
AER184W3052911664e-13
YOR222W (ODC2)3072911665e-13
KLLA0B08503g3033031665e-13
Kwal_47.182163333251665e-13
Kwal_27.120813693201676e-13
ADL264C3292971666e-13
AEL253W3653471667e-13
YBL030C (PET9)3182881658e-13
Scas_667.223063091641e-12
Kwal_23.43543433531651e-12
CAGL0K08250g2973001622e-12
Kwal_26.76533253081613e-12
Sklu_2430.103243201603e-12
CAGL0F07711g3682521604e-12
CAGL0L02079g2973111594e-12
CAGL0K02365g9192941615e-12
KLLA0F03212g3053151585e-12
Sklu_1149.22963111585e-12
Kwal_23.29133203081586e-12
YIL134W (FLX1)3113231561e-11
Kwal_27.125993043021561e-11
AER366W2931801551e-11
CAGL0K12210g3113001551e-11
YPR021C (AGC1)9022961581e-11
ADL049W9122051581e-11
YMR056C (AAC1)3092871552e-11
CAGL0G01166g2953041532e-11
Sklu_1926.23053071533e-11
Scas_645.93911981533e-11
Scas_702.103023001524e-11
KLLA0E12353g3052911514e-11
Scas_718.53242991506e-11
Kwal_23.47313143131497e-11
Scas_662.123083171497e-11
YLR348C (DIC1)2982921481e-10
Sklu_2359.69021911501e-10
CAGL0D01606g3052981471e-10
Kwal_47.173218811791501e-10
KLLA0E09680g3072881472e-10
Scas_489.42971891452e-10
KLLA0E13453g9062771482e-10
YBR104W (YMC2)3293141453e-10
Scas_558.22892021443e-10
KLLA0F17864g3072031443e-10
YPL134C (ODC1)3102891444e-10
KLLA0E02750g3042841434e-10
KLLA0E18810g3773061437e-10
KLLA0B12826g3193191427e-10
Scas_715.453051851418e-10
YMR166C3681991411e-09
KLLA0D04290g1881521361e-09
YPR058W (YMC1)3073141373e-09
KLLA0A09383g3662251383e-09
Scas_669.63732511383e-09
Kwal_23.35293952231383e-09
Scas_602.88852251384e-09
YBR291C (CTP1)2993071364e-09
YER053C3001871356e-09
CAGL0B03883g3062971347e-09
Kwal_26.79672973111348e-09
Kwal_23.57573071831339e-09
Kwal_55.213383232811321e-08
Kwal_33.129883032041302e-08
Kwal_33.154463051651302e-08
Sklu_2442.82751951283e-08
AFR147C3152911284e-08
Kwal_56.230113032211284e-08
Kwal_27.114192983141275e-08
YBR192W (RIM2)3773571285e-08
Sklu_1275.13111971276e-08
Sklu_2398.43093041276e-08
KLLA0B14454g3051881259e-08
YGR257C (MTM1)3662001261e-07
AFL196W3612231232e-07
CAGL0M05225g3813581223e-07
KLLA0A00979g3431401223e-07
YDL198C (YHM1)3001831213e-07
Sklu_2127.43232831214e-07
Sklu_2075.33451641205e-07
CAGL0J09790g3001831196e-07
CAGL0F00231g3071831196e-07
Sklu_2260.53021921187e-07
CAGL0F08305g3742591198e-07
AGL064W296861188e-07
YJR077C (MIR1)3111801188e-07
Scas_687.15*3281551188e-07
Scas_705.93233001171e-06
Sklu_2433.84201561181e-06
Kwal_47.192282811391161e-06
Kwal_33.155973051921161e-06
CAGL0H03839g2822431151e-06
AER450C3082051162e-06
AFR253W3442491162e-06
Kwal_0.2322742001152e-06
Sklu_2435.23443351152e-06
Sklu_2115.42993111142e-06
Kwal_55.211063283101142e-06
KLLA0D04312g103891072e-06
Scas_673.173141601124e-06
YFR045W2852091124e-06
CAGL0C02013g3292231125e-06
KLLA0E08877g2943001116e-06
Sklu_1119.13072461107e-06
AAL014C2711951081e-05
KLLA0D09889g3642701081e-05
CAGL0J04114g3032121072e-05
YPR128C (ANT1)3283051072e-05
KLLA0D04950g2742001062e-05
Scas_562.123001831063e-05
KLLA0F13464g3001691044e-05
CAGL0H10538g2972561045e-05
KLLA0B11319g3552621037e-05
Scas_660.174972211029e-05
YNL003C (PET8)2841971001e-04
Scas_613.24177164972e-04
Kwal_27.11626299170982e-04
ABL023W309172983e-04
Scas_328.1227216963e-04
Sklu_2117.2298170973e-04
AGR191W298184974e-04
AEL060C429140920.002
YDL119C30757890.003
CAGL0D04774g322304890.003
Scas_671.1*12358820.006
CAGL0K06545g512244840.015
AFR373W467137820.025
YDR470C (UGO1)502101800.050
Sklu_2194.3312159780.083
Kwal_34.15907312167760.13
YMR241W (YHM2)314175740.22
AFR542W31095710.51
Sklu_2436.18494100691.2
KLLA0A05071g46595681.3
Scas_433.1116780644.5
KLLA0E22880g43682644.5
Scas_696.9312134634.8
KLLA0C00869g37354627.1
KLLA0E03399g480121627.5
Kwal_47.18297472100628.2
BLASTP 2.2.26 [Sep-21-2011]

Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, 
Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), 
"Gapped BLAST and PSI-BLAST: a new generation of protein database search
programs",  Nucleic Acids Res. 25:3389-3402.

Reference for compositional score matrix adjustment: Altschul, Stephen F., 
John C. Wootton, E. Michael Gertz, Richa Agarwala, Aleksandr Morgulis,
Alejandro A. Schaffer, and Yi-Kuo Yu (2005) "Protein database searches
using compositionally adjusted substitution matrices", FEBS J. 272:5101-5109.

Query= YGR096W
         (309 letters)

Database: blastdb 
           34,618 sequences; 16,596,109 total letters

Searching..................................................done

                                                                 Score    E
Sequences producing significant alignments:                      (bits) Value

YGR096W (TPC1) [2056] chr7 (676623..677567) Mitochondrial thiami...   634   0.0  
Scas_716.29                                                           318   e-108
KLLA0D15015g 1267803..1268756 similar to sp|P53257 Saccharomyces...   273   1e-90
CAGL0G03135g 290834..291757 similar to sp|P53257 Saccharomyces c...   271   4e-90
AAR036W [222] [Homologous to ScYGR096W - SH] complement(406887.....   263   6e-87
Kwal_23.3965                                                          246   1e-80
YPR011C (YPR011C) [5447] chr16 complement(583057..584037) Protei...   106   2e-26
CAGL0J01661g 154646..155629 highly similar to tr|Q12251 Saccharo...    99   8e-24
KLLA0E02772g complement(261895..262749) similar to sp|Q12375 Sac...    98   1e-23
Sklu_2363.2 YPR011C, Contig c2363 11969-12940                          98   2e-23
YHR002W (LEU5) [2287] chr8 (108806..109879) Protein with similar...    96   3e-22
Kwal_14.2210                                                           93   1e-21
Sklu_2334.2 YJR095W, Contig c2334 6303-7262 reverse complement         90   2e-20
Kwal_55.20868                                                          91   2e-20
Scas_578.3*                                                            91   2e-20
CAGL0K02915g 259026..260054 highly similar to sp|P38702 Saccharo...    89   4e-20
Kwal_55.21335                                                          89   4e-20
Scas_717.20                                                            89   9e-20
YJR095W (SFC1) [2987] chr10 (609690..610658) Mitochondrial membr...    87   1e-19
AGL047C [4264] [Homologous to ScYPR011C - NSH] (616853..617803) ...    86   5e-19
Kwal_23.3042                                                           87   6e-19
Scas_709.9                                                             86   8e-19
Scas_589.10                                                            85   1e-18
YNL083W (YNL083W) [4507] chr14 (471377..473014) Member of the mi...    86   2e-18
Sklu_2432.5 YLR348C, Contig c2432 10310-11176 reverse complement       84   2e-18
Scas_632.9                                                             82   6e-18
CAGL0J05522g complement(524930..526489) highly similar to sp|P48...    84   8e-18
Sklu_2127.5 YOR130C, Contig c2127 7354-8190 reverse complement         82   1e-17
ADL009W [1733] [Homologous to ScYIL006W - SH; ScYEL006W - SH] co...    82   2e-17
YIL006W (YIL006W) [2659] chr9 (344059..345180) Member of the mit...    82   2e-17
KLLA0C11363g complement(975442..976995) similar to sp|P48233 Sac...    82   2e-17
CAGL0K10362g complement(1009155..1010060) similar to sp|Q12375 S...    81   3e-17
Sklu_2037.2 YIL134W, Contig c2037 1645-2577 reverse complement         81   3e-17
AGL311C [4001] [Homologous to ScYJR095W (SFC1) - SH] (119645..12...    80   7e-17
Kwal_26.8669                                                           79   1e-16
YOR130C (ORT1) [4932] chr15 complement(569929..570807) Ornithine...    79   1e-16
AER419W [2919] [Homologous to ScYNL083W - SH] complement(1442595...    79   2e-16
Kwal_33.14050                                                          78   3e-16
CAGL0M09020g complement(896312..897358) highly similar to sp|P33...    79   3e-16
CAGL0K11616g complement(1121834..1122796) highly similar to sp|P...    77   5e-16
YOR100C (CRC1) [4905] chr15 complement(513295..514278) Mitochond...    77   5e-16
CAGL0G08910g complement(853693..854562) similar to sp|P40464 Sac...    76   1e-15
Scas_691.4                                                             77   1e-15
Scas_714.18                                                            76   1e-15
YJL133W (MRS3) [2785] chr10 (160537..161481) Member of the mitoc...    76   2e-15
YKR052C (MRS4) [3303] chr11 complement(532192..533106) Member of...    75   3e-15
Sklu_2374.7 YNL083W, Contig c2374 13874-15415 reverse complement       76   3e-15
Scas_379.2                                                             75   3e-15
ACR109W [1156] [Homologous to ScYOR222W (ODC2) - SH; ScYPL134C (...    75   4e-15
KLLA0C13431g 1145919..1146905 similar to sgd|S0005626 Saccharomy...    74   6e-15
YEL006W (YEL006W) [1417] chr5 (144326..145333) Member of the mit...    74   9e-15
Scas_667.4                                                             74   9e-15
Scas_582.7                                                             74   1e-14
Scas_721.27                                                            74   1e-14
KLLA0E18788g complement(1661093..1662238) similar to sp|P38702 S...    74   2e-14
KLLA0F04697g complement(461126..462049) similar to sp|P40464 Sac...    73   2e-14
CAGL0L05742g complement(630844..631761) similar to sp|P10566 Sac...    73   2e-14
AGL065C [4246] [Homologous to ScYHR002W (LEU5) - SH] (585963..58...    72   3e-14
Kwal_27.12481                                                          72   3e-14
KLLA0D07073g 606857..607750 similar to sp|Q03028 Saccharomyces c...    72   4e-14
AGR383W [4694] [Homologous to ScYDL119C - SH] complement(1436769...    72   4e-14
KLLA0D14036g complement(1203522..1204817) some similarities with...    72   4e-14
CAGL0J02002g 198226..199311 similar to sp|P40556 Saccharomyces c...    72   4e-14
ACR260W [1307] [Homologous to ScYJL133W (MRS3) - SH; ScYKR052C (...    72   5e-14
Sklu_2431.5 YBR192W, Contig c2431 8526-9638                            72   6e-14
Scas_718.24                                                            72   6e-14
AFR146W [3338] [Homologous to ScYOR130C (ORT1) - SH] complement(...    71   6e-14
YKL120W (OAC1) [3145] chr11 (216990..217964) Mitochondrial oxalo...    71   6e-14
Scas_640.25                                                            71   7e-14
CAGL0B04543g 441599..442552 highly similar to tr|Q12289 Saccharo...    71   9e-14
KLLA0E23705g complement(2099965..2101071) highly similar to sp|P...    71   9e-14
AFR131C [3323] [Homologous to ScYGR257C - SH] (672999..674033) [...    71   1e-13
Scas_721.129                                                           70   1e-13
YBR085W (AAC3) [275] chr2 (415940..416863) ADP/ATP transporter p...    70   2e-13
Kwal_26.7972                                                           70   2e-13
CAGL0F04213g 419473..420393 highly similar to sp|P18239 Saccharo...    69   3e-13
Scas_697.47                                                            69   3e-13
KLLA0E15532g complement(1383230..1384210) similar to sp|P23500 S...    69   4e-13
AER184W [2686] [Homologous to ScYBL030C (PET9) - SH; ScYBR085W (...    69   4e-13
YOR222W (ODC2) [5014] chr15 (758330..759253) 2-Oxodicarboxylate ...    69   5e-13
KLLA0B08503g complement(753498..754409) similar to sp|P32331 Sac...    69   5e-13
Kwal_47.18216                                                          69   5e-13
Kwal_27.12081                                                          69   6e-13
ADL264C [1477] [Homologous to ScYOR100C (CRC1) - SH] (241532..24...    69   6e-13
AEL253W [2253] [Homologous to ScYBR192W (RIM2) - SH] complement(...    69   7e-13
YBL030C (PET9) [164] chr2 complement(163006..163962) ADP/ATP car...    68   8e-13
Scas_667.22                                                            68   1e-12
Kwal_23.4354                                                           68   1e-12
CAGL0K08250g complement(820185..821078) highly similar to sp|P23...    67   2e-12
Kwal_26.7653                                                           67   3e-12
Sklu_2430.10 YKL120W, Contig c2430 18856-19830                         66   3e-12
CAGL0F07711g complement(751794..752900) similar to sp|Q03829 Sac...    66   4e-12
CAGL0L02079g 243467..244360 highly similar to sp|P38152 Saccharo...    66   4e-12
CAGL0K02365g 212702..215461 highly similar to tr|Q12482 Saccharo...    67   5e-12
KLLA0F03212g 302915..303832 highly similar to sp|P33303 Saccharo...    65   5e-12
Sklu_1149.2 YBR291C, Contig c1149 2019-2909 reverse complement         65   5e-12
Kwal_23.2913                                                           65   6e-12
YIL134W (FLX1) [2542] chr9 (97395..98330) Protein involved in tr...    65   1e-11
Kwal_27.12599                                                          65   1e-11
AER366W [2867] [Homologous to ScYIL134W (FLX1) - SH] complement(...    64   1e-11
CAGL0K12210g 1193771..1194706 similar to sp|P38087 Saccharomyces...    64   1e-11
YPR021C (AGC1) [5455] chr16 complement(600644..603352) Member of...    65   1e-11
ADL049W [1692] [Homologous to ScYPR021C - SH] complement(598135....    65   1e-11
YMR056C (AAC1) [4016] chr13 complement(387314..388243) ADP/ATP c...    64   2e-11
CAGL0G01166g complement(111298..112185) highly similar to tr|Q06...    64   2e-11
Sklu_1926.2 YPR058W, Contig c1926 347-1264 reverse complement          64   3e-11
Scas_645.9                                                             64   3e-11
Scas_702.10                                                            63   4e-11
KLLA0E12353g complement(1092303..1093220) gi|1351895|sp|P49382|A...    63   4e-11
Scas_718.5                                                             62   6e-11
Kwal_23.4731                                                           62   7e-11
Scas_662.12                                                            62   7e-11
YLR348C (DIC1) [3731] chr12 complement(826976..827872) Mitochond...    62   1e-10
Sklu_2359.6 YPR021C, Contig c2359 14617-17325                          62   1e-10
CAGL0D01606g complement(169066..169983) highly similar to sp|P32...    61   1e-10
Kwal_47.17321                                                          62   1e-10
KLLA0E09680g complement(860245..861168) similar to ca|CA5146|CaY...    61   2e-10
Scas_489.4                                                             60   2e-10
KLLA0E13453g complement(1184806..1187526) similar to sgd|S000622...    62   2e-10
YBR104W (YMC2) [293] chr2 (449624..450613) Member of the mitocho...    60   3e-10
Scas_558.2                                                             60   3e-10
KLLA0F17864g complement(1634241..1635164) similar to sp|P32331 S...    60   3e-10
YPL134C (ODC1) [5311] chr16 complement(298570..299502) 2-Oxodica...    60   4e-10
KLLA0E02750g 260854..261768 similar to ca|CA6127|IPF149 Candida ...    60   4e-10
KLLA0E18810g 1663220..1664353 some similarities with sp|P38152 S...    60   7e-10
KLLA0B12826g 1121106..1122065 similar to sp|P32332 Saccharomyces...    59   7e-10
Scas_715.45                                                            59   8e-10
YMR166C (YMR166C) [4121] chr13 complement(593366..594472) Member...    59   1e-09
KLLA0D04290g 366536..367102 similar to sgd|S0006215 Saccharomyce...    57   1e-09
YPR058W (YMC1) [5488] chr16 (673746..674669) Member of the mitoc...    57   3e-09
KLLA0A09383g complement(818752..819852) similar to sp|P53320 Sac...    58   3e-09
Scas_669.6                                                             58   3e-09
Kwal_23.3529                                                           58   3e-09
Scas_602.8                                                             58   4e-09
YBR291C (CTP1) [469] chr2 complement(783631..784530) Mitochondri...    57   4e-09
YER053C (PIC2) [1481] chr5 complement(258736..259638) Member of ...    57   6e-09
CAGL0B03883g 383602..384522 weakly similar to sp|P32331 Saccharo...    56   7e-09
Kwal_26.7967                                                           56   8e-09
Kwal_23.5757                                                           56   9e-09
Kwal_55.21338                                                          55   1e-08
Kwal_33.12988                                                          55   2e-08
Kwal_33.15446                                                          55   2e-08
Sklu_2442.8 YNL003C, Contig c2442 12309-13136                          54   3e-08
AFR147C [3339] [Homologous to NOHBY] (703270..704217) [948 bp, 3...    54   4e-08
Kwal_56.23011                                                          54   4e-08
Kwal_27.11419                                                          54   5e-08
YBR192W (RIM2) [375] chr2 (607609..608742) Member of the mitocho...    54   5e-08
Sklu_1275.1 , Contig c1275 314-1249                                    54   6e-08
Sklu_2398.4 , Contig c2398 9476-10405                                  54   6e-08
KLLA0B14454g complement(1268709..1269626) highly similar to sp|P...    53   9e-08
YGR257C (MTM1) [2204] chr7 complement(1006210..1007310) Member o...    53   1e-07
AFL196W [2999] [Homologous to ScYMR166C - SH] complement(66955.....    52   2e-07
CAGL0M05225g 563163..564308 highly similar to sp|P38127 Saccharo...    52   3e-07
KLLA0A00979g complement(92561..93592) weakly similar to sp|P3815...    52   3e-07
YDL198C (GGC1) [676] chr4 complement(103650..104552) Member of t...    51   3e-07
Sklu_2127.4 , Contig c2127 6322-7293                                   51   4e-07
Sklu_2075.3 , Contig c2075 6414-7451 reverse complement                51   5e-07
CAGL0J09790g complement(957759..958661) highly similar to sp|P38...    50   6e-07
CAGL0F00231g 29705..30628 highly similar to sp|P23641 Saccharomy...    50   6e-07
Sklu_2260.5 YER053C, Contig c2260 6981-7889 reverse complement         50   7e-07
CAGL0F08305g complement(827705..828829) similar to sp|P53320 Sac...    50   8e-07
AGL064W [4247] [Homologous to ScYBR291C (CTP1) - SH] complement(...    50   8e-07
YJR077C (MIR1) [2970] chr10 complement(577169..578104) Phosphate...    50   8e-07
Scas_687.15*                                                           50   8e-07
Scas_705.9                                                             50   1e-06
Sklu_2433.8 YFR045W, Contig c2433 11995-13257 reverse complement       50   1e-06
Kwal_47.19228                                                          49   1e-06
Kwal_33.15597                                                          49   1e-06
CAGL0H03839g 359987..360835 highly similar to sp|P38921 Saccharo...    49   1e-06
AER450C [2950] [Homologous to ScYJR077C (MIR1) - SH] (1500683..1...    49   2e-06
AFR253W [3445] [Homologous to ScYFR045W - SH] complement(892939....    49   2e-06
Kwal_0.232                                                             49   2e-06
Sklu_2435.2 YPR128C, Contig c2435 2489-3523 reverse complement         49   2e-06
Sklu_2115.4 YDL119C, Contig c2115 2906-3805                            49   2e-06
Kwal_55.21106                                                          49   2e-06
KLLA0D04312g 367160..367471 highly similar to sgd|S0006215 Sacch...    46   2e-06
Scas_673.17                                                            48   4e-06
YFR045W (YFR045W) [1727] chr6 (242129..242986) Member of the mit...    48   4e-06
CAGL0C02013g complement(209930..210919) weakly similar to sp|P38...    48   5e-06
KLLA0E08877g complement(791157..792041) similar to sgd|S0002277 ...    47   6e-06
Sklu_1119.1 YJR077C, Contig c1119 366-1289                             47   7e-06
AAL014C [173] [Homologous to ScYNL003C (PET8) - SH] (317388..318...    46   1e-05
KLLA0D09889g complement(834904..835998) similar to sp|Q03829 Sac...    46   1e-05
CAGL0J04114g complement(384321..385232) similar to sp|Q99297 Sac...    46   2e-05
YPR128C (ANT1) [5547] chr16 complement(791212..792198) Peroxisom...    46   2e-05
KLLA0D04950g 424550..425374 similar to sp|P38921 Saccharomyces c...    45   2e-05
Scas_562.12                                                            45   3e-05
KLLA0F13464g 1246646..1247548 highly similar to sp|P38988 Saccha...    45   4e-05
CAGL0H10538g 1027739..1028632 highly similar to tr|Q07534 Saccha...    45   5e-05
KLLA0B11319g 988293..989360 similar to sgd|S0006332 Saccharomyce...    44   7e-05
Scas_660.17                                                            44   9e-05
YNL003C (PET8) [4582] chr14 complement(624974..625828) Protein o...    43   1e-04
Scas_613.24                                                            42   2e-04
Kwal_27.11626                                                          42   2e-04
ABL023W [569] [Homologous to ScYKL120W (OAC1) - SH] complement(3...    42   3e-04
Scas_328.1                                                             42   3e-04
Sklu_2117.2 YDL198C, Contig c2117 3737-4633                            42   3e-04
AGR191W [4502] [Homologous to ScYDL198C (YHM1) - SH] complement(...    42   4e-04
AEL060C [2446] [Homologous to NOHBY] (525069..526358) [1290 bp, ...    40   0.002
YDL119C (YDL119C) [751] chr4 complement(246689..247612) Member o...    39   0.003
CAGL0D04774g complement(467712..468680) similar to tr|Q06497 Sac...    39   0.003
Scas_671.1*                                                            36   0.006
CAGL0K06545g complement(641129..642667) similar to tr|Q03327 Sac...    37   0.015
AFR373W [3565] [Homologous to ScYDR470C (UGO1) - SH] complement(...    36   0.025
YDR470C (UGO1) [1287] chr4 complement(1399694..1401202) Protein ...    35   0.050
Sklu_2194.3 YMR241W, Contig c2194 5245-6183                            35   0.083
Kwal_34.15907                                                          34   0.13 
YMR241W (YHM2) [4197] chr13 (751960..752904) Suppressor of abf1 ...    33   0.22 
AFR542W [3734] [Homologous to ScYMR241W (YHM2) - SH] complement(...    32   0.51 
Sklu_2436.18 YDR470C, Contig c2436 37947-39431 reverse complement      31   1.2  
KLLA0A05071g complement(452333..453730) similar to sp|P25340 Sac...    31   1.3  
Scas_433.1                                                             29   4.5  
KLLA0E22880g complement(2033077..2034387) similar to ca|CA2800|I...    29   4.5  
Scas_696.9                                                             29   4.8  
KLLA0C00869g 64120..65241 similar to sgd|S0002939 Saccharomyces ...    28   7.1  
KLLA0E03399g 317949..319391 similar to sgd|S0002878 Saccharomyce...    28   7.5  
Kwal_47.18297                                                          28   8.2  

>YGR096W (TPC1) [2056] chr7 (676623..677567) Mitochondrial thiamine
           pyrophosphate transporter, controls import of thiamine
           pyrophosphate during growth on fermentative carbon
           sources, member of the mitochondrial carrier family
           (MCF) of membrane transporters [945 bp, 314 aa]
          Length = 314

 Score =  634 bits (1634), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 309/309 (100%), Positives = 309/309 (100%)

Query: 1   MFKEEDSLRKGQNVAAWKTLLAGAVSGLLARSITAPMDTIKIRLQLTPANGLKPFGSQVM 60
           MFKEEDSLRKGQNVAAWKTLLAGAVSGLLARSITAPMDTIKIRLQLTPANGLKPFGSQVM
Sbjct: 1   MFKEEDSLRKGQNVAAWKTLLAGAVSGLLARSITAPMDTIKIRLQLTPANGLKPFGSQVM 60

Query: 61  EVARSMIKNEGIRSFWKGNIPGSLLYVTYGSAQFSSYSLFNRYLTPFGLEARLHSLVVGA 120
           EVARSMIKNEGIRSFWKGNIPGSLLYVTYGSAQFSSYSLFNRYLTPFGLEARLHSLVVGA
Sbjct: 61  EVARSMIKNEGIRSFWKGNIPGSLLYVTYGSAQFSSYSLFNRYLTPFGLEARLHSLVVGA 120

Query: 121 FAGITSSIVSYPFDVLRTRLVANNQMHSMSITREVRDIWKLEGLPGFFKGSIASMTTITL 180
           FAGITSSIVSYPFDVLRTRLVANNQMHSMSITREVRDIWKLEGLPGFFKGSIASMTTITL
Sbjct: 121 FAGITSSIVSYPFDVLRTRLVANNQMHSMSITREVRDIWKLEGLPGFFKGSIASMTTITL 180

Query: 181 TASIMFGTYETIRIYCDENEKTTAAHKKWELATLNHSAGTIGGVIAKIITFPLETIRRRM 240
           TASIMFGTYETIRIYCDENEKTTAAHKKWELATLNHSAGTIGGVIAKIITFPLETIRRRM
Sbjct: 181 TASIMFGTYETIRIYCDENEKTTAAHKKWELATLNHSAGTIGGVIAKIITFPLETIRRRM 240

Query: 241 QFMNSKHLEKFSRHSSVYGSYKGYGFARIGLQILKQEGVSSLYRGILVALSKTIPTTFVS 300
           QFMNSKHLEKFSRHSSVYGSYKGYGFARIGLQILKQEGVSSLYRGILVALSKTIPTTFVS
Sbjct: 241 QFMNSKHLEKFSRHSSVYGSYKGYGFARIGLQILKQEGVSSLYRGILVALSKTIPTTFVS 300

Query: 301 FWGYETAIH 309
           FWGYETAIH
Sbjct: 301 FWGYETAIH 309

>Scas_716.29
          Length = 316

 Score =  318 bits (814), Expect = e-108,   Method: Compositional matrix adjust.
 Identities = 161/312 (51%), Positives = 224/312 (71%), Gaps = 19/312 (6%)

Query: 6   DSLRKGQNVAAWKTLLAGAVSGLLARSITAPMDTIKIRLQLTPA-NGLKPFGSQVMEVAR 64
           D LRKG++V   ++L+AG+VSGLLAR++ AP+DT+KIRLQL P+  G  P G  ++++ +
Sbjct: 12  DHLRKGEDVKVSQSLVAGSVSGLLARTVIAPLDTLKIRLQLRPSYTGQAPSG--LLKMMK 69

Query: 65  SMIKNEG-IRSFWKGNIPGSLLYVTYGSAQFSSYSLFNRYLTPFG----LEARLHSLVVG 119
            MI NEG +RSFWKGN+PG+++YV YG AQFSSYS +N     FG    +  +L SLVVG
Sbjct: 70  GMILNEGGLRSFWKGNVPGTMMYVLYGGAQFSSYSFYNNL---FGETSDMNGQLQSLVVG 126

Query: 120 AFAGITSSIVSYPFDVLRTRLVANNQMHSMSITREVRDIWKLEGLPGFFKGSIASMTTIT 179
           A AG+TSS VSYP DVLRTR +AN  +   S++   ++IW +EG+PGFF+G  ASM TIT
Sbjct: 127 ALAGMTSSFVSYPTDVLRTRFIANQDVALSSLSHGCKEIWNMEGIPGFFRGCTASMFTIT 186

Query: 180 LTASIMFGTYETIRIYCDENEKTTAAHKKWELATLNHSAGTIGGVIAKIITFPLETIRRR 239
           L+ASI+FGTYE+I+IYCDE  K +          L +SA +I GV +K++T+PL+TIRRR
Sbjct: 187 LSASILFGTYESIKIYCDEYSKESDYTNY-----LRYSASSISGVTSKMVTYPLDTIRRR 241

Query: 240 MQFMNSKHLEKFSRH---SSVYGSYKGYGFARIGLQILKQEGVSSLYRGILVALSKTIPT 296
           +Q  NS +++    +   + +Y SYKG  F R+GL IL+QEG+ SLY+G+ ++L KT+P+
Sbjct: 242 IQVRNSVYVQHNVENKIVTEIYQSYKGASFIRMGLNILRQEGLLSLYQGVSMSLCKTVPS 301

Query: 297 TFVSFWGYETAI 308
           T VS W YET +
Sbjct: 302 TVVSLWAYETVM 313

>KLLA0D15015g 1267803..1268756 similar to sp|P53257 Saccharomyces
           cerevisiae YGR096w, start by similarity
          Length = 317

 Score =  273 bits (697), Expect = 1e-90,   Method: Compositional matrix adjust.
 Identities = 140/306 (45%), Positives = 199/306 (65%), Gaps = 14/306 (4%)

Query: 4   EEDSLRKGQNVAAWKTLLAGAVSGLLARSITAPMDTIKIRLQLTPANGLKPFGSQVMEVA 63
            +D LRKG+ V+ + +++AG+VSG+ AR  TAPMDT+KIR QL P    K  G  +    
Sbjct: 6   RKDHLRKGETVSWYNSVIAGSVSGVFARMATAPMDTVKIRYQLQPVQEDKYKG--IASTV 63

Query: 64  RSMIKNEGIRSFWKGNIPGSLLYVTYGSAQFSSYSLFNRYLTP----FGLEARLHSLVVG 119
           R+++K EG+R+ WKGNIP + +YV YG+ QF SYS FN   +     F  +    +L VG
Sbjct: 64  RTIMKEEGLRALWKGNIPATAMYVVYGAVQFGSYSWFNNVWSAKFPRFSQQG--QTLTVG 121

Query: 120 AFAGITSSIVSYPFDVLRTRLVANNQMHSMSITREVRDIWKLEGLPGFFKGSIASMTTIT 179
           A AG+TSS+VSYP D+LRTRL+AN   H  S+  E R +W  EG+ GFF G   +MTT+T
Sbjct: 122 ALAGMTSSVVSYPLDLLRTRLIANRTSHRTSVAEECRQMWLNEGVRGFFTGISTAMTTVT 181

Query: 180 LTASIMFGTYETIRIYCDENEKTTAAHKKWELATLNHSAGTIGGVIAKIITFPLETIRRR 239
           L+ +IMF TYET+ I C+ +EK     + W    ++ S+G I G ++K + FP++T+RRR
Sbjct: 182 LSTAIMFLTYETVNIVCENHEK-----EFWSRP-VSASSGIIAGFVSKTMVFPIDTLRRR 235

Query: 240 MQFMNSKHLEKFSRHSSVYGSYKGYGFARIGLQILKQEGVSSLYRGILVALSKTIPTTFV 299
           MQ MNSK    F++  +VY  Y+      I  +IL+QEGVS+LYRG+ + L K++PTT +
Sbjct: 236 MQVMNSKRTVHFTKFPAVYHEYRYKSSTAIIYKILRQEGVSALYRGLTMGLCKSVPTTAI 295

Query: 300 SFWGYE 305
           S + YE
Sbjct: 296 SLFVYE 301

 Score = 55.5 bits (132), Expect = 1e-08,   Method: Compositional matrix adjust.
 Identities = 42/195 (21%), Positives = 83/195 (42%), Gaps = 23/195 (11%)

Query: 114 HSLVVGAFAGITSSIVSYPFDVLRTR--LVANNQMHSMSITREVRDIWKLEGLPGFFKGS 171
           +S++ G+ +G+ + + + P D ++ R  L    +     I   VR I K EGL   +KG+
Sbjct: 20  NSVIAGSVSGVFARMATAPMDTVKIRYQLQPVQEDKYKGIASTVRTIMKEEGLRALWKGN 79

Query: 172 IASMTTITLTASIMFGTYETIRIYCDENEKTTAAHKKWELATLNHSAGTIGGVIAKIITF 231
           I +     +  ++ FG+Y         N   +A   ++       + G + G+ + ++++
Sbjct: 80  IPATAMYVVYGAVQFGSYSWF------NNVWSAKFPRFSQQGQTLTVGALAGMTSSVVSY 133

Query: 232 PLETIRRRMQFMNSKHLEKFSRHSSVYGSYKGYGFARIGLQILKQEGVSSLYRGILVALS 291
           PL+ +R R+    + H    +                   Q+   EGV   + GI  A++
Sbjct: 134 PLDLLRTRLIANRTSHRTSVAEECR---------------QMWLNEGVRGFFTGISTAMT 178

Query: 292 KTIPTTFVSFWGYET 306
               +T + F  YET
Sbjct: 179 TVTLSTAIMFLTYET 193

>CAGL0G03135g 290834..291757 similar to sp|P53257 Saccharomyces
           cerevisiae YGR096w, hypothetical start
          Length = 307

 Score =  271 bits (692), Expect = 4e-90,   Method: Compositional matrix adjust.
 Identities = 136/308 (44%), Positives = 198/308 (64%), Gaps = 14/308 (4%)

Query: 3   KEEDSLRKGQNVAAWKTLLAGAVSGLLARSITAPMDTIKIRLQLTPANGLKPFGSQVMEV 62
            ++D LRK + V+   +L+AG++SGL AR+  AP+DT+KI+LQ+TP N       +   V
Sbjct: 2   NKKDHLRKDEEVSTTNSLVAGSLSGLFARTCIAPLDTVKIKLQVTPHN-------KNANV 54

Query: 63  ARSMIKNEGIRSFWKGNIPGSLLYVTYGSAQFSSYSLFNRYLT---PFGLEARLHSLVVG 119
             +++K EGIR FWKGN+PGS++Y+ YG AQF SY+    +L       +  +L+S +VG
Sbjct: 55  LINILKREGIRGFWKGNVPGSIMYIIYGGAQFGSYTYIGSFLRGGLDLNISPQLYSCLVG 114

Query: 120 AFAGITSSIVSYPFDVLRTRLVANNQMHSMSITREVRDIWKLEGLPGFFKGSIASMTTIT 179
           + AG+TSS+ SYPFDVLRTR  AN+Q   + +  E+  IW  EGL GFF G  +SM  I 
Sbjct: 115 SLAGMTSSLASYPFDVLRTRFAANSQGQLIKLRDEIMAIWSHEGLMGFFSGCGSSMINIG 174

Query: 180 LTASIMFGTYETIRIYCDENEKTTAAHKKWELATLNHSAGTIGGVIAKIITFPLETIRRR 239
           L  +IMFG YE+I+I+ +E  K +     + L  LN  AG I G  +K+ TFPL+T+RRR
Sbjct: 175 LNTAIMFGVYESIKIFTEERSKLSDRRDPFTL--LNELAGPISGFTSKLATFPLDTVRRR 232

Query: 240 MQFMNSKHLEKFSRH--SSVYGSYKGYGFARIGLQILKQEGVSSLYRGILVALSKTIPTT 297
           +Q  NS + E+  R     +Y SYK   F  +G+ +++QEG  SLYRG+ ++L K++P+T
Sbjct: 233 IQIRNSPNEERHDREFTKDIYKSYKNRRFLGVGISMVQQEGPLSLYRGVTMSLIKSVPST 292

Query: 298 FVSFWGYE 305
            +S W YE
Sbjct: 293 AISLWSYE 300

 Score = 30.0 bits (66), Expect = 2.0,   Method: Compositional matrix adjust.
 Identities = 24/93 (25%), Positives = 42/93 (45%), Gaps = 13/93 (13%)

Query: 21  LAGAVSGLLARSITAPMDTIKIRLQLTPANGL----KPFGSQV---------MEVARSMI 67
           LAG +SG  ++  T P+DT++ R+Q+  +       + F   +         + V  SM+
Sbjct: 210 LAGPISGFTSKLATFPLDTVRRRIQIRNSPNEERHDREFTKDIYKSYKNRRFLGVGISMV 269

Query: 68  KNEGIRSFWKGNIPGSLLYVTYGSAQFSSYSLF 100
           + EG  S ++G     +  V   +    SY LF
Sbjct: 270 QQEGPLSLYRGVTMSLIKSVPSTAISLWSYELF 302

>AAR036W [222] [Homologous to ScYGR096W - SH]
           complement(406887..407840) [954 bp, 317 aa]
          Length = 317

 Score =  263 bits (672), Expect = 6e-87,   Method: Compositional matrix adjust.
 Identities = 128/304 (42%), Positives = 191/304 (62%), Gaps = 12/304 (3%)

Query: 5   EDSLRKGQNVAAWKTLLAGAVSGLLARSITAPMDTIKIRLQLTPANGLKPFGSQVMEVAR 64
           ED LRKG+ V+    ++AG+VSGL+ARS+TAPMDT+KIR QL  A+  K  G  ++   R
Sbjct: 13  EDHLRKGEAVSGLHAVVAGSVSGLVARSVTAPMDTVKIRRQLQLASEHKYHG--ILHTFR 70

Query: 65  SMIKNEGIRSFWKGNIPGSLLYVTYGSAQFSSYSLFNRYLTPFGLEARLHSLVVGAFAGI 124
           ++ + EG+R+ WKGN+P S +YV YGS QF +Y+  N      GL  + HSL VGA AG+
Sbjct: 71  TVAREEGVRALWKGNVPASAMYVLYGSLQFGTYAWLNTAAASAGLPPQAHSLAVGALAGL 130

Query: 125 TSSIVSYPFDVLRTRLVANNQMHSMSITREVRDIWKLEGLPGFFKGSIASMTTITLTASI 184
            SS+++YP D+LRTRLVAN   H  S+ R+ R IW  EG  GFF+G   ++   TLT  +
Sbjct: 131 VSSLLTYPLDLLRTRLVANRSAHFFSLRRQARVIWDTEGPAGFFRGGAWAIAATTLTTGL 190

Query: 185 MFGTYETIRIYCDENEKTTAAHKKWELATLNHSAGTIGGVIAKIITFPLETIRRRMQFMN 244
           +FG YET  I  D           + L  L  +A    G+++K   FPL+T+RRR+Q ++
Sbjct: 191 IFGIYETCTIAAD----------TYGLPWLAAAASPTAGLVSKAAVFPLDTVRRRLQIVD 240

Query: 245 SKHLEKFSRHSSVYGSYKGYGFARIGLQILKQEGVSSLYRGILVALSKTIPTTFVSFWGY 304
           +KH+  F+R    Y + +G  F  + + +++ EG++SLY+G+ +AL K+ PTT ++ W Y
Sbjct: 241 AKHIPFFTRDPGAYSALRGTRFLGLAVHMVRAEGIASLYKGLTMALCKSTPTTVITLWVY 300

Query: 305 ETAI 308
           +  +
Sbjct: 301 QRCL 304

>Kwal_23.3965
          Length = 307

 Score =  246 bits (629), Expect = 1e-80,   Method: Compositional matrix adjust.
 Identities = 118/304 (38%), Positives = 195/304 (64%), Gaps = 9/304 (2%)

Query: 5   EDSLRKGQNVAAWKTLLAGAVSGLLARSITAPMDTIKIRLQLTPANGLKPFGSQVMEVAR 64
           ED LRKGQ V  +++L+AG +SG+ AR +TAP+DT+KIRLQL  AN  +  G  ++   +
Sbjct: 3   EDHLRKGQEVPVFQSLVAGCLSGISARIVTAPLDTLKIRLQLQLANEAQYGG--ILVTFK 60

Query: 65  SMIKNEGIRSFWKGNIPGSLLYVTYGSAQFSSYSLFNRYLTPFGLEARLHSLVVGAFAGI 124
            +++ EG+R+ WKGN+P   +Y+ YGS QF+SY++ N+ L+   L A++H+ +VGA +G 
Sbjct: 61  RLVRQEGVRALWKGNVPAMAMYILYGSTQFTSYAILNKLLSKSQLPAQIHTGMVGALSGT 120

Query: 125 TSSIVSYPFDVLRTRLVANNQMHSMSITREVRDIWKLEGLPGFFKGSIASMTTITLTASI 184
            S+I SYP DVLRTR +AN+     ++    ++IW+ EG  GFFKG  +S+ +I +  S 
Sbjct: 121 CSAIASYPCDVLRTRFIANHSRELSTMLSTAQEIWRHEGFRGFFKGVSSSIVSIAVATSS 180

Query: 185 MFGTYETIRIYCDENEKTTAAHKKWELATLNHSAGTIGGVIAKIITFPLETIRRRMQFMN 244
           +  TYE+++I+C++     ++     +  L  SA  I G+++K I FP++T+R+R Q ++
Sbjct: 181 ILATYESVKIFCEQRPDRDSS----VIQLLESSASVIAGIVSKTIVFPIDTVRKRYQVID 236

Query: 245 SKHLEKFSRHSSVYGSYKGY---GFARIGLQILKQEGVSSLYRGILVALSKTIPTTFVSF 301
            + L      +  Y +YK Y    F R+ L I+++EG+ +LY G  + ++K++P+T VS 
Sbjct: 237 WQQLGHPGHTNKAYKAYKSYTSTNFLRLALMIVEKEGLLALYHGYTLGIAKSVPSTVVSL 296

Query: 302 WGYE 305
             YE
Sbjct: 297 GVYE 300

>YPR011C (YPR011C) [5447] chr16 complement(583057..584037) Protein
           with similarity to human Grave's disease carrier protein
           and to bovine homolog of Grave's disease protein, member
           of the mitochondrial carrier family (MCF) of membrane
           transporters [981 bp, 326 aa]
          Length = 326

 Score =  106 bits (265), Expect = 2e-26,   Method: Compositional matrix adjust.
 Identities = 85/325 (26%), Positives = 150/325 (46%), Gaps = 38/325 (11%)

Query: 5   EDSLRKGQNVAAWKTLLAGAVSGLLARSITAPMDTIKIRLQLTPANGLKPFGSQVMEVAR 64
           +D L++  N+A     LAG V+G ++R++ +P + +KI LQ+  +     +   +    R
Sbjct: 15  KDFLKQDSNIA----FLAGGVAGAVSRTVVSPFERVKILLQVQSST--TSYNRGIFSSIR 68

Query: 65  SMIKNEGIRSFWKGNIPGSLLYVTYGSAQFSSYSLFNRYLTPF----GLE--ARLHSLVV 118
            +   EG +  ++GN    +    Y + QF  Y    + L       G E       L  
Sbjct: 69  QVYHEEGTKGLFRGNGLNCIRIFPYSAVQFVVYEACKKKLFHVNGNNGQEQLTNTQRLFS 128

Query: 119 GAFAGITSSIVSYPFDVLRTRL---VAN----NQMHSMSITRE------VRDIWKLEG-L 164
           GA  G  S + +YP D+++TRL    AN    N+  + SI++       + + ++LEG L
Sbjct: 129 GALCGGCSVVATYPLDLIKTRLSIQTANLSSLNRSKAKSISKPPGIWQLLSETYRLEGGL 188

Query: 165 PGFFKGSIASMTTITLTASIMFGTYETIRIYCDENEKTTAAHKKWELATLNHSAGTIGGV 224
            G ++G   +   +    ++ F  YE +R +      ++ A   W+      + G I G 
Sbjct: 189 RGLYRGVWPTSLGVVPYVALNFAVYEQLREF---GVNSSDAQPSWKSNLYKLTIGAISGG 245

Query: 225 IAKIITFPLETIRRRMQFMNSKHLEKFSRHSSVYGSYKGYGFARIGLQILKQEGVSSLYR 284
           +A+ IT+P + +RRR Q +     E   R++SV+ +          + I + EGVS  Y+
Sbjct: 246 VAQTITYPFDLLRRRFQVLAMGGNELGFRYTSVWDAL---------VTIGRAEGVSGYYK 296

Query: 285 GILVALSKTIPTTFVSFWGYETAIH 309
           G+   L K +P+T VS+  YE    
Sbjct: 297 GLAANLFKVVPSTAVSWLVYEVVCD 321

>CAGL0J01661g 154646..155629 highly similar to tr|Q12251
           Saccharomyces cerevisiae YPR011c, start by similarity
          Length = 327

 Score = 99.4 bits (246), Expect = 8e-24,   Method: Compositional matrix adjust.
 Identities = 80/320 (25%), Positives = 146/320 (45%), Gaps = 42/320 (13%)

Query: 8   LRKGQNVAAWKTLLAGAVSGLLARSITAPMDTIKIRLQLTPANGLKPFGSQVMEVARSMI 67
           L++  NVA     LAG ++G ++R++ +P + +KI LQ+  +     +   + +    + 
Sbjct: 19  LKQDTNVA----FLAGGIAGAISRTVVSPFERVKILLQVQSST--TAYNKGLFDAIGQVY 72

Query: 68  KNEGIRSFWKGNIPGSLLYVTYGSAQFSSYSLFNRYLTPFGLEAR------LHSLVVGAF 121
           K E I+  ++GN    +    Y + QF  +    +++     + +         L  GA 
Sbjct: 73  KEENIKGLFRGNGLNCIRVFPYSAVQFVVFEGCKKHIFHVDTKGKGEQLNNWQRLFSGAL 132

Query: 122 AGITSSIVSYPFDVLRTRL-VANNQMHSMSITR-----EVRDIWKL--------EGLPGF 167
            G  S + +YP D++RTRL V    +  +S +R     +   +WKL         G+ G 
Sbjct: 133 CGGCSVVATYPLDLVRTRLSVQTANLSKLSKSRASDIAKPPGVWKLLSKAYAEEGGIMGL 192

Query: 168 FKGSIASMTTITLTASIMFGTYETIRIY--CDENEKTTAAHKKWELATLNHSAGTIGGVI 225
           ++G   +   I    ++ F  YE ++ +   DEN  ++     ++L     S G I G +
Sbjct: 193 YRGVWPTSLGIVPYVALNFAVYEQLKEFMPSDENGNSSMRDSLYKL-----SMGAISGGV 247

Query: 226 AKIITFPLETIRRRMQFMNSKHLEKFSRHSSVYGSYKGYGFARIGLQILKQEGVSSLYRG 285
           A+ IT+P + +RRR Q +     E    ++SV+ +          + I K EG    Y+G
Sbjct: 248 AQTITYPFDLLRRRFQVLAMGGNELGFHYNSVWDAL---------VTIGKTEGFKGYYKG 298

Query: 286 ILVALSKTIPTTFVSFWGYE 305
           +   L K +P+T VS+  YE
Sbjct: 299 LTANLFKVVPSTAVSWLVYE 318

 Score = 75.5 bits (184), Expect = 2e-15,   Method: Compositional matrix adjust.
 Identities = 53/206 (25%), Positives = 98/206 (47%), Gaps = 21/206 (10%)

Query: 6   DSLRKGQNVAAWKTLLAGAVSGLLARSITAPMDTIKIRLQLTPANGLKPFGSQVMEVA-- 63
           D+  KG+ +  W+ L +GA+ G  +   T P+D ++ RL +  AN  K   S+  ++A  
Sbjct: 113 DTKGKGEQLNNWQRLFSGALCGGCSVVATYPLDLVRTRLSVQTANLSKLSKSRASDIAKP 172

Query: 64  --------RSMIKNEGIRSFWKGNIPGSLLYVTYGSAQFSSYSLFNRYLTP-----FGLE 110
                   ++  +  GI   ++G  P SL  V Y +  F+ Y     ++         + 
Sbjct: 173 PGVWKLLSKAYAEEGGIMGLYRGVWPTSLGIVPYVALNFAVYEQLKEFMPSDENGNSSMR 232

Query: 111 ARLHSLVVGAFAGITSSIVSYPFDVLRTRL----VANNQM--HSMSITREVRDIWKLEGL 164
             L+ L +GA +G  +  ++YPFD+LR R     +  N++  H  S+   +  I K EG 
Sbjct: 233 DSLYKLSMGAISGGVAQTITYPFDLLRRRFQVLAMGGNELGFHYNSVWDALVTIGKTEGF 292

Query: 165 PGFFKGSIASMTTITLTASIMFGTYE 190
            G++KG  A++  +  + ++ +  YE
Sbjct: 293 KGYYKGLTANLFKVVPSTAVSWLVYE 318

>KLLA0E02772g complement(261895..262749) similar to sp|Q12375
           Saccharomyces cerevisiae YOR130c ARG11 ornithine
           transport protein of mitochondria involved in arginine
           metabolism, member of the mitochondrial carrier family
           (MCF), start by similarity
          Length = 284

 Score = 98.2 bits (243), Expect = 1e-23,   Method: Compositional matrix adjust.
 Identities = 80/305 (26%), Positives = 139/305 (45%), Gaps = 44/305 (14%)

Query: 15  AAWKTLLAGAVSGLLARSITAPMDTIKIRLQLTPANGLKPFGSQVMEVARSMIKNEGIRS 74
           +A K +  G+V+G + + I  P DT+K+RLQ  PA+ L P         RS   +EGI  
Sbjct: 6   SALKDIAYGSVAGAIGKVIEYPFDTVKVRLQTQPAH-LYP---TTWSCIRSTYTDEGI-- 59

Query: 75  FWKGNIPGSLLYVTYGSAQ-----FSSYSLFNRYLTPF-GLEARLHSLVVGAFAGITSSI 128
            WKG   G +    +G+A      F S++    +L  F  L+    ++  GAFAG  +S 
Sbjct: 60  -WKGFYQG-IASPLFGAALENAVLFVSFNQCTNFLDEFTQLKPLTKTIYSGAFAGACASF 117

Query: 129 VSYPFDVLRTRLVANNQMHSMSITREVRDIW-------KLEGLPGFFKGSIASMTTITLT 181
           +  P ++++ +L  +N  +S+S T     +W       K +GL G ++G +++     L 
Sbjct: 118 ILTPVELVKCKLQVSNISNSLSQTTRHTSVWPTIKSVIKEKGLLGLWQGQLSTFVRECLG 177

Query: 182 ASIMFGTYETIRIYCDENEKTTAAHKKWELATLNHSAGTIGGVIAKIITFPLETIRRRMQ 241
            ++ F TYE +++           +  WEL      +G   GV+     FP +T++   Q
Sbjct: 178 GAVWFTTYEIMKMKFASLHPAEKENHTWELLV----SGASAGVLFNASVFPADTVKSVCQ 233

Query: 242 FMNSKHLEKFSRHSSVYGSYKGYGFARIGLQILKQEGVSSLYRGILVALSKTIPTTFVSF 301
                     + H S+  + K         ++L+  G++  YRG+ + L +  P     F
Sbjct: 234 ----------TEHVSIVNALK---------KVLRTHGITGFYRGLGITLIRAAPANATVF 274

Query: 302 WGYET 306
           + YET
Sbjct: 275 YTYET 279

 Score = 61.6 bits (148), Expect = 9e-11,   Method: Compositional matrix adjust.
 Identities = 45/183 (24%), Positives = 91/183 (49%), Gaps = 11/183 (6%)

Query: 18  KTLLAGAVSGLLARSITAPMDTIKIRLQLTP-ANGLKPFG--SQVMEVARSMIKNEGIRS 74
           KT+ +GA +G  A  I  P++ +K +LQ++  +N L      + V    +S+IK +G+  
Sbjct: 103 KTIYSGAFAGACASFILTPVELVKCKLQVSNISNSLSQTTRHTSVWPTIKSVIKEKGLLG 162

Query: 75  FWKGNIPGSLLYVTYGSAQFSSYSLFN-RYLTPFGLEARLHS---LVVGAFAGITSSIVS 130
            W+G +   +     G+  F++Y +   ++ +    E   H+   LV GA AG+  +   
Sbjct: 163 LWQGQLSTFVRECLGGAVWFTTYEIMKMKFASLHPAEKENHTWELLVSGASAGVLFNASV 222

Query: 131 YPFDVLRTRLVANNQMHSMSITREVRDIWKLEGLPGFFKGSIASMTTITLTASIMFGTYE 190
           +P D +++      Q   +SI   ++ + +  G+ GF++G   ++       + +F TYE
Sbjct: 223 FPADTVKSVC----QTEHVSIVNALKKVLRTHGITGFYRGLGITLIRAAPANATVFYTYE 278

Query: 191 TIR 193
           T++
Sbjct: 279 TLK 281

 Score = 61.2 bits (147), Expect = 1e-10,   Method: Compositional matrix adjust.
 Identities = 48/201 (23%), Positives = 90/201 (44%), Gaps = 22/201 (10%)

Query: 109 LEARLHSLVVGAFAGITSSIVSYPFDVLRTRLVANNQMHSMSITREVRDIWKLEGL-PGF 167
           LE+ L  +  G+ AG    ++ YPFD ++ RL         +    +R  +  EG+  GF
Sbjct: 4   LESALKDIAYGSVAGAIGKVIEYPFDTVKVRLQTQPAHLYPTTWSCIRSTYTDEGIWKGF 63

Query: 168 FKGSIASMTTITLTASIMFGTYETIRIYCDENEKTTAAHKKWELATLNHS--AGTIGGVI 225
           ++G  + +    L  +++F ++     + DE           +L  L  +  +G   G  
Sbjct: 64  YQGIASPLFGAALENAVLFVSFNQCTNFLDEFT---------QLKPLTKTIYSGAFAGAC 114

Query: 226 AKIITFPLETIRRRMQFMN-SKHLEKFSRHSSVYGSYKGYGFARIGLQILKQEGVSSLYR 284
           A  I  P+E ++ ++Q  N S  L + +RH+SV+ + K          ++K++G+  L++
Sbjct: 115 ASFILTPVELVKCKLQVSNISNSLSQTTRHTSVWPTIK---------SVIKEKGLLGLWQ 165

Query: 285 GILVALSKTIPTTFVSFWGYE 305
           G L    +      V F  YE
Sbjct: 166 GQLSTFVRECLGGAVWFTTYE 186

>Sklu_2363.2 YPR011C, Contig c2363 11969-12940
          Length = 323

 Score = 98.2 bits (243), Expect = 2e-23,   Method: Compositional matrix adjust.
 Identities = 82/322 (25%), Positives = 142/322 (44%), Gaps = 41/322 (12%)

Query: 8   LRKGQNVAAWKTLLAGAVSGLLARSITAPMDTIKIRLQLTPANGLKPFGSQVMEVARSMI 67
           L+   NVA     LAG ++G ++R++ +P + +KI LQ+   N    +   ++   R + 
Sbjct: 18  LKNDSNVA----FLAGGLAGAVSRTVVSPFERVKILLQVQ--NSTTAYNQGIVGAVRQVY 71

Query: 68  KNEGIRSFWKGNIPGSLLYVTYGSAQFSSYSLFNRYLTPF-GLEAR-----LHSLVVGAF 121
           + EG    ++GN    +    Y + QF  Y    ++     G + R        L  GA 
Sbjct: 72  REEGTPGLFRGNGLNCIRIFPYSAVQFVVYEACKKHFFHVDGSKGREQLQNWQRLFSGAL 131

Query: 122 AGITSSIVSYPFDVLRTRL---------VANNQMHSMSITREVRDI----WKLEG-LPGF 167
            G  S + +YP D++RTRL         ++ ++ H++S    V D+    +K EG + G 
Sbjct: 132 CGGCSVLATYPLDLVRTRLSIQTANLTKLSKSRAHNISKPPGVWDLLCRTYKEEGGIKGL 191

Query: 168 FKGSIASMTTITLTASIMFGTYETIRIYCDENEKTTAAHKKWELATLNHSAGTIGGVIAK 227
           ++G   +   +    ++ F  YE  + +  E    T A+          S G + G +A+
Sbjct: 192 YRGVWPTSLGVVPYVALNFAVYEQFKEFMPEGTDNTLAN------FYKLSIGALSGGVAQ 245

Query: 228 IITFPLETIRRRMQFMNSKHLEKFSRHSSVYGSYKGYGFARIGLQILKQEGVSSLYRGIL 287
            +T+P + +RRR Q +     E   R+ SV  +          + I K EG    Y+G+ 
Sbjct: 246 TVTYPFDLLRRRFQVLAMGGNELGFRYKSVMDAL---------ITIGKTEGFRGYYKGLT 296

Query: 288 VALSKTIPTTFVSFWGYETAIH 309
             L K IP+T VS+  YE    
Sbjct: 297 ANLFKVIPSTAVSWLVYEVVCD 318

 Score = 78.2 bits (191), Expect = 3e-16,   Method: Compositional matrix adjust.
 Identities = 57/215 (26%), Positives = 101/215 (46%), Gaps = 23/215 (10%)

Query: 2   FKEEDSLRKGQNVAAWKTLLAGAVSGLLARSITAPMDTIKIRLQLTPANGLKPFGSQVME 61
           F   D  +  + +  W+ L +GA+ G  +   T P+D ++ RL +  AN  K   S+   
Sbjct: 108 FFHVDGSKGREQLQNWQRLFSGALCGGCSVLATYPLDLVRTRLSIQTANLTKLSKSRAHN 167

Query: 62  V----------ARSMIKNEGIRSFWKGNIPGSLLYVTYGSAQFSSYSLFNRYLTPFGLE- 110
           +           R+  +  GI+  ++G  P SL  V Y +  F+ Y  F  ++ P G + 
Sbjct: 168 ISKPPGVWDLLCRTYKEEGGIKGLYRGVWPTSLGVVPYVALNFAVYEQFKEFM-PEGTDN 226

Query: 111 --ARLHSLVVGAFAGITSSIVSYPFDVLRTRL----VANNQM--HSMSITREVRDIWKLE 162
             A  + L +GA +G  +  V+YPFD+LR R     +  N++     S+   +  I K E
Sbjct: 227 TLANFYKLSIGALSGGVAQTVTYPFDLLRRRFQVLAMGGNELGFRYKSVMDALITIGKTE 286

Query: 163 GLPGFFKGSIASMTTITLTASIMFGTYETIRIYCD 197
           G  G++KG  A++  +  + ++ +  YE +   CD
Sbjct: 287 GFRGYYKGLTANLFKVIPSTAVSWLVYEVV---CD 318

>YHR002W (LEU5) [2287] chr8 (108806..109879) Protein with similarity
           to Grave's disease protein, member of the mitochondrial
           carrier (MCF) family of membrane transporters [1074 bp,
           357 aa]
          Length = 357

 Score = 95.5 bits (236), Expect = 3e-22,   Method: Compositional matrix adjust.
 Identities = 77/322 (23%), Positives = 140/322 (43%), Gaps = 47/322 (14%)

Query: 21  LAGAVSGLLARSITAPMDTIKIRLQLTPANGLKPFGSQV--MEVARSMIKNEGIRSFWKG 78
           LAG +SG  A+++ AP+D IKI  Q +  +  K  GS +  +E A+ +  N+G+R F++G
Sbjct: 38  LAGGISGSCAKTLIAPLDRIKILFQTSNPHYTKYTGSLIGLVEAAKHIWINDGVRGFFQG 97

Query: 79  NIPGSLLYVTYGSAQFSSYSLFNRYLTPFG-LEARLHSLVVGAFAGITSSIVSYPFDVLR 137
           +    L    Y + +F +Y      L P    E+    LV G+ AG+ S  ++YP D++R
Sbjct: 98  HSATLLRIFPYAAVKFVAYEQIRNTLIPSKEFESHWRRLVSGSLAGLCSVFITYPLDLVR 157

Query: 138 TRLVANNQMHSMSITREVRDIWKLEG---------LP-------GFFKGSIASMTTITLT 181
            RL    +   + + R ++ I+K            +P        F++G + ++  +   
Sbjct: 158 VRLAYETEHKRVKLGRIIKKIYKEPASATLIKNDYIPNWFCHWCNFYRGYVPTVLGMIPY 217

Query: 182 ASI---------------MFGTYETIRIYCDENEKTTAAHKKWELATLNH-SAGTIGGVI 225
           A +                F  Y  + +  D+  +     ++  L T     +G + G+ 
Sbjct: 218 AGVSFFAHDLLHDVLKSPFFAPYSVLELSEDDELERVQKKQRRPLRTWAELISGGLAGMA 277

Query: 226 AKIITFPLETIRRRMQF--MNSKHLEKFSRHSSVYGSYKGYGFARIGLQILKQEGVSSLY 283
           ++   +P E IRRR+Q   ++ K +            +K    + I   I K+ GV   +
Sbjct: 278 SQTAAYPFEIIRRRLQVSALSPKTMY----------DHKFQSISEIAHIIFKERGVRGFF 327

Query: 284 RGILVALSKTIPTTFVSFWGYE 305
            G+ +   K  P    SF+ YE
Sbjct: 328 VGLSIGYIKVTPMVACSFFVYE 349

 Score = 62.0 bits (149), Expect = 1e-10,   Method: Compositional matrix adjust.
 Identities = 52/220 (23%), Positives = 97/220 (44%), Gaps = 43/220 (19%)

Query: 17  WKTLLAGAVSGLLARSITAPMDTIKIRLQLTPANGLKPFGSQVMEVAR-----SMIKNEG 71
           W+ L++G+++GL +  IT P+D +++RL     +     G  + ++ +     ++IKN+ 
Sbjct: 133 WRRLVSGSLAGLCSVFITYPLDLVRVRLAYETEHKRVKLGRIIKKIYKEPASATLIKNDY 192

Query: 72  IR-------SFWKGNIPGSLLYVTYGSAQFSSYSLFNRYL-TPF---------GLEARLH 114
           I        +F++G +P  L  + Y    F ++ L +  L +PF           +  L 
Sbjct: 193 IPNWFCHWCNFYRGYVPTVLGMIPYAGVSFFAHDLLHDVLKSPFFAPYSVLELSEDDELE 252

Query: 115 --------------SLVVGAFAGITSSIVSYPFDVLRTRL----VANNQMHS---MSITR 153
                          L+ G  AG+ S   +YPF+++R RL    ++   M+     SI+ 
Sbjct: 253 RVQKKQRRPLRTWAELISGGLAGMASQTAAYPFEIIRRRLQVSALSPKTMYDHKFQSISE 312

Query: 154 EVRDIWKLEGLPGFFKGSIASMTTITLTASIMFGTYETIR 193
               I+K  G+ GFF G       +T   +  F  YE ++
Sbjct: 313 IAHIIFKERGVRGFFVGLSIGYIKVTPMVACSFFVYERMK 352

 Score = 30.0 bits (66), Expect = 2.6,   Method: Compositional matrix adjust.
 Identities = 28/109 (25%), Positives = 43/109 (39%), Gaps = 9/109 (8%)

Query: 197 DENEKTTAAHKKWELATLNHSAGTIGGVIAKIITFPLETIRRRMQFMNSKHLEKFSRHSS 256
           +  +KT+     ++    +  AG I G  AK +  PL+ I+   Q  N  H  K++    
Sbjct: 18  NTTQKTSFDRNSFDYIVRSGLAGGISGSCAKTLIAPLDRIKILFQTSNP-HYTKYT---- 72

Query: 257 VYGSYKGYGFARIGLQILKQEGVSSLYRGILVALSKTIPTTFVSFWGYE 305
             GS    G       I   +GV   ++G    L +  P   V F  YE
Sbjct: 73  --GSL--IGLVEAAKHIWINDGVRGFFQGHSATLLRIFPYAAVKFVAYE 117

>Kwal_14.2210
          Length = 315

 Score = 93.2 bits (230), Expect = 1e-21,   Method: Compositional matrix adjust.
 Identities = 78/320 (24%), Positives = 136/320 (42%), Gaps = 34/320 (10%)

Query: 4   EEDSLRKGQNVAAWKTLLAGAVSGLLARSITAPMDTIKIRLQLTPANGLKPFGSQVMEVA 63
           ++ S R      A     AG ++G ++R++ +P + +KI LQ+  +     +   +    
Sbjct: 5   QDHSWRCALKSDAGIAFCAGGIAGAVSRTVVSPFERVKILLQVQSST--HAYNHGLFRAV 62

Query: 64  RSMIKNEGIRSFWKGNIPGSLLYVTYGSAQFSSYSLFNRYL---TPFGLEARLHSLVVGA 120
           + +   EG+    +GN    +    Y + QF  Y    +      P  +    H LV GA
Sbjct: 63  KQVYLEEGVPGLLRGNGLNCIRIFPYSAVQFLVYEFCKKQWFQQNPDTVVLNWHRLVSGA 122

Query: 121 FAGITSSIVSYPFDVLRTRL---VAN-NQMHSMSITREVRD--IWKL--------EGLPG 166
             G  S + +YP D++RTRL    AN  ++H        +   +W+L         G+ G
Sbjct: 123 LCGGCSVLATYPLDLVRTRLSIQTANLARLHKAKAASAAKPPGVWELLRKTYTQEGGIFG 182

Query: 167 FFKGSIASMTTITLTASIMFGTYETIRIYCDENEKTTAAHKKWELATLNHSAGTIGGVIA 226
            ++G   +   +    ++ F  YE +R Y   +    +A      +    S G I G +A
Sbjct: 183 LYRGVWPTSIGVVPYVALNFAVYEQLREYIPASFDPASA------SLYKLSIGAISGGVA 236

Query: 227 KIITFPLETIRRRMQFMNSKHLEKFSRHSSVYGSYKGYGFARIGLQILKQEGVSSLYRGI 286
           + IT+P + +RRR Q +     E    + SV  +          + I + EG    Y+G+
Sbjct: 237 QTITYPFDLLRRRFQVLAMGQSELGFHYKSVPDAL---------ITIGRTEGFKGYYKGL 287

Query: 287 LVALSKTIPTTFVSFWGYET 306
              L K +P+T VS+  YET
Sbjct: 288 TANLFKVVPSTAVSWVVYET 307

 Score = 76.6 bits (187), Expect = 1e-15,   Method: Compositional matrix adjust.
 Identities = 59/203 (29%), Positives = 98/203 (48%), Gaps = 24/203 (11%)

Query: 14  VAAWKTLLAGAVSGLLARSITAPMDTIKIRLQLTPANGLK-----------PFGSQVMEV 62
           V  W  L++GA+ G  +   T P+D ++ RL +  AN  +           P G  V E+
Sbjct: 112 VLNWHRLVSGALCGGCSVLATYPLDLVRTRLSIQTANLARLHKAKAASAAKPPG--VWEL 169

Query: 63  ARSMIKNEG-IRSFWKGNIPGSLLYVTYGSAQFSSYSLFNRYLTPFGLE---ARLHSLVV 118
            R     EG I   ++G  P S+  V Y +  F+ Y     Y+ P   +   A L+ L +
Sbjct: 170 LRKTYTQEGGIFGLYRGVWPTSIGVVPYVALNFAVYEQLREYI-PASFDPASASLYKLSI 228

Query: 119 GAFAGITSSIVSYPFDVLRTR--LVANNQ----MHSMSITREVRDIWKLEGLPGFFKGSI 172
           GA +G  +  ++YPFD+LR R  ++A  Q     H  S+   +  I + EG  G++KG  
Sbjct: 229 GAISGGVAQTITYPFDLLRRRFQVLAMGQSELGFHYKSVPDALITIGRTEGFKGYYKGLT 288

Query: 173 ASMTTITLTASIMFGTYETIRIY 195
           A++  +  + ++ +  YET+R Y
Sbjct: 289 ANLFKVVPSTAVSWVVYETVRDY 311

>Sklu_2334.2 YJR095W, Contig c2334 6303-7262 reverse complement
          Length = 319

 Score = 90.1 bits (222), Expect = 2e-20,   Method: Compositional matrix adjust.
 Identities = 83/314 (26%), Positives = 141/314 (44%), Gaps = 35/314 (11%)

Query: 6   DSLRKGQNVAAWKTLLAGAVSGLLARSITAPMDTIKIRLQL---TPANGLKPFGSQVMEV 62
            S +K  N A    L+AG  +GL       P+DTIK+R+Q+   +   G+KP G   ++ 
Sbjct: 2   SSKKKSSNPAV--NLIAGGTAGLFEALCCHPLDTIKVRMQIYRRSALEGIKPPG--FIKT 57

Query: 63  ARSMIKNEGIRSFWKGNIPGSLLYVTYGSAQFSSYSLFNRYLTP--FGLEARLHSLVVGA 120
            R++   EG+ + +KG     +  +   + +FSSY  +   L     G  +  ++ + G 
Sbjct: 58  GRNIYTEEGLLALYKGLGAVVIGIIPKMAIRFSSYEFYRSALADKQTGSVSTGNTFLAGV 117

Query: 121 FAGITSSI-VSYPFDVLRTRLVANNQMHSMSITREVRD-------IWKLEGLPGFFKGSI 172
            AG T ++ V  P +V++ RL A +     + +   R+       I K EG+   ++G  
Sbjct: 118 GAGTTEAVLVVNPMEVVKIRLQAQHLHPETAASPRYRNALQACYLIVKEEGIGALYRGVS 177

Query: 173 ASMTTITLTASIMFGTYETIRIYCDENEKTTAAHKKWELATLNHSAGTIGGVIAKIITFP 232
            +           F  Y  ++ +  E+ KT A    WE + +    G I G I      P
Sbjct: 178 LTAARQATNQGANFTVYSKLKEFLQEHHKTDAL-PSWETSCI----GLISGAIGPFSNAP 232

Query: 233 LETIRRRMQFMNS-KHLEKFSRHSSVYGSYKGYGFARIGLQILKQEGVSSLYRGILVALS 291
           L+TI+ R+Q   S  ++  +SR               IG Q++K+EG  +LY+GI   + 
Sbjct: 233 LDTIKTRLQKDKSTANMSGWSR------------IVTIGKQLIKEEGFRALYKGITPRVM 280

Query: 292 KTIPTTFVSFWGYE 305
           +  P   V+F  YE
Sbjct: 281 RVAPGQAVTFTVYE 294

 Score = 58.2 bits (139), Expect = 2e-09,   Method: Compositional matrix adjust.
 Identities = 49/196 (25%), Positives = 82/196 (41%), Gaps = 11/196 (5%)

Query: 13  NVAAWKTLLAGAVSGLL-ARSITAPMDTIKIRLQ---LTPANGLKPFGSQVMEVARSMIK 68
           +V+   T LAG  +G   A  +  PM+ +KIRLQ   L P     P     ++    ++K
Sbjct: 106 SVSTGNTFLAGVGAGTTEAVLVVNPMEVVKIRLQAQHLHPETAASPRYRNALQACYLIVK 165

Query: 69  NEGIRSFWKGNIPGSLLYVTYGSAQFSSYSLFNRYLTPFGLEARLHS---LVVGAFAGIT 125
            EGI + ++G    +    T   A F+ YS    +L        L S     +G  +G  
Sbjct: 166 EEGIGALYRGVSLTAARQATNQGANFTVYSKLKEFLQEHHKTDALPSWETSCIGLISGAI 225

Query: 126 SSIVSYPFDVLRTRLVANNQMHSMS----ITREVRDIWKLEGLPGFFKGSIASMTTITLT 181
               + P D ++TRL  +    +MS    I    + + K EG    +KG    +  +   
Sbjct: 226 GPFSNAPLDTIKTRLQKDKSTANMSGWSRIVTIGKQLIKEEGFRALYKGITPRVMRVAPG 285

Query: 182 ASIMFGTYETIRIYCD 197
            ++ F  YE +R + +
Sbjct: 286 QAVTFTVYEFVREHLE 301

 Score = 52.8 bits (125), Expect = 1e-07,   Method: Compositional matrix adjust.
 Identities = 28/100 (28%), Positives = 48/100 (48%)

Query: 10  KGQNVAAWKTLLAGAVSGLLARSITAPMDTIKIRLQLTPANGLKPFGSQVMEVARSMIKN 69
           K   + +W+T   G +SG +     AP+DTIK RLQ   +       S+++ + + +IK 
Sbjct: 206 KTDALPSWETSCIGLISGAIGPFSNAPLDTIKTRLQKDKSTANMSGWSRIVTIGKQLIKE 265

Query: 70  EGIRSFWKGNIPGSLLYVTYGSAQFSSYSLFNRYLTPFGL 109
           EG R+ +KG  P  +      +  F+ Y     +L   G+
Sbjct: 266 EGFRALYKGITPRVMRVAPGQAVTFTVYEFVREHLETLGI 305

>Kwal_55.20868
          Length = 380

 Score = 90.9 bits (224), Expect = 2e-20,   Method: Compositional matrix adjust.
 Identities = 86/307 (28%), Positives = 135/307 (43%), Gaps = 39/307 (12%)

Query: 19  TLLAGAVSGLLARSITAPMDTIKIRLQLTPANGLKPFGSQ----VMEVARSMIKNEGIRS 74
           T L+GA++G LA     P+D  K RLQ   A GL    S     ++    ++I++EG R 
Sbjct: 78  TALSGAMAGFLAGVTVCPLDVAKTRLQ---AQGLHSNPSNYYKGILGTLTTIIRDEGARG 134

Query: 75  FWKGNIPGSLLYVTYGSAQFSSYS----LFNRYLTPFGLEARLHSLVVGAFAGITSSIVS 130
            +KG +P  + Y       FS Y     L+ R    F   +   S +    AG  S+I++
Sbjct: 135 LYKGLVPIIMGYFPTWMIYFSVYERSKKLYPRIFPSFDFISHSASALT---AGTVSTILT 191

Query: 131 YPFDVLRTRL-----VANNQMHSMSITREVRDIWKLEGLPGFFKGSIASMTTITLTASIM 185
            P  V++TRL     V  N  H  S       ++  EGL  F+ G + S+  +    +I 
Sbjct: 192 NPVWVVKTRLMLQTHVNKNSTHYTSTFDAFHKMYTTEGLRTFYAGLLPSLLGL-FHVAIH 250

Query: 186 FGTYETIRI--YCDENEKTTAAHKKWELATLNHSAGTIGGVIAKIITFPLETIRRRMQFM 243
           F  YE +++  +C  +   T  H    LA L   A +   ++A  +T+P E +R RMQ  
Sbjct: 251 FPIYEKLKVWLHCTPSMSRTEDH-NLNLARLI-IASSASKMVASTLTYPHEILRTRMQLK 308

Query: 244 NSK-----HLEKFSRHSSVYGSYKGYGFARIGLQILKQEGVSSLYRGILVALSKTIPTTF 298
                    L+K SRH          G  R+     K EG+   Y G    L++T+P + 
Sbjct: 309 AYPTDPLAALQKTSRH----------GLIRLIKHTYKSEGLRGFYSGFTANLARTLPASA 358

Query: 299 VSFWGYE 305
           ++   +E
Sbjct: 359 ITLVSFE 365

 Score = 55.5 bits (132), Expect = 1e-08,   Method: Compositional matrix adjust.
 Identities = 53/195 (27%), Positives = 88/195 (45%), Gaps = 24/195 (12%)

Query: 20  LLAGAVSGLLARSITAPMDTIKIRLQL-TPANGLKPFGSQVMEVARSMIKNEGIRSFWKG 78
           L AG VS +L    T P+  +K RL L T  N      +   +    M   EG+R+F+ G
Sbjct: 181 LTAGTVSTIL----TNPVWVVKTRLMLQTHVNKNSTHYTSTFDAFHKMYTTEGLRTFYAG 236

Query: 79  NIPGSLLYVTYGSAQFSSYSLFNRYL--TPFGLEARLHSL------VVGAFAGITSSIVS 130
            +P SLL + + +  F  Y     +L  TP       H+L      +  + + + +S ++
Sbjct: 237 LLP-SLLGLFHVAIHFPIYEKLKVWLHCTPSMSRTEDHNLNLARLIIASSASKMVASTLT 295

Query: 131 YPFDVLRTR----------LVANNQMHSMSITREVRDIWKLEGLPGFFKGSIASMTTITL 180
           YP ++LRTR          L A  +     + R ++  +K EGL GF+ G  A++     
Sbjct: 296 YPHEILRTRMQLKAYPTDPLAALQKTSRHGLIRLIKHTYKSEGLRGFYSGFTANLARTLP 355

Query: 181 TASIMFGTYETIRIY 195
            ++I   ++E  R Y
Sbjct: 356 ASAITLVSFEYFRKY 370

>Scas_578.3*
          Length = 524

 Score = 91.3 bits (225), Expect = 2e-20,   Method: Compositional matrix adjust.
 Identities = 75/321 (23%), Positives = 141/321 (43%), Gaps = 40/321 (12%)

Query: 14  VAAWKTLLAGAVSGLLARSITAPMDTIKIRL---------QLTPANGLKPFG-------S 57
           +  +   +AG +SG+++R+ TAP+D IK+ L          L P   L+  G       S
Sbjct: 206 IKGFGYFIAGGLSGVISRTCTAPLDRIKVFLIARTDLSSTLLNPKMHLRIQGLNLAKIRS 265

Query: 58  QVMEVARSMIKNEGIRSFWKGNIPGSLLYVTYGSAQFSSYSLFNRYLTPFGLE------A 111
            +++  RS+ +  G+R+F+ GN           S +F ++ L  R +     +      +
Sbjct: 266 PIIKAIRSLYRQGGLRAFYVGNGLSVFKICPESSIKFGTFELAKRLMANLSGDKLVNDLS 325

Query: 112 RLHSLVVGAFAGITSSIVSYPFDVLRTRL----VANNQMHSMSITREVRDIWKLEGLPGF 167
           +L + V G  AG+ + I  YP D L+ R+    +  N   +  +    ++++K  G+  F
Sbjct: 326 KLQTYVAGGIAGVMAQISIYPIDTLKFRIQCAPLEGNLKGNALLISTAKEMYKEGGIRVF 385

Query: 168 FKGSIASMTTITLTASIMFGTYETIRIYC--DENEKTTAAHKKWELA-TLNHSAGTIGGV 224
           ++G +     I   A++  GT+  ++ +    +++K     K   L+  L    G   G 
Sbjct: 386 YRGVLLGALGIFPYAALDLGTFSALKKWYIKRQSKKLNIPEKDVMLSYLLVLPMGAFSGT 445

Query: 225 IAKIITFPLETIRRRMQFMNSKHLEKFSRHSSVYGSYKGYGFARIGLQILKQEGVSSLYR 284
           +     +P+  +R R+Q   +        H   Y      GF  + +Q LK+EGV   Y+
Sbjct: 446 VGATAVYPINLLRTRLQAQGT------YAHPYTYT-----GFRDVFMQTLKREGVPGFYK 494

Query: 285 GILVALSKTIPTTFVSFWGYE 305
           G++  L K  P   + +  YE
Sbjct: 495 GLVPTLVKVCPAVSIGYLCYE 515

 Score = 87.4 bits (215), Expect = 5e-19,   Method: Compositional matrix adjust.
 Identities = 55/197 (27%), Positives = 97/197 (49%), Gaps = 15/197 (7%)

Query: 12  QNVAAWKTLLAGAVSGLLARSITAPMDTIKIRLQLTPANGLKPFGSQVMEVARSMIKNEG 71
            +++  +T +AG ++G++A+    P+DT+K R+Q  P  G     + ++  A+ M K  G
Sbjct: 322 NDLSKLQTYVAGGIAGVMAQISIYPIDTLKFRIQCAPLEGNLKGNALLISTAKEMYKEGG 381

Query: 72  IRSFWKGNIPGSLLYVTYGSAQFSSYSLFNRY--------LTPFGLEARLHSLVV---GA 120
           IR F++G + G+L    Y +    ++S   ++        L     +  L  L+V   GA
Sbjct: 382 IRVFYRGVLLGALGIFPYAALDLGTFSALKKWYIKRQSKKLNIPEKDVMLSYLLVLPMGA 441

Query: 121 FAGITSSIVSYPFDVLRTRLVANNQMHSMSITREVRDIW----KLEGLPGFFKGSIASMT 176
           F+G   +   YP ++LRTRL A             RD++    K EG+PGF+KG + ++ 
Sbjct: 442 FSGTVGATAVYPINLLRTRLQAQGTYAHPYTYTGFRDVFMQTLKREGVPGFYKGLVPTLV 501

Query: 177 TITLTASIMFGTYETIR 193
            +    SI +  YE  +
Sbjct: 502 KVCPAVSIGYLCYEKFK 518

>CAGL0K02915g 259026..260054 highly similar to sp|P38702
           Saccharomyces cerevisiae YHR002w LEU5, hypothetical
           start
          Length = 342

 Score = 89.4 bits (220), Expect = 4e-20,   Method: Compositional matrix adjust.
 Identities = 84/324 (25%), Positives = 143/324 (44%), Gaps = 51/324 (15%)

Query: 21  LAGAVSGLLARSITAPMDTIKIRLQLTPANGLKPFGSQV--MEVARSMIKNEGIRSFWKG 78
           LAG VSG  A+++ AP+D IKI  Q +  +  K  GS V   E A+ +  N+GIR F++G
Sbjct: 23  LAGGVSGSCAKTLIAPLDRIKILFQTSNPHYSKYAGSLVGLYEAAKHIWINDGIRGFFQG 82

Query: 79  NIPGSLLYVTYGSAQFSSYSLFNRYLTPF-GLEARLHSLVVGAFAGITSSIVSYPFDVLR 137
           +    L    Y + +F +Y      L P    E+    L  G+ AG+ S  ++YP D+ R
Sbjct: 83  HSVTLLRIFPYAAVKFVAYEQIRSILIPSREYESHWRRLASGSLAGLCSVFITYPLDLTR 142

Query: 138 TRLVANNQMHSMSITREVRDIWKL---EGLP-------------GFFKGSIASMTTITLT 181
            RL    +   + +   V+ I+     EGL               F++G + ++  +   
Sbjct: 143 VRLAYVTEHKRVKLRDIVKTIYHEPASEGLTSHLLVPKWFAHWCNFYRGYVPTVLGMIPY 202

Query: 182 ASIMFGTYETIR------IYCDENEKTTAAHKKWELATLNHS----------AGTIGGVI 225
           A + F  ++ I       +      K  ++ ++ E   L             AG + G++
Sbjct: 203 AGVSFFAHDLIHDIMKSSLMAPYAVKQLSSQEELERKKLRQKTPLRTWAELVAGGLSGIL 262

Query: 226 AKIITFPLETIRRRMQF--MNSKHL--EKFSRHSSVYGSYKGYGFARIGLQILKQEGVSS 281
           ++   +PLE IRRR+Q   ++ + +   KF   SS+         ARI   I +++G   
Sbjct: 263 SQTAAYPLEIIRRRLQVSTLSPRKMYDHKFQSISSI---------ARI---IYQEKGWRG 310

Query: 282 LYRGILVALSKTIPTTFVSFWGYE 305
            + G+ +   K  P    SF+ YE
Sbjct: 311 FFVGLSIGYIKVTPMVACSFFVYE 334

 Score = 50.8 bits (120), Expect = 5e-07,   Method: Compositional matrix adjust.
 Identities = 50/222 (22%), Positives = 92/222 (41%), Gaps = 47/222 (21%)

Query: 17  WKTLLAGAVSGLLARSITAPMDTIKIRLQLTPANGLKPFGSQVMEVARSMIKNEGIRS-- 74
           W+ L +G+++GL +  IT P+D  ++RL     +        V  +      +EG+ S  
Sbjct: 118 WRRLASGSLAGLCSVFITYPLDLTRVRLAYVTEHKRVKLRDIVKTIYHEP-ASEGLTSHL 176

Query: 75  -----------FWKGNIPGSLLYVTYGSAQFSSYSLFNR-----YLTPFGLEARLHS--- 115
                      F++G +P  L  + Y    F ++ L +       + P+ ++ +L S   
Sbjct: 177 LVPKWFAHWCNFYRGYVPTVLGMIPYAGVSFFAHDLIHDIMKSSLMAPYAVK-QLSSQEE 235

Query: 116 -----------------LVVGAFAGITSSIVSYPFDVLRTRL----VANNQMHS---MSI 151
                            LV G  +GI S   +YP +++R RL    ++  +M+     SI
Sbjct: 236 LERKKLRQKTPLRTWAELVAGGLSGILSQTAAYPLEIIRRRLQVSTLSPRKMYDHKFQSI 295

Query: 152 TREVRDIWKLEGLPGFFKGSIASMTTITLTASIMFGTYETIR 193
           +   R I++ +G  GFF G       +T   +  F  YE ++
Sbjct: 296 SSIARIIYQEKGWRGFFVGLSIGYIKVTPMVACSFFVYERMK 337

 Score = 43.1 bits (100), Expect = 1e-04,   Method: Compositional matrix adjust.
 Identities = 22/78 (28%), Positives = 44/78 (56%), Gaps = 3/78 (3%)

Query: 4   EEDSLRKGQNVAAWKTLLAGAVSGLLARSITAPMDTIKIRLQLTPANGLKPFGSQ---VM 60
           E   LR+   +  W  L+AG +SG+L+++   P++ I+ RLQ++  +  K +  +   + 
Sbjct: 237 ERKKLRQKTPLRTWAELVAGGLSGILSQTAAYPLEIIRRRLQVSTLSPRKMYDHKFQSIS 296

Query: 61  EVARSMIKNEGIRSFWKG 78
            +AR + + +G R F+ G
Sbjct: 297 SIARIIYQEKGWRGFFVG 314

>Kwal_55.21335
          Length = 317

 Score = 89.0 bits (219), Expect = 4e-20,   Method: Compositional matrix adjust.
 Identities = 83/311 (26%), Positives = 141/311 (45%), Gaps = 62/311 (19%)

Query: 16  AWKTLLAGAVSGLLARSITAPMDTIKIRLQLTPANGLKPFGSQVMEVARSMIK----NEG 71
           A K +L G+++G   + I  P+DTIK+RLQ  PA+        V   + S IK     EG
Sbjct: 45  ALKDILYGSIAGAAGKVIEYPLDTIKVRLQTQPAH--------VFPTSWSCIKYTYQKEG 96

Query: 72  -IRSFWKG--------NIPGSLLYVTYGSAQFSSYSLFNRY--LTPFGLEARLHSLVVGA 120
            ++ F++G         +  ++L+VT+  AQ    +   +Y  ++P        +++ GA
Sbjct: 97  FVKGFYQGVASPLVGAALENAVLFVTFNRAQ----NFLQQYESVSPLS-----QTVLSGA 147

Query: 121 FAGITSSIVSYPFDVLRTRLVANN-----QMHSMSITREVRDIWKLEGLPGFFKGSIASM 175
           FAG  +S V  P ++++  L  +N       HS  I   V+ I + +G+ G ++G  ++ 
Sbjct: 148 FAGACTSYVLTPVELIKCTLQVSNLEGATTRHS-KIWPTVKHIVQHKGIGGLWQGQSSTF 206

Query: 176 TTITLTASIMFGTYETIRIYCDENEKTTAAHKKWELATLNHSAGTIGGVIAKIITFPLET 235
                  ++ F TYE+++ Y       T  H  WEL     ++G   GV      FP +T
Sbjct: 207 IRECAGGAVWFTTYESLKSYLARRRNDTENH-TWELL----ASGASAGVAFNASIFPADT 261

Query: 236 IRRRMQFMNSKHLEKFSRHSSVYGSYKGYGFARIGLQILKQEGVSSLYRGILVALSKTIP 295
           I+   Q   ++HL                G      +IL + G + LYRG+ + L +  P
Sbjct: 262 IKSTAQ---TQHL----------------GIVDATKRILARSGPAGLYRGLGITLIRAAP 302

Query: 296 TTFVSFWGYET 306
              + F+ YET
Sbjct: 303 ANAIVFYTYET 313

 Score = 59.3 bits (142), Expect = 7e-10,   Method: Compositional matrix adjust.
 Identities = 41/178 (23%), Positives = 80/178 (44%), Gaps = 7/178 (3%)

Query: 18  KTLLAGAVSGLLARSITAPMDTIKIRLQLTPANGLKPFGSQVMEVARSMIKNEGIRSFWK 77
           +T+L+GA +G     +  P++ IK  LQ++   G     S++    + +++++GI   W+
Sbjct: 141 QTVLSGAFAGACTSYVLTPVELIKCTLQVSNLEGATTRHSKIWPTVKHIVQHKGIGGLWQ 200

Query: 78  GNIPGSLLYVTYGSAQFSSYSLFNRYLTPFGLEARLHS---LVVGAFAGITSSIVSYPFD 134
           G     +     G+  F++Y     YL     +   H+   L  GA AG+  +   +P D
Sbjct: 201 GQSSTFIRECAGGAVWFTTYESLKSYLARRRNDTENHTWELLASGASAGVAFNASIFPAD 260

Query: 135 VLRTRLVANNQMHSMSITREVRDIWKLEGLPGFFKGSIASMTTITLTASIMFGTYETI 192
            +++      Q   + I    + I    G  G ++G   ++       +I+F TYET+
Sbjct: 261 TIKS----TAQTQHLGIVDATKRILARSGPAGLYRGLGITLIRAAPANAIVFYTYETL 314

>Scas_717.20
          Length = 356

 Score = 88.6 bits (218), Expect = 9e-20,   Method: Compositional matrix adjust.
 Identities = 80/320 (25%), Positives = 140/320 (43%), Gaps = 43/320 (13%)

Query: 21  LAGAVSGLLARSITAPMDTIKIRLQLTPANGLKPFGSQV--MEVARSMIKNEGIRSFWKG 78
           LAG +SG  A+++ AP+D IKI  Q +  +  K  GS V   E A+ +  N+GIR F++G
Sbjct: 37  LAGGISGSCAKTLIAPLDRIKILFQTSNPHYTKYAGSLVGLKEAAKHIWLNDGIRGFFQG 96

Query: 79  NIPGSLLYVTYGSAQFSSYSLFNRYLTPFG-LEARLHSLVVGAFAGITSSIVSYPFDVLR 137
           +    +    Y + +F +Y      L P    E+    L+ G+ AG+ S   +YP D++R
Sbjct: 97  HSVTLMRIFPYAAVKFVAYEQIRNTLIPSKEYESHWRRLMSGSLAGLCSVFTTYPLDLIR 156

Query: 138 TRLVANNQMHSMSITREVRDIWK------LEG---LP-------GFFKGSIASMTTITLT 181
            RL    +   +S+   V+ I+K      LE    +P        F++G   ++  +   
Sbjct: 157 VRLAYVTEHKRISLLGLVKTIYKEPASTTLEAKGYIPNWFAHWCNFYRGYTPTVLGMIPY 216

Query: 182 ASIMF---------------GTYETIRIYCDENEKTTAAHKKWELATLNH-SAGTIGGVI 225
           A + F                 Y  + +   E E+    H++  L T     +G + G+ 
Sbjct: 217 AGVSFFAHDLLHDVLKHPILAPYSVLALSESEQEERHFKHQRLPLRTWAELLSGGLAGMA 276

Query: 226 AKIITFPLETIRRRMQFMNSKHLEKFSRHSSVYGSYKGYGFARIGLQILKQEGVSSLYRG 285
           ++   +P E IRRR+Q +++  + +   H       +    + I   I K+ G    + G
Sbjct: 277 SQTAAYPFEIIRRRLQ-VSTLSVSQMYDH-------RFQSISEIAKIIYKERGWRGFFVG 328

Query: 286 ILVALSKTIPTTFVSFWGYE 305
           + +   K  P    SF+ YE
Sbjct: 329 LSIGYIKVTPMVACSFFVYE 348

 Score = 56.2 bits (134), Expect = 9e-09,   Method: Compositional matrix adjust.
 Identities = 56/221 (25%), Positives = 95/221 (42%), Gaps = 45/221 (20%)

Query: 17  WKTLLAGAVSGLLARSITAPMDTIKIRLQLTPAN------GL-----KPFGSQVMEVARS 65
           W+ L++G+++GL +   T P+D I++RL     +      GL     K   S  +E A+ 
Sbjct: 132 WRRLMSGSLAGLCSVFTTYPLDLIRVRLAYVTEHKRISLLGLVKTIYKEPASTTLE-AKG 190

Query: 66  MIKNEGIR--SFWKGNIPGSLLYVTYGSAQFSSYSLFNRY-----LTPFGLEARLHS--- 115
            I N      +F++G  P  L  + Y    F ++ L +       L P+ + A   S   
Sbjct: 191 YIPNWFAHWCNFYRGYTPTVLGMIPYAGVSFFAHDLLHDVLKHPILAPYSVLALSESEQE 250

Query: 116 ----------------LVVGAFAGITSSIVSYPFDVLRTRL----VANNQMHS---MSIT 152
                           L+ G  AG+ S   +YPF+++R RL    ++ +QM+     SI+
Sbjct: 251 ERHFKHQRLPLRTWAELLSGGLAGMASQTAAYPFEIIRRRLQVSTLSVSQMYDHRFQSIS 310

Query: 153 REVRDIWKLEGLPGFFKGSIASMTTITLTASIMFGTYETIR 193
              + I+K  G  GFF G       +T   +  F  YE ++
Sbjct: 311 EIAKIIYKERGWRGFFVGLSIGYIKVTPMVACSFFVYERMK 351

>YJR095W (SFC1) [2987] chr10 (609690..610658) Mitochondrial membrane
           succinate-fumarate transporter, member of the
           mitochondrial carrier family (MCF) of membrane
           transporters [969 bp, 322 aa]
          Length = 322

 Score = 87.4 bits (215), Expect = 1e-19,   Method: Compositional matrix adjust.
 Identities = 82/308 (26%), Positives = 133/308 (43%), Gaps = 43/308 (13%)

Query: 19  TLLAGAVSGLLARSITAPMDTIKIRLQL----TPANGLKPFGSQVMEVARSMIKNEGIRS 74
            L+AG  +GL       P+DTIK+R+Q+         +KP G   ++  R++ + EG  +
Sbjct: 13  NLMAGGTAGLFEALCCHPLDTIKVRMQIYRRVAGIEHVKPPG--FIKTGRTIYQKEGFLA 70

Query: 75  FWKGNIPGSLLYVTYGSAQFSSYSLFNRYLT--PFGLEARLHSLVVGAFAGITSSI-VSY 131
            +KG     +  +   + +FSSY  +   L     G+ +  ++ V G  AGIT ++ V  
Sbjct: 71  LYKGLGAVVIGIIPKMAIRFSSYEFYRTLLVNKESGIVSTGNTFVAGVGAGITEAVLVVN 130

Query: 132 PFDVLRTRLVA--------------NNQMHSMSITREVRDIWKLEGLPGFFKGSIASMTT 177
           P +V++ RL A              NN +H+         I K EG+   ++G   +   
Sbjct: 131 PMEVVKIRLQAQHLTPSEPNAGPKYNNAIHA------AYTIVKEEGVSALYRGVSLTAAR 184

Query: 178 ITLTASIMFGTYETIRIYCDENEKTTAAHKKWELATLNHSAGTIGGVIAKIITFPLETIR 237
                   F  Y  ++ +  +N         WE + +    G I G I      PL+TI+
Sbjct: 185 QATNQGANFTVYSKLKEFL-QNYHQMDVLPSWETSCI----GLISGAIGPFSNAPLDTIK 239

Query: 238 RRMQFMNSKHLEKFSRHSSVYGSYKGYGFARIGLQILKQEGVSSLYRGILVALSKTIPTT 297
            R+Q   S  LEK S    +           IG Q+LK+EG  +LY+GI   + +  P  
Sbjct: 240 TRLQKDKSISLEKQSGMKKII---------TIGAQLLKEEGFRALYKGITPRVMRVAPGQ 290

Query: 298 FVSFWGYE 305
            V+F  YE
Sbjct: 291 AVTFTVYE 298

 Score = 54.7 bits (130), Expect = 3e-08,   Method: Compositional matrix adjust.
 Identities = 48/201 (23%), Positives = 88/201 (43%), Gaps = 20/201 (9%)

Query: 14  VAAWKTLLAGAVSGLL-ARSITAPMDTIKIRLQ---LTPAN-GLKPFGSQVMEVARSMIK 68
           V+   T +AG  +G+  A  +  PM+ +KIRLQ   LTP+     P  +  +  A +++K
Sbjct: 108 VSTGNTFVAGVGAGITEAVLVVNPMEVVKIRLQAQHLTPSEPNAGPKYNNAIHAAYTIVK 167

Query: 69  NEGIRSFWKGNIPGSLLYVTYGSAQFSSYSLFNRYLTPFGLEARLHS---LVVGAFAGIT 125
            EG+ + ++G    +    T   A F+ YS    +L  +     L S     +G  +G  
Sbjct: 168 EEGVSALYRGVSLTAARQATNQGANFTVYSKLKEFLQNYHQMDVLPSWETSCIGLISGAI 227

Query: 126 SSIVSYPFDVLRTRLVANNQMHSMSITREV---------RDIWKLEGLPGFFKGSIASMT 176
               + P D ++TRL  +    S+S+ ++            + K EG    +KG    + 
Sbjct: 228 GPFSNAPLDTIKTRLQKDK---SISLEKQSGMKKIITIGAQLLKEEGFRALYKGITPRVM 284

Query: 177 TITLTASIMFGTYETIRIYCD 197
            +    ++ F  YE +R + +
Sbjct: 285 RVAPGQAVTFTVYEYVREHLE 305

 Score = 47.8 bits (112), Expect = 4e-06,   Method: Compositional matrix adjust.
 Identities = 28/102 (27%), Positives = 49/102 (48%), Gaps = 10/102 (9%)

Query: 14  VAAWKTLLAGAVSGLLARSITAPMDTIKIRLQ------LTPANGLKPFGSQVMEVARSMI 67
           + +W+T   G +SG +     AP+DTIK RLQ      L   +G+K    +++ +   ++
Sbjct: 212 LPSWETSCIGLISGAIGPFSNAPLDTIKTRLQKDKSISLEKQSGMK----KIITIGAQLL 267

Query: 68  KNEGIRSFWKGNIPGSLLYVTYGSAQFSSYSLFNRYLTPFGL 109
           K EG R+ +KG  P  +      +  F+ Y     +L   G+
Sbjct: 268 KEEGFRALYKGITPRVMRVAPGQAVTFTVYEYVREHLENLGI 309

 Score = 43.1 bits (100), Expect = 2e-04,   Method: Compositional matrix adjust.
 Identities = 29/99 (29%), Positives = 43/99 (43%), Gaps = 9/99 (9%)

Query: 207 KKWELATLNHSAGTIGGVIAKIITFPLETIRRRMQFMNSKHLEKFSRHSSVYGSYKGYGF 266
           KK     +N  AG   G+   +   PL+TI+ RMQ           R  +     K  GF
Sbjct: 5   KKASHPAINLMAGGTAGLFEALCCHPLDTIKVRMQIY---------RRVAGIEHVKPPGF 55

Query: 267 ARIGLQILKQEGVSSLYRGILVALSKTIPTTFVSFWGYE 305
            + G  I ++EG  +LY+G+   +   IP   + F  YE
Sbjct: 56  IKTGRTIYQKEGFLALYKGLGAVVIGIIPKMAIRFSSYE 94

>AGL047C [4264] [Homologous to ScYPR011C - NSH] (616853..617803)
           [951 bp, 316 aa]
          Length = 316

 Score = 85.9 bits (211), Expect = 5e-19,   Method: Compositional matrix adjust.
 Identities = 81/308 (26%), Positives = 144/308 (46%), Gaps = 40/308 (12%)

Query: 19  TLLAGAVSGLLARSITAPMDTIKIRLQLTPANGLKPFGSQVMEVARSMIKNEGIRSFWKG 78
             +AG V G ++R++ +P++ +KI LQ+  +     +   ++   + + K EG++  ++G
Sbjct: 19  AFVAGGVGGAVSRTVVSPVERVKILLQVQSST--TAYNGGLVHAVKQVYKEEGVKGLFRG 76

Query: 79  NIPGSLLYVTYGSAQFSSYSLFNRYLTPFGLEA--RLHS---LVVGAFAGITSSIVSYPF 133
           N    L    Y + Q++ Y      +   G     +L S   LV GA  G  S +V+YP 
Sbjct: 77  NGINCLRIFPYSAVQYAVYEFCKTRVFHVGQSGHEQLRSWERLVGGALGGGASVLVTYPL 136

Query: 134 DVLRTRL---VAN------NQMHSM----SITREVRDIWKLE-GLPGFFKGSIASMTTIT 179
           D++RTRL    AN      ++ H +     I   +R I++ E GL G+++G   +   + 
Sbjct: 137 DLVRTRLSIQTANLAKLHRSKAHDIRRPPGIVELLRRIFREEGGLRGWYRGVYPTSLGVV 196

Query: 180 LTASIMFGTYETIR--IYCDENEKTTAAHKKWELATLNHSAGTIGGVIAKIITFPLETIR 237
              ++ F  YE ++  I  D +  + AA K         + G + G IA+ + +P + +R
Sbjct: 197 PFVALNFALYERLKALIPHDYDAGSVAAAKL--------AIGAVSGGIAQTVVYPFDLLR 248

Query: 238 RRMQFMNSKHLEKFSRHSSVYGSYKGYGFARIGLQILKQEGVSSLYRGILVALSKTIPTT 297
           RR Q +     E   R++SV         A     I +QEG+   Y+G+   L K +P  
Sbjct: 249 RRFQVLTMGQSELGFRYASV---------ADALWTIGRQEGLRGYYKGLTANLVKVVPAM 299

Query: 298 FVSFWGYE 305
            V ++ YE
Sbjct: 300 AVQWFVYE 307

 Score = 62.4 bits (150), Expect = 6e-11,   Method: Compositional matrix adjust.
 Identities = 54/200 (27%), Positives = 96/200 (48%), Gaps = 20/200 (10%)

Query: 12  QNVAAWKTLLAGAVSGLLARSITAPMDTIKIRLQLTPANGLKPFGSQ---------VMEV 62
           + + +W+ L+ GA+ G  +  +T P+D ++ RL +  AN  K   S+         ++E+
Sbjct: 111 EQLRSWERLVGGALGGGASVLVTYPLDLVRTRLSIQTANLAKLHRSKAHDIRRPPGIVEL 170

Query: 63  ARSMIKNE-GIRSFWKGNIPGSLLYVTYGSAQFSSYSLFNRYLTPFGLEA---RLHSLVV 118
            R + + E G+R +++G  P SL  V + +  F+ Y    + L P   +A       L +
Sbjct: 171 LRRIFREEGGLRGWYRGVYPTSLGVVPFVALNFALYERL-KALIPHDYDAGSVAAAKLAI 229

Query: 119 GAFAGITSSIVSYPFDVLRTRLVANNQMHS------MSITREVRDIWKLEGLPGFFKGSI 172
           GA +G  +  V YPFD+LR R        S       S+   +  I + EGL G++KG  
Sbjct: 230 GAVSGGIAQTVVYPFDLLRRRFQVLTMGQSELGFRYASVADALWTIGRQEGLRGYYKGLT 289

Query: 173 ASMTTITLTASIMFGTYETI 192
           A++  +    ++ +  YE I
Sbjct: 290 ANLVKVVPAMAVQWFVYELI 309

>Kwal_23.3042
          Length = 542

 Score = 87.4 bits (215), Expect = 6e-19,   Method: Compositional matrix adjust.
 Identities = 71/320 (22%), Positives = 142/320 (44%), Gaps = 46/320 (14%)

Query: 20  LLAGAVSGLLARSITAPMDTIK------------------IRLQLTPANGLKPFGSQVME 61
            +AG VSG+++R+ TAP D IK                  I L+  P   L    S +++
Sbjct: 228 FIAGGVSGVVSRTCTAPFDRIKVFLIARTDLSSTFLKSKDIILEKNPNADLSKIKSPLVK 287

Query: 62  VARSMIKNEGIRSFWKGNIPGSLLYVTYGSAQFSSYSLFNRYLTPF-GLE-----ARLHS 115
            A ++ +  GIR+F+ GN   ++      + +F S+ L  R +    G++     +R  +
Sbjct: 288 AATTLYRQGGIRAFYVGNGLNAMKVFPESAIKFGSFELAKRLMAQLEGVQDTAGLSRFST 347

Query: 116 LVVGAFAGITSSIVSYPFDVLRTRLVANNQMHSMSITREV-----RDIWKLEGLPGFFKG 170
            + G   G+ + +  YP D L+ R V    +++ S  R++     +D++K  GL  F++G
Sbjct: 348 YLAGGLGGVMAQLSVYPIDTLKYR-VQCAPLNTESKGRQLLISTAKDMYKEGGLRIFYRG 406

Query: 171 SIASMTTITLTASIMFGTYETIRIYCDENEKTTAAHKKWELATLNHSA---GTIGGVIAK 227
               +  I   A++  GT+  ++ +    +       + ++   N      G   G +  
Sbjct: 407 ITVGIMGIFPYAAMDLGTFSALKKWYIARQARLTGLPEDQVTMSNMFVLLMGAFSGTVGA 466

Query: 228 IITFPLETIRRRMQFMNS-KHLEKFSRHSSVYGSYKGYGFARIGLQILKQEGVSSLYRGI 286
              +P+  +R R+Q   +  H  +++            GF  + L+ +++EG   L++G+
Sbjct: 467 TAVYPVNLLRTRLQAQGTFAHPHRYN------------GFRDVLLKTVQREGYQGLFKGL 514

Query: 287 LVALSKTIPTTFVSFWGYET 306
           +  L+K  P   +S+  YE 
Sbjct: 515 VPNLAKVCPAVSISYLCYEN 534

 Score = 77.4 bits (189), Expect = 1e-15,   Method: Compositional matrix adjust.
 Identities = 52/197 (26%), Positives = 90/197 (45%), Gaps = 19/197 (9%)

Query: 14  VAAWKTLLAGAVSGLLARSITAPMDTIKIRLQLTPANGLKPFGSQVMEVARSMIKNEGIR 73
           ++ + T LAG + G++A+    P+DT+K R+Q  P N        ++  A+ M K  G+R
Sbjct: 342 LSRFSTYLAGGLGGVMAQLSVYPIDTLKYRVQCAPLNTESKGRQLLISTAKDMYKEGGLR 401

Query: 74  SFWKGNIPGSLLYVTYGSAQFSSYSLFNRYLTPFGLEARLHS-------------LVVGA 120
            F++G   G +    Y +    ++S   ++      +ARL               L++GA
Sbjct: 402 IFYRGITVGIMGIFPYAAMDLGTFSALKKWY--IARQARLTGLPEDQVTMSNMFVLLMGA 459

Query: 121 FAGITSSIVSYPFDVLRTRLVANNQMHSMSITREVRDIW----KLEGLPGFFKGSIASMT 176
           F+G   +   YP ++LRTRL A             RD+     + EG  G FKG + ++ 
Sbjct: 460 FSGTVGATAVYPVNLLRTRLQAQGTFAHPHRYNGFRDVLLKTVQREGYQGLFKGLVPNLA 519

Query: 177 TITLTASIMFGTYETIR 193
            +    SI +  YE ++
Sbjct: 520 KVCPAVSISYLCYENLK 536

>Scas_709.9
          Length = 365

 Score = 85.9 bits (211), Expect = 8e-19,   Method: Compositional matrix adjust.
 Identities = 86/308 (27%), Positives = 139/308 (45%), Gaps = 46/308 (14%)

Query: 19  TLLAGAVSGLLARSITAPMDTIKIRLQLTPANGLK----PFGSQVMEVARSMIKNEGIRS 74
           T L+GA++G L+  I  P+D  K RLQ   A G++    P+   V+    +++ +EG+R 
Sbjct: 67  TALSGALAGFLSGIIVCPLDVTKTRLQ---AQGIQSIENPYYRGVLGTMSTIVVDEGVRG 123

Query: 75  FWKGNIPGSLLYVTYGSAQFSSYSLFNRYLTPFGL-EARLHSLVVGAF-AGITSSIVSYP 132
            +KG IP  L Y       FS Y  F + L P  L  +   S    A  AG  S++++ P
Sbjct: 124 LYKGLIPIILGYFPTWMIYFSVYE-FAKDLYPRVLPNSDFISHSCSAITAGAASTVLTNP 182

Query: 133 FDVLRTRL-----VANNQMHSMSITREVRDIWKLEGLPGFFKGSIASMTTITLTASIMFG 187
             V++TRL     +  ++ H        + I   EG+   + G + SM  + L  +I F 
Sbjct: 183 IWVVKTRLMLQTPLGESRTHYRGTIDAFKKIITQEGVRTLYTGLVPSMFGL-LHVAIHFP 241

Query: 188 TYETI--RIYCDENEKTTAAHKKWELATLNHS--------AGTIGGVIAKIITFPLETIR 237
            YE +  R++CD     T  H   E     HS        A +   ++A I+T+P E +R
Sbjct: 242 VYEKLKNRLHCD---TITGGHNSQE-----HSLHLTRLIIASSASKMLASILTYPHEILR 293

Query: 238 RRMQFMNSKHLEKFSRHSSVYGSYKGYGFARIGLQILKQEGVSSLYRGILVALSKTIPTT 297
            RMQ  + K L   S+H  +    + Y +          EG+   Y G    L +T+P +
Sbjct: 294 TRMQLKSDKLL--ISKHKLLDLIKRTYRY----------EGLLGFYSGFATNLLRTVPAS 341

Query: 298 FVSFWGYE 305
            ++   +E
Sbjct: 342 AITLVSFE 349

 Score = 49.3 bits (116), Expect = 1e-06,   Method: Compositional matrix adjust.
 Identities = 47/186 (25%), Positives = 89/186 (47%), Gaps = 19/186 (10%)

Query: 22  AGAVSGLLARSITAPMDTIKIRLQL-TPANGLKPFGSQVMEVARSMIKNEGIRSFWKGNI 80
           AGA S +L    T P+  +K RL L TP    +      ++  + +I  EG+R+ + G +
Sbjct: 172 AGAASTVL----TNPIWVVKTRLMLQTPLGESRTHYRGTIDAFKKIITQEGVRTLYTGLV 227

Query: 81  PGSLLYVTYGSAQFSSYS-LFNRYLTPF---GLEARLHSL------VVGAFAGITSSIVS 130
           P S+  + + +  F  Y  L NR        G  ++ HSL      +  + + + +SI++
Sbjct: 228 P-SMFGLLHVAIHFPVYEKLKNRLHCDTITGGHNSQEHSLHLTRLIIASSASKMLASILT 286

Query: 131 YPFDVLRTRLVANNQMHSMS---ITREVRDIWKLEGLPGFFKGSIASMTTITLTASIMFG 187
           YP ++LRTR+   +    +S   +   ++  ++ EGL GF+ G   ++      ++I   
Sbjct: 287 YPHEILRTRMQLKSDKLLISKHKLLDLIKRTYRYEGLLGFYSGFATNLLRTVPASAITLV 346

Query: 188 TYETIR 193
           ++E  R
Sbjct: 347 SFEYFR 352

 Score = 34.7 bits (78), Expect = 0.072,   Method: Compositional matrix adjust.
 Identities = 32/124 (25%), Positives = 54/124 (43%), Gaps = 15/124 (12%)

Query: 189 YETIRIYCDENEK---TTAAHKKWELATLNHSA--GTIGGVIAKIITFPLETIRRRMQFM 243
           Y+ + +   E EK   +T    K  L+    +A  G + G ++ II  PL+  + R+Q  
Sbjct: 36  YQNMLLQSHEPEKHIASTVIQSKLHLSDPKITALSGALAGFLSGIIVCPLDVTKTRLQAQ 95

Query: 244 NSKHLEKFSRHSSVYGSYKGYGFARIGLQILKQEGVSSLYRGILVALSKTIPTTFVSFWG 303
             + +E    +  V G+            I+  EGV  LY+G++  +    PT  + F  
Sbjct: 96  GIQSIEN-PYYRGVLGTMS---------TIVVDEGVRGLYKGLIPIILGYFPTWMIYFSV 145

Query: 304 YETA 307
           YE A
Sbjct: 146 YEFA 149

>Scas_589.10
          Length = 316

 Score = 84.7 bits (208), Expect = 1e-18,   Method: Compositional matrix adjust.
 Identities = 75/289 (25%), Positives = 139/289 (48%), Gaps = 29/289 (10%)

Query: 20  LLAGAVSGLLARSITAPMDTIKIRLQL----------TPANGLKPFGSQVMEVARSMIKN 69
            ++GAV+G+    +  P+D +K R QL          + A   +P  S ++     ++K 
Sbjct: 17  FISGAVAGMSETIMMYPLDVVKTRFQLQINKKALATSSVAVPKQPEHSSILSCLSKILKE 76

Query: 70  EGIRSFWKGNIPGSLLYVTYGSAQFSSYSLFNR-YLTPFGLEARLH--SLVVGAFAGITS 126
           EG ++ +KG  P  L+ V   + +F+S   F +  +  F L+      +L+ G FAGIT 
Sbjct: 77  EGFKNLYKGMSPPLLMEVPKRAVKFASNEQFQQIMMKKFKLKEVTSTVTLLAGTFAGITE 136

Query: 127 SIVSYPFDVLRTRLVANNQMHSMSITREVRDIWKLEGLPGFFKGSIASMTTITLTASIMF 186
           S++  PF++++ RL  + Q    S  R  R I + +GL G + G  +++   T+  +  F
Sbjct: 137 SLIVVPFELVKIRL-QDAQSDYRSPIRCTRTIIENQGLFGIYAGFESTIWRNTIWNASYF 195

Query: 187 GTYETIRIYCDENEKTTAAHKKWELATLNHSAGTIGGVIAKIITFPLETIRRRMQFMNSK 246
           G    ++ +    + TT    K++    +   G I G ++  ++ P + ++ RMQ   SK
Sbjct: 196 GLIFQVKKFIPRAKSTT----KFQGIRNDFLVGAIAGCMSCFLSVPFDVVKTRMQ--GSK 249

Query: 247 HLEKFSRHSSVYGSYKGYGFARIGLQILKQEGVSSLYRGILVALSKTIP 295
                 + SS  G   G+ +  + L I + EG+  +Y+GIL  + +  P
Sbjct: 250 ------KTSS--GMCYGWAWQSVFL-IYRTEGIKGIYKGILPIICRYGP 289

 Score = 59.3 bits (142), Expect = 7e-10,   Method: Compositional matrix adjust.
 Identities = 46/173 (26%), Positives = 79/173 (45%), Gaps = 21/173 (12%)

Query: 10  KGQNVAAWKTLLAGAVSGLLARSITAPMDTIKIRLQLTPANGLKPFGSQVMEVARSMIKN 69
           K + V +  TLLAG  +G+    I  P + +KIRLQ   ++   P     +   R++I+N
Sbjct: 116 KLKEVTSTVTLLAGTFAGITESLIVVPFELVKIRLQDAQSDYRSP-----IRCTRTIIEN 170

Query: 70  EGI--------RSFWKGNIPGSLLYVTYGSAQFSSYSLFNRYLTPFGLEARLHSLVVGAF 121
           +G+         + W+  I  +    +Y    F       R  +    +   +  +VGA 
Sbjct: 171 QGLFGIYAGFESTIWRNTIWNA----SYFGLIFQVKKFIPRAKSTTKFQGIRNDFLVGAI 226

Query: 122 AGITSSIVSYPFDVLRTRLVANNQMHSMSIT----REVRDIWKLEGLPGFFKG 170
           AG  S  +S PFDV++TR+  + +  S        + V  I++ EG+ G +KG
Sbjct: 227 AGCMSCFLSVPFDVVKTRMQGSKKTSSGMCYGWAWQSVFLIYRTEGIKGIYKG 279

 Score = 47.4 bits (111), Expect = 6e-06,   Method: Compositional matrix adjust.
 Identities = 41/177 (23%), Positives = 71/177 (40%), Gaps = 35/177 (19%)

Query: 113 LHSLVVGAFAGITSSIVSYPFDVLRTRL---------------VANNQMHSMSITREVRD 157
           ++  + GA AG++ +I+ YP DV++TR                V     HS SI   +  
Sbjct: 14  IYQFISGAVAGMSETIMMYPLDVVKTRFQLQINKKALATSSVAVPKQPEHS-SILSCLSK 72

Query: 158 IWKLEGLPGFFKGSIASMTTITLTASIMFGTYETIRIYCDENEKTTAAHKKWEL----AT 213
           I K EG    +KG    +       ++ F + E  +             KK++L    +T
Sbjct: 73  ILKEEGFKNLYKGMSPPLLMEVPKRAVKFASNEQFQ---------QIMMKKFKLKEVTST 123

Query: 214 LNHSAGTIGGVIAKIITFPLETIRRRMQFMNSKHLEKFS------RHSSVYGSYKGY 264
           +   AGT  G+   +I  P E ++ R+Q   S +            +  ++G Y G+
Sbjct: 124 VTLLAGTFAGITESLIVVPFELVKIRLQDAQSDYRSPIRCTRTIIENQGLFGIYAGF 180

 Score = 37.7 bits (86), Expect = 0.008,   Method: Compositional matrix adjust.
 Identities = 27/96 (28%), Positives = 43/96 (44%), Gaps = 17/96 (17%)

Query: 218 AGTIGGVIAKIITFPLETIRRRMQF-MNSKHL-------EKFSRHSSVYGSYKGYGFARI 269
           +G + G+   I+ +PL+ ++ R Q  +N K L        K   HSS+            
Sbjct: 19  SGAVAGMSETIMMYPLDVVKTRFQLQINKKALATSSVAVPKQPEHSSILSCLS------- 71

Query: 270 GLQILKQEGVSSLYRGILVALSKTIPTTFVSFWGYE 305
             +ILK+EG  +LY+G+   L   +P   V F   E
Sbjct: 72  --KILKEEGFKNLYKGMSPPLLMEVPKRAVKFASNE 105

>YNL083W (YNL083W) [4507] chr14 (471377..473014) Member of the
           mitochondrial carrier (MCF) family of membrane
           transporters [1638 bp, 545 aa]
          Length = 545

 Score = 85.9 bits (211), Expect = 2e-18,   Method: Compositional matrix adjust.
 Identities = 73/325 (22%), Positives = 142/325 (43%), Gaps = 56/325 (17%)

Query: 20  LLAGAVSGLLARSITAPMDTIKI----RLQLT--------------PANGLKPFGSQVME 61
            +AG +SG+++R+ TAP D +K+    R  L+              P   +    S + +
Sbjct: 231 FIAGGISGVISRTCTAPFDRLKVFLIARTDLSSILLNSKTDLLAKNPNADINKISSPLAK 290

Query: 62  VARSMIKNEGIRSFWKGNIPGSLLYVTYGSAQFSSYSLFNRYLTPF-GLE-----ARLHS 115
             +S+ +  GI++F+ GN    +      S +F S+ +  + +T   G       ++  +
Sbjct: 291 AVKSLYRQGGIKAFYVGNGLNVIKVFPESSIKFGSFEVTKKIMTKLEGCRDTKDLSKFST 350

Query: 116 LVVGAFAGITSSIVSYPFDVLR---------TRLVANNQMHSMSITREVRDIWKLEGLPG 166
            + G  AG+ +    YP D L+         T+L  NN +   +     +D+++  GL  
Sbjct: 351 YIAGGLAGMAAQFSVYPIDTLKFRVQCAPLDTKLKGNNLLFQTA-----KDMFREGGLRL 405

Query: 167 FFKGSIASMTTITLTASIMFGTYETIRI-YCDENEKTTAAHKKWELATLNH----SAGTI 221
           F++G    +  I   A++  GT+  ++  Y  +  KT    +  +  TL++      G  
Sbjct: 406 FYRGVTVGIVGIFPYAALDLGTFSALKKWYIAKQAKTLNLPQ--DQVTLSNLVVLPMGAF 463

Query: 222 GGVIAKIITFPLETIRRRMQFMNSKHLEKFSRHSSVYGSYKGYGFARIGLQILKQEGVSS 281
            G +   + +P+  +R R+Q   +        H  VY      GF  + L+ L++EG   
Sbjct: 464 SGTVGASVVYPINLLRTRLQAQGT------YAHPYVYN-----GFKDVLLKTLEREGYQG 512

Query: 282 LYRGILVALSKTIPTTFVSFWGYET 306
           L++G++  L+K  P   +S+  YE 
Sbjct: 513 LFKGLVPTLAKVCPAVSISYLCYEN 537

 Score = 78.6 bits (192), Expect = 5e-16,   Method: Compositional matrix adjust.
 Identities = 51/205 (24%), Positives = 98/205 (47%), Gaps = 15/205 (7%)

Query: 6   DSLRKGQNVAAWKTLLAGAVSGLLARSITAPMDTIKIRLQLTPANGLKPFGSQVMEVARS 65
           +  R  ++++ + T +AG ++G+ A+    P+DT+K R+Q  P +      + + + A+ 
Sbjct: 337 EGCRDTKDLSKFSTYIAGGLAGMAAQFSVYPIDTLKFRVQCAPLDTKLKGNNLLFQTAKD 396

Query: 66  MIKNEGIRSFWKGNIPGSLLYVTYGSAQFSSYSLFNRY--------LTPFGLEARLHSLV 117
           M +  G+R F++G   G +    Y +    ++S   ++        L     +  L +LV
Sbjct: 397 MFREGGLRLFYRGVTVGIVGIFPYAALDLGTFSALKKWYIAKQAKTLNLPQDQVTLSNLV 456

Query: 118 V---GAFAGITSSIVSYPFDVLRTRLVANNQMHSMSITREVRDI----WKLEGLPGFFKG 170
           V   GAF+G   + V YP ++LRTRL A        +    +D+     + EG  G FKG
Sbjct: 457 VLPMGAFSGTVGASVVYPINLLRTRLQAQGTYAHPYVYNGFKDVLLKTLEREGYQGLFKG 516

Query: 171 SIASMTTITLTASIMFGTYETIRIY 195
            + ++  +    SI +  YE ++ +
Sbjct: 517 LVPTLAKVCPAVSISYLCYENLKKF 541

>Sklu_2432.5 YLR348C, Contig c2432 10310-11176 reverse complement
          Length = 288

 Score = 84.0 bits (206), Expect = 2e-18,   Method: Compositional matrix adjust.
 Identities = 77/291 (26%), Positives = 129/291 (44%), Gaps = 34/291 (11%)

Query: 23  GAVSGLLARSITAPMDTIKIRLQLTPANGLKPFGSQVMEVARSMIKNEGIRSFWKGNIPG 82
           G   G++A   T P+D  K+RLQ  PA   KP    ++ +A  +++NEG+   + G    
Sbjct: 15  GGFGGIVACVATHPLDLAKVRLQTAPAP--KP---TLVRMASQILRNEGVPGLYSGLTAA 69

Query: 83  SLLYVTYGSAQFSSYSLF-NRYLTPFGLEARLHSLVVGAFAGITSSIVSYPFDVLRTRLV 141
            L   TY +A+F  Y     RY+    L + L+ L    F+G    ++  P DV+  R+ 
Sbjct: 70  ILRQCTYTTARFGVYDFVKERYIPKEYLNSMLYLLPCSMFSGAVGGLIGNPADVVNIRM- 128

Query: 142 ANNQMHSMSITREVRD----IWKL---EGLPGFFKGSIASMTTITLTASIMFGTYETIRI 194
            N+      + R  ++    ++K+   EG+   F G   ++    L  S    TY+  + 
Sbjct: 129 QNDSSLPAELRRNYKNAADGLYKICSGEGVAKLFTGWQPNLVRGILMTSSQVVTYDIAKN 188

Query: 195 YCDENEKTTAAHKKWELATLNHSAGTIGGVIAKIITFPLETIRRRMQFMNSKHLEKFSRH 254
           Y  +N      +K    A+       + G++A  +  P + I+ R+  MN+    K S  
Sbjct: 189 YLVQNVGLDKDNKSTHFAS-----SLLAGLVATTVCSPADVIKTRV--MNA---HKHSHD 238

Query: 255 SSVYGSYKGYGFARIGLQILKQEGVSSLYRGILVALSKTIPTTFVSFWGYE 305
           S+V          RI L  +KQEG S ++RG L +  +  P T + F   E
Sbjct: 239 SAV----------RILLDAVKQEGPSFMFRGWLPSFVRLGPNTILIFLTVE 279

 Score = 49.3 bits (116), Expect = 1e-06,   Method: Compositional matrix adjust.
 Identities = 46/181 (25%), Positives = 79/181 (43%), Gaps = 11/181 (6%)

Query: 19  TLLAGAVSGLLARSITAPMDTIKIRLQLT---PANGLKPFGSQVMEVARSMIKNEGIRSF 75
           ++ +GAV GL+      P D + IR+Q     PA  L+       +    +   EG+   
Sbjct: 107 SMFSGAVGGLIGN----PADVVNIRMQNDSSLPAE-LRRNYKNAADGLYKICSGEGVAKL 161

Query: 76  WKGNIPGSLLYVTYGSAQFSSYSLFNRYLTP-FGLEARLHS--LVVGAFAGITSSIVSYP 132
           + G  P  +  +   S+Q  +Y +   YL    GL+    S        AG+ ++ V  P
Sbjct: 162 FTGWQPNLVRGILMTSSQVVTYDIAKNYLVQNVGLDKDNKSTHFASSLLAGLVATTVCSP 221

Query: 133 FDVLRTRLVANNQMHSMSITREVRDIWKLEGLPGFFKGSIASMTTITLTASIMFGTYETI 192
            DV++TR++  ++    S  R + D  K EG    F+G + S   +     ++F T E +
Sbjct: 222 ADVIKTRVMNAHKHSHDSAVRILLDAVKQEGPSFMFRGWLPSFVRLGPNTILIFLTVEQL 281

Query: 193 R 193
           R
Sbjct: 282 R 282

>Scas_632.9
          Length = 292

 Score = 82.4 bits (202), Expect = 6e-18,   Method: Compositional matrix adjust.
 Identities = 78/317 (24%), Positives = 141/317 (44%), Gaps = 49/317 (15%)

Query: 5   EDSLRKGQNVAAWKTLLAGAVSGLLARSITAPMDTIKIRLQLTPANGLKPFGSQVMEVAR 64
           +  + K     A   ++ G+++G   + I  P DT+K+RLQ          GS +     
Sbjct: 6   DHPIEKSSVQNALSDIVNGSIAGAFGKIIEYPFDTVKVRLQTQ--------GSHIFPTTW 57

Query: 65  SMIK----NEGI-RSFWKGNIPGSLLY--VTYGSAQFSSYSLFNRYLTPFGLEARLHSLV 117
           S IK    NEG+ R F++G   GS L+      +  F SY+  +  L  F   + L +++
Sbjct: 58  SCIKYTYHNEGVWRGFFQG--IGSPLFGAALENATLFVSYNQCSNVLEKFTNVSPLSNIL 115

Query: 118 V-GAFAGITSSIVSYPFDVLRTRLVANN-------QMHSMSITREVRDIWKLEGLPGFFK 169
           + GAFAG  +S V  P ++++ +L  +N       Q+    I   +  + + +G+ G ++
Sbjct: 116 LSGAFAGSCASFVLTPVELIKCKLQVSNLQTAVEGQIKHTKIIPTLMYVLREKGILGLWQ 175

Query: 170 GSIASMTTITLTASIMFGTYETIRIYCDENEKTTAAHKKWELATLNHSAGTIGGVIAKII 229
           G  ++    +L     F TYE ++    +  K T  +K WEL      +G   G+     
Sbjct: 176 GQSSTFIRESLGGVAWFATYEVMKQGLKDRRKDTE-NKTWELLV----SGASAGLAFNAS 230

Query: 230 TFPLETIRRRMQFMNSKHLEKFSRHSSVYGSYKGYGFARIGLQILKQEGVSSLYRGILVA 289
            FP +T++  MQ          + H ++  + K         ++L   G++  YRG+ + 
Sbjct: 231 IFPADTVKSMMQ----------TEHITLINAVK---------KVLTTYGITGFYRGLGIT 271

Query: 290 LSKTIPTTFVSFWGYET 306
           L + +P     F+ YET
Sbjct: 272 LIRAVPANATVFYMYET 288

 Score = 47.4 bits (111), Expect = 6e-06,   Method: Compositional matrix adjust.
 Identities = 46/200 (23%), Positives = 91/200 (45%), Gaps = 23/200 (11%)

Query: 6   DSLRKGQNVAAWKT-LLAGAVSGLLARSITAPMDTIKIRLQL----TPANGLKPFGSQVM 60
           + L K  NV+     LL+GA +G  A  +  P++ IK +LQ+    T   G +   ++++
Sbjct: 100 NVLEKFTNVSPLSNILLSGAFAGSCASFVLTPVELIKCKLQVSNLQTAVEG-QIKHTKII 158

Query: 61  EVARSMIKNEGIRSFWKGNIPGSLLYVTYGSAQFSSYSLFNRYLTPFGLEARLHS----- 115
                +++ +GI   W+G     +     G A F++Y +  +     GL+ R        
Sbjct: 159 PTLMYVLREKGILGLWQGQSSTFIRESLGGVAWFATYEVMKQ-----GLKDRRKDTENKT 213

Query: 116 ---LVVGAFAGITSSIVSYPFDVLRTRLVANNQMHSMSITREVRDIWKLEGLPGFFKGSI 172
              LV GA AG+  +   +P D +++ +    Q   +++   V+ +    G+ GF++G  
Sbjct: 214 WELLVSGASAGLAFNASIFPADTVKSMM----QTEHITLINAVKKVLTTYGITGFYRGLG 269

Query: 173 ASMTTITLTASIMFGTYETI 192
            ++       + +F  YET+
Sbjct: 270 ITLIRAVPANATVFYMYETL 289

>CAGL0J05522g complement(524930..526489) highly similar to sp|P48233
           Saccharomyces cerevisiae YNL083w, hypothetical start
          Length = 519

 Score = 84.0 bits (206), Expect = 8e-18,   Method: Compositional matrix adjust.
 Identities = 70/321 (21%), Positives = 141/321 (43%), Gaps = 48/321 (14%)

Query: 20  LLAGAVSGLLARSITAPMDTIKI----RLQLT--------------PANGLKPFGSQVME 61
            +AG +SG+++R+ TAP D +K+    R  L+              P        S +++
Sbjct: 204 FIAGGISGVISRTCTAPFDRLKVFLIARTDLSSTLLNSTEDVLAKNPHAKPNKLRSPLVK 263

Query: 62  VARSMIKNEGIRSFWKGNIPGSLLYVTYGSAQFSSYSLFNRYLTPFGLE--------ARL 113
              S+ +  GI+SF+ GN   +L      S +F S+ +  + +T   +E        ++L
Sbjct: 264 AIISLYRQGGIKSFYVGNGLNALKVFPESSIKFGSFEITKKLMTK--VENCKDTKDLSKL 321

Query: 114 HSLVVGAFAGITSSIVSYPFDVLRTRLVA---NNQMHSMSIT-REVRDIWKLEGLPGFFK 169
            + + G  AG+ +    YP D L+ R+     N ++    +  +  ++++   GL  F++
Sbjct: 322 STFIAGGLAGVCAQFSVYPIDTLKFRMQCAPLNAELKGRKLMIQTAKEMYTEGGLKLFYR 381

Query: 170 GSIASMTTITLTASIMFGTYETIRIYCDENEKTTAAHKKWELATLNH----SAGTIGGVI 225
           G    +  I   A++  GT+  ++ +   + K    +KK E   L++      G   G  
Sbjct: 382 GVTVGVLGIFPYAALDLGTFSMLKKWY-ISSKAKKLNKKEEDVELSNLVVLPMGAFSGTF 440

Query: 226 AKIITFPLETIRRRMQFMNSKHLEKFSRHSSVYGSYKGYGFARIGLQILKQEGVSSLYRG 285
              + +P+  +R R+Q              +    Y+  GF  + L+ +++EG   L++G
Sbjct: 441 GATVVYPINLLRTRLQ-----------AQGTFAHPYRYDGFRDVLLKTIQREGYPGLFKG 489

Query: 286 ILVALSKTIPTTFVSFWGYET 306
           ++  L+K  P   +S+  YE 
Sbjct: 490 LVPTLAKVCPAVSISYLCYEN 510

 Score = 84.0 bits (206), Expect = 8e-18,   Method: Compositional matrix adjust.
 Identities = 53/203 (26%), Positives = 97/203 (47%), Gaps = 15/203 (7%)

Query: 6   DSLRKGQNVAAWKTLLAGAVSGLLARSITAPMDTIKIRLQLTPANGLKPFGSQVMEVARS 65
           ++ +  ++++   T +AG ++G+ A+    P+DT+K R+Q  P N        +++ A+ 
Sbjct: 310 ENCKDTKDLSKLSTFIAGGLAGVCAQFSVYPIDTLKFRMQCAPLNAELKGRKLMIQTAKE 369

Query: 66  MIKNEGIRSFWKGNIPGSLLYVTYGSAQFSSYSLFNRY--------LTPFGLEARLHSLV 117
           M    G++ F++G   G L    Y +    ++S+  ++        L     +  L +LV
Sbjct: 370 MYTEGGLKLFYRGVTVGVLGIFPYAALDLGTFSMLKKWYISSKAKKLNKKEEDVELSNLV 429

Query: 118 V---GAFAGITSSIVSYPFDVLRTRLVANNQMHSMSITREVRDIW----KLEGLPGFFKG 170
           V   GAF+G   + V YP ++LRTRL A             RD+     + EG PG FKG
Sbjct: 430 VLPMGAFSGTFGATVVYPINLLRTRLQAQGTFAHPYRYDGFRDVLLKTIQREGYPGLFKG 489

Query: 171 SIASMTTITLTASIMFGTYETIR 193
            + ++  +    SI +  YE ++
Sbjct: 490 LVPTLAKVCPAVSISYLCYENLK 512

>Sklu_2127.5 YOR130C, Contig c2127 7354-8190 reverse complement
          Length = 278

 Score = 81.6 bits (200), Expect = 1e-17,   Method: Compositional matrix adjust.
 Identities = 74/300 (24%), Positives = 133/300 (44%), Gaps = 40/300 (13%)

Query: 16  AWKTLLAGAVSGLLARSITAPMDTIKIRLQLTPANGLKPFGSQVMEVARSMIKNEGI-RS 74
           A K +L G+++G + + I  P DT+K+RLQ  PA+      S +    +    NEG+ R 
Sbjct: 6   AAKDILYGSIAGAVGKVIEYPFDTVKVRLQTQPAHMFPTTWSCI----KFTYDNEGLWRG 61

Query: 75  FWKG---NIPGSLLYVTYGSAQFSSYSLFNRYLTPFGLEARLHSLV-VGAFAGITSSIVS 130
           F++G    + G+ L     +  F S++   R L    L + L   V  GAFAG  +S V 
Sbjct: 62  FYQGIGSPLAGAAL---ENAVLFVSFNQAKRLLDVESLLSPLSKTVWAGAFAGACASFVL 118

Query: 131 YPFDVLRTRLVANN----QMHSMSITREVRDIWKLEGLPGFFKGSIASMTTITLTASIMF 186
            P ++++ +L  +N    +     I   ++ +    G  G ++G   +    +   +  F
Sbjct: 119 TPVELIKCKLQVSNLSTTKTSHTKILPTIKSVLSERGFLGLWQGQSGTFIRESGGGAAWF 178

Query: 187 GTYETIRIYCDENEKTTAAHKKWELATLNHSAGTIGGVIAKIITFPLETIRRRMQFMNSK 246
            TYE ++ Y   + +    +  WEL     ++G   G+      FP +TI+  MQ   + 
Sbjct: 179 TTYEVVKNYL-ASRRQAEQNTTWELL----ASGASAGLAFNASIFPADTIKSTMQ---TD 230

Query: 247 HLEKFSRHSSVYGSYKGYGFARIGLQILKQEGVSSLYRGILVALSKTIPTTFVSFWGYET 306
           H++  S    +Y                 ++G++  YRG+ + L + +P     F+ YET
Sbjct: 231 HIDLSSATRKIYA----------------RQGIAGFYRGLGITLIRAVPANAAIFYTYET 274

 Score = 62.4 bits (150), Expect = 6e-11,   Method: Compositional matrix adjust.
 Identities = 43/179 (24%), Positives = 88/179 (49%), Gaps = 9/179 (5%)

Query: 18  KTLLAGAVSGLLARSITAPMDTIKIRLQLTPANGLKPFGSQVMEVARSMIKNEGIRSFWK 77
           KT+ AGA +G  A  +  P++ IK +LQ++  +  K   ++++   +S++   G    W+
Sbjct: 102 KTVWAGAFAGACASFVLTPVELIKCKLQVSNLSTTKTSHTKILPTIKSVLSERGFLGLWQ 161

Query: 78  GNIPGSLLYVTYGSAQFSSYSLFNRYLTPFGLEARLHS----LVVGAFAGITSSIVSYPF 133
           G     +     G+A F++Y +   YL     +A  ++    L  GA AG+  +   +P 
Sbjct: 162 GQSGTFIRESGGGAAWFTTYEVVKNYLAS-RRQAEQNTTWELLASGASAGLAFNASIFPA 220

Query: 134 DVLRTRLVANNQMHSMSITREVRDIWKLEGLPGFFKGSIASMTTITLTASIMFGTYETI 192
           D +++ +    Q   + ++   R I+  +G+ GF++G   ++       + +F TYET+
Sbjct: 221 DTIKSTM----QTDHIDLSSATRKIYARQGIAGFYRGLGITLIRAVPANAAIFYTYETL 275

 Score = 43.1 bits (100), Expect = 1e-04,   Method: Compositional matrix adjust.
 Identities = 30/138 (21%), Positives = 59/138 (42%), Gaps = 10/138 (7%)

Query: 109 LEARLHSLVVGAFAGITSSIVSYPFDVLRTRLVANNQMHSMSITREVRDIWKLEGL-PGF 167
            E     ++ G+ AG    ++ YPFD ++ RL         +    ++  +  EGL  GF
Sbjct: 3   FEEAAKDILYGSIAGAVGKVIEYPFDTVKVRLQTQPAHMFPTTWSCIKFTYDNEGLWRGF 62

Query: 168 FKGSIASMTTITLTASIMFGTYETIRIYCD-ENEKTTAAHKKWELATLNHSAGTIGGVIA 226
           ++G  + +    L  +++F ++   +   D E+  +  +   W        AG   G  A
Sbjct: 63  YQGIGSPLAGAALENAVLFVSFNQAKRLLDVESLLSPLSKTVW--------AGAFAGACA 114

Query: 227 KIITFPLETIRRRMQFMN 244
             +  P+E I+ ++Q  N
Sbjct: 115 SFVLTPVELIKCKLQVSN 132

 Score = 30.4 bits (67), Expect = 1.5,   Method: Compositional matrix adjust.
 Identities = 19/72 (26%), Positives = 32/72 (44%), Gaps = 8/72 (11%)

Query: 7   SLRKGQNVAAWKTLLAGAVSGLLARSITAPMDTIKIRLQLTPANGLKPFGSQVMEVARSM 66
           S R+ +    W+ L +GA +GL   +   P DTIK  +Q    +        +    R +
Sbjct: 190 SRRQAEQNTTWELLASGASAGLAFNASIFPADTIKSTMQTDHID--------LSSATRKI 241

Query: 67  IKNEGIRSFWKG 78
              +GI  F++G
Sbjct: 242 YARQGIAGFYRG 253

>ADL009W [1733] [Homologous to ScYIL006W - SH; ScYEL006W - SH]
           complement(693078..694217) [1140 bp, 379 aa]
          Length = 379

 Score = 82.4 bits (202), Expect = 2e-17,   Method: Compositional matrix adjust.
 Identities = 81/301 (26%), Positives = 136/301 (45%), Gaps = 36/301 (11%)

Query: 19  TLLAGAVSGLLARSITAPMDTIKIRLQLTPANGLKPFGSQVMEVARSMIKNEGIRSFWKG 78
           T ++GA++G ++  +  P+D  K RLQ   A   + +   ++    +++++EG+   +KG
Sbjct: 87  TAVSGALAGFVSGIMVCPLDVAKTRLQAQGAGSGERYYRGIVGTLSAILRDEGVAGLYKG 146

Query: 79  NIPGSLLYVTYGSAQFSSYS-LFNRYLT--PFGLEARLHSLVVGAFAGITSSIVSYPFDV 135
             P  L Y       FS Y     RY +  P G  +   S +    AG  S+ ++ P  V
Sbjct: 147 LAPIVLGYFPTWMLYFSVYEKCKQRYPSYLPGGFVSHAASALT---AGAISTALTNPIWV 203

Query: 136 LRTRL-----VANNQMHSMSITREVRDIWKLEGLPGFFKGSIASMTTITLTASIMFGTYE 190
           ++TRL     V+ +  +  S     R +++ EGL  F+ G + S+  +    +I F  YE
Sbjct: 204 VKTRLMIQSDVSRDSTNYRSTLDAFRKMYRSEGLKVFYSGLVPSLFGL-FHVAIHFPVYE 262

Query: 191 TIRIYCDENEKTTAA------HKKWELATLNHSAGTIGGVIAKIITFPLETIRRRMQFMN 244
            ++I+   N  T AA      H K +L  L   A  +  V+A +IT+P E +R RMQ   
Sbjct: 263 KLKIWLHRN--TPAADGQRLDHNKLQLDRLI-VASCLSKVVASVITYPHEILRTRMQV-- 317

Query: 245 SKHLEKFSRHSSVYGSYKGYGFARIGLQILKQEGVSSLYRGILVALSKTIPTTFVSFWGY 304
                   RHS V  S        +  +I   EG    Y G    L +T+P + ++   +
Sbjct: 318 --------RHSGVPPS-----LLNLLGRIRASEGYVGFYSGFATNLVRTVPASVITLVSF 364

Query: 305 E 305
           E
Sbjct: 365 E 365

 Score = 48.9 bits (115), Expect = 2e-06,   Method: Compositional matrix adjust.
 Identities = 46/192 (23%), Positives = 84/192 (43%), Gaps = 17/192 (8%)

Query: 16  AWKTLLAGAVSGLLARSITAPMDTIKIRLQLTPANGLKPFGSQ-VMEVARSMIKNEGIRS 74
           A   L AGA+S     ++T P+  +K RL +           +  ++  R M ++EG++ 
Sbjct: 184 AASALTAGAIS----TALTNPIWVVKTRLMIQSDVSRDSTNYRSTLDAFRKMYRSEGLKV 239

Query: 75  FWKGNIPGSLLYVTYGSAQFSSYSLFNRYL---TPFGLEARLHS--------LVVGAFAG 123
           F+ G +P SL  + + +  F  Y     +L   TP     RL          +V    + 
Sbjct: 240 FYSGLVP-SLFGLFHVAIHFPVYEKLKIWLHRNTPAADGQRLDHNKLQLDRLIVASCLSK 298

Query: 124 ITSSIVSYPFDVLRTRLVANNQMHSMSITREVRDIWKLEGLPGFFKGSIASMTTITLTAS 183
           + +S+++YP ++LRTR+   +     S+   +  I   EG  GF+ G   ++      + 
Sbjct: 299 VVASVITYPHEILRTRMQVRHSGVPPSLLNLLGRIRASEGYVGFYSGFATNLVRTVPASV 358

Query: 184 IMFGTYETIRIY 195
           I   ++E  R Y
Sbjct: 359 ITLVSFEYFRKY 370

>YIL006W (YIL006W) [2659] chr9 (344059..345180) Member of the
           mitochondrial carrier (MCF) family of membrane
           transporters [1122 bp, 373 aa]
          Length = 373

 Score = 82.0 bits (201), Expect = 2e-17,   Method: Compositional matrix adjust.
 Identities = 78/303 (25%), Positives = 128/303 (42%), Gaps = 39/303 (12%)

Query: 19  TLLAGAVSGLLARSITAPMDTIKIRLQLTPANGLK-----PFGSQVMEVARSMIKNEGIR 73
           T L+GA +G L+     P+D  K RLQ   A GL+     P+   +M    +++++EG R
Sbjct: 80  TALSGAFAGFLSGVAVCPLDVAKTRLQ---AQGLQTRFENPYYRGIMGTLSTIVRDEGPR 136

Query: 74  SFWKGNIPGSLLYVTYGSAQFSSYS----LFNRYLTPFGLEARLHSLVVGAFAGITSSIV 129
             +KG +P  L Y       FS Y      F+     F   A+  + +    AG  S+ +
Sbjct: 137 GLYKGLVPIVLGYFPTWMIYFSVYEFSKKFFHGIFPQFDFVAQSCAAIT---AGAASTTL 193

Query: 130 SYPFDVLRTRLVANNQM-----HSMSITREVRDIWKLEGLPGFFKGSIASMTTITLTASI 184
           + P  V++TRL+  + +     H        R ++  EG    + G + S+  +    +I
Sbjct: 194 TNPIWVVKTRLMLQSNLGEHPTHYKGTFDAFRKLFYQEGFKALYAGLVPSLLGL-FHVAI 252

Query: 185 MFGTYET--IRIYCDENEKTTAAHKKWELATLNHSAGTIGGVIAKIITFPLETIRRRMQF 242
            F  YE   +R +C   E  T +     L      A ++  +IA  +T+P E +R RMQ 
Sbjct: 253 HFPIYEDLKVRFHCYSRENNTNSINLQRLIM----ASSVSKMIASAVTYPHEILRTRMQL 308

Query: 243 MNSKHLEKFSRHSSVYGSYKGYGFARIGLQILKQEGVSSLYRGILVALSKTIPTTFVSFW 302
                       S +  S +   F  I      QEG+   Y G    L +TIP + ++  
Sbjct: 309 -----------KSDIPDSIQRRLFPLIK-ATYAQEGLKGFYSGFTTNLVRTIPASAITLV 356

Query: 303 GYE 305
            +E
Sbjct: 357 SFE 359

 Score = 47.8 bits (112), Expect = 4e-06,   Method: Compositional matrix adjust.
 Identities = 42/183 (22%), Positives = 82/183 (44%), Gaps = 13/183 (7%)

Query: 22  AGAVSGLLARSITAPMDTIKIRLQLTPANGLKPFGSQ-VMEVARSMIKNEGIRSFWKGNI 80
           A   +G  + ++T P+  +K RL L    G  P   +   +  R +   EG ++ + G +
Sbjct: 182 AAITAGAASTTLTNPIWVVKTRLMLQSNLGEHPTHYKGTFDAFRKLFYQEGFKALYAGLV 241

Query: 81  PGSLLYVTYGSAQFSSYSLFNRYLTPFGLEARLHSL------VVGAFAGITSSIVSYPFD 134
           P SLL + + +  F  Y         +  E   +S+      +  + + + +S V+YP +
Sbjct: 242 P-SLLGLFHVAIHFPIYEDLKVRFHCYSRENNTNSINLQRLIMASSVSKMIASAVTYPHE 300

Query: 135 VLRTRLVANNQMHSMSITRE----VRDIWKLEGLPGFFKGSIASMTTITLTASIMFGTYE 190
           +LRTR+   + +   SI R     ++  +  EGL GF+ G   ++      ++I   ++E
Sbjct: 301 ILRTRMQLKSDIPD-SIQRRLFPLIKATYAQEGLKGFYSGFTTNLVRTIPASAITLVSFE 359

Query: 191 TIR 193
             R
Sbjct: 360 YFR 362

>KLLA0C11363g complement(975442..976995) similar to sp|P48233
           Saccharomyces cerevisiae YNL083w singleton, start by
           similarity
          Length = 517

 Score = 82.4 bits (202), Expect = 2e-17,   Method: Compositional matrix adjust.
 Identities = 68/320 (21%), Positives = 138/320 (43%), Gaps = 46/320 (14%)

Query: 20  LLAGAVSGLLARSITAPMDTIKI----RLQLT--------------PANGLKPFGSQVME 61
            +AG  SG+++R+ TAP D IK+    R  L+              P   L    S +++
Sbjct: 203 FIAGGCSGVVSRTCTAPFDRIKVFLIARTDLSSTLLNSKDTLLAKNPNADLSKIKSPLIK 262

Query: 62  VARSMIKNEGIRSFWKGNIPGSLLYVTYGSAQFSSYSLFNRYLTPFGLE--------ARL 113
            A ++ +  G+R+F+ GN    +      + +F S+ +  R +    LE        +RL
Sbjct: 263 AATTLYRQGGLRAFYVGNGLNVVKVFPESAIKFGSFEMAKRIMA--RLENVKDTSELSRL 320

Query: 114 HSLVVGAFAGITSSIVSYPFDVLRTRL----VANNQMHSMSITREVRDIWKLEGLPGFFK 169
            + + G   G+ +    YP D L+ R+    +  N   S  + +  +++++  G+  F++
Sbjct: 321 STYIAGGLGGVAAQFSVYPIDTLKYRIQCAPLNTNLKKSSILLQTAKEMYQQGGIRLFYR 380

Query: 170 GSIASMTTITLTASIMFGTYETIRIYCDENEKTTAAHKKWELATLNH---SAGTIGGVIA 226
           G    +  I   A++  GT+  ++ +  + E       + E+   N      G   G + 
Sbjct: 381 GVHIGVMGIFPYAALDLGTFSALKKWYIKKEAKKTGLPEDEVIISNLIVLPMGAFSGTVG 440

Query: 227 KIITFPLETIRRRMQFMNSKHLEKFSRHSSVYGSYKGYGFARIGLQILKQEGVSSLYRGI 286
             + +P+  +R R+Q   +        H   Y      GF+ +  + +++EG   L++G+
Sbjct: 441 ATLVYPINLLRTRLQAQGT------YAHPHTYN-----GFSDVLKKTIQREGYQGLFKGL 489

Query: 287 LVALSKTIPTTFVSFWGYET 306
           +  L+K  P   +S+  YE 
Sbjct: 490 VPNLAKVCPAVSISYLCYEN 509

 Score = 74.7 bits (182), Expect = 9e-15,   Method: Compositional matrix adjust.
 Identities = 53/203 (26%), Positives = 95/203 (46%), Gaps = 15/203 (7%)

Query: 6   DSLRKGQNVAAWKTLLAGAVSGLLARSITAPMDTIKIRLQLTPANGLKPFGSQVMEVARS 65
           ++++    ++   T +AG + G+ A+    P+DT+K R+Q  P N      S +++ A+ 
Sbjct: 309 ENVKDTSELSRLSTYIAGGLGGVAAQFSVYPIDTLKYRIQCAPLNTNLKKSSILLQTAKE 368

Query: 66  MIKNEGIRSFWKGNIPGSLLYVTYGSAQFSSYSLFNRYL-----TPFGL---EARLHSLV 117
           M +  GIR F++G   G +    Y +    ++S   ++         GL   E  + +L+
Sbjct: 369 MYQQGGIRLFYRGVHIGVMGIFPYAALDLGTFSALKKWYIKKEAKKTGLPEDEVIISNLI 428

Query: 118 V---GAFAGITSSIVSYPFDVLRTRLVANNQMHSMSITREVRDIWK----LEGLPGFFKG 170
           V   GAF+G   + + YP ++LRTRL A              D+ K     EG  G FKG
Sbjct: 429 VLPMGAFSGTVGATLVYPINLLRTRLQAQGTYAHPHTYNGFSDVLKKTIQREGYQGLFKG 488

Query: 171 SIASMTTITLTASIMFGTYETIR 193
            + ++  +    SI +  YE ++
Sbjct: 489 LVPNLAKVCPAVSISYLCYENLK 511

>CAGL0K10362g complement(1009155..1010060) similar to sp|Q12375
           Saccharomyces cerevisiae YOR130c ARG11, start by
           similarity
          Length = 301

 Score = 80.9 bits (198), Expect = 3e-17,   Method: Compositional matrix adjust.
 Identities = 79/318 (24%), Positives = 138/318 (43%), Gaps = 58/318 (18%)

Query: 15  AAWKTLLAGAVSGLLARSITAPMDTIKIRLQLTPANGLKPFGSQVMEVARSMI----KNE 70
           AA++ +L G+++G L + I  P DT+K+RLQ          G  V     S I    KNE
Sbjct: 12  AAFRDILYGSIAGALGKVIEYPFDTVKVRLQTQ--------GRHVFPDTWSCITYTYKNE 63

Query: 71  G-IRSFWKGNIPGSLLYVTYGSAQFSSYSLFNRYLTPFGLEARLHSLVV-GAFAGITSSI 128
           G I+ F++G            +A F SY+  +++L  +   + L ++++ GAFAG  +S 
Sbjct: 64  GIIKGFFQGIASPLAGAAIENAALFLSYNQCSKFLQHYTNVSDLTNILISGAFAGSCASF 123

Query: 129 VSYPFDVLRTRLVANN---------------QMHSMSITREVRDIWKLEGLPGFFKGSIA 173
           V  P ++++ +L  +N               + H+  I   ++ + K  G  G ++G   
Sbjct: 124 VLTPVELIKCKLQVSNLQSLPLGVAGGNTVTERHT-RIIPTIQAVIKNRGFIGLWQGQSG 182

Query: 174 SMTTITLTASIMFGTYETIRIYCD-----ENEKTTAAHKKWELATLNHSAGTIGGVIAKI 228
           +    +      F TYE ++ Y       E+      +K WEL     ++G   G+    
Sbjct: 183 TFIRESFGGVAWFATYELMKKYLKSRHNIEDPSLPNDNKTWELL----ASGASAGLAFNA 238

Query: 229 ITFPLETIRRRMQFMNSKHLEKFSRHSSVYGSYKGYGFARIGLQILKQEGVSSLYRGILV 288
             FP +T++  MQ   ++HL                G      +I  ++G+   YRG+ +
Sbjct: 239 SIFPADTVKSMMQ---TEHL----------------GLKTAIKKIFVEKGLRGFYRGLGI 279

Query: 289 ALSKTIPTTFVSFWGYET 306
            L + IP     F+ YET
Sbjct: 280 TLIRAIPANATVFYVYET 297

 Score = 54.7 bits (130), Expect = 2e-08,   Method: Compositional matrix adjust.
 Identities = 46/194 (23%), Positives = 92/194 (47%), Gaps = 27/194 (13%)

Query: 20  LLAGAVSGLLARSITAPMDTIKIRLQLTPANGLKPFG-----------SQVMEVARSMIK 68
           L++GA +G  A  +  P++ IK +LQ++    L P G           ++++   +++IK
Sbjct: 111 LISGAFAGSCASFVLTPVELIKCKLQVSNLQSL-PLGVAGGNTVTERHTRIIPTIQAVIK 169

Query: 69  NEGIRSFWKGNIPGSLLYVTYGS-AQFSSYSLFNRYL-TPFGLE--------ARLHSLVV 118
           N G    W+G   G+ +  ++G  A F++Y L  +YL +   +E             L  
Sbjct: 170 NRGFIGLWQGQ-SGTFIRESFGGVAWFATYELMKKYLKSRHNIEDPSLPNDNKTWELLAS 228

Query: 119 GAFAGITSSIVSYPFDVLRTRLVANNQMHSMSITREVRDIWKLEGLPGFFKGSIASMTTI 178
           GA AG+  +   +P D +++ +    Q   + +   ++ I+  +GL GF++G   ++   
Sbjct: 229 GASAGLAFNASIFPADTVKSMM----QTEHLGLKTAIKKIFVEKGLRGFYRGLGITLIRA 284

Query: 179 TLTASIMFGTYETI 192
               + +F  YET+
Sbjct: 285 IPANATVFYVYETL 298

 Score = 41.6 bits (96), Expect = 4e-04,   Method: Compositional matrix adjust.
 Identities = 31/141 (21%), Positives = 59/141 (41%), Gaps = 8/141 (5%)

Query: 109 LEARLHSLVVGAFAGITSSIVSYPFDVLRTRLVANNQMHSMSITREVRDIWKLEG-LPGF 167
           L A    ++ G+ AG    ++ YPFD ++ RL    +         +   +K EG + GF
Sbjct: 10  LAAAFRDILYGSIAGALGKVIEYPFDTVKVRLQTQGRHVFPDTWSCITYTYKNEGIIKGF 69

Query: 168 FKGSIASMTTITLTASIMFGTYETIRIYCDENEKTTAAHKKWELATLNHSAGTIGGVIAK 227
           F+G  + +    +  + +F +Y     +       +      +L  +  S G   G  A 
Sbjct: 70  FQGIASPLAGAAIENAALFLSYNQCSKFLQHYTNVS------DLTNILIS-GAFAGSCAS 122

Query: 228 IITFPLETIRRRMQFMNSKHL 248
            +  P+E I+ ++Q  N + L
Sbjct: 123 FVLTPVELIKCKLQVSNLQSL 143

>Sklu_2037.2 YIL134W, Contig c2037 1645-2577 reverse complement
          Length = 310

 Score = 80.9 bits (198), Expect = 3e-17,   Method: Compositional matrix adjust.
 Identities = 72/315 (22%), Positives = 154/315 (48%), Gaps = 39/315 (12%)

Query: 18  KTLLAGAVSGLLARSITAPMDTIKIRLQLTPANGLKPFGSQVMEVARSMIKNEGIRSFWK 77
           K +++G  +G +    T P+D +K+RLQL   N  KP G    +V + ++K+    SF++
Sbjct: 10  KEMISGLTAGTITTVSTHPLDLVKVRLQLLATNK-KPQG--YYDVVKRIVKDSKQHSFFR 66

Query: 78  -----------GN-IPGSLLYVTYGSA-----QFSSYSL--FNRYLTPFGLEARLHSLVV 118
                      GN +   L +  Y ++     Q+ +  +  FN  +        L  L+ 
Sbjct: 67  ETYRGLGVNLLGNSVAWGLYFGLYRASKDWVFQWCNTDVKRFNNTMNNDKEMTSLMYLLA 126

Query: 119 GAFAGITSSIVSYPFDVLRTRLVANNQMHSMSITREV---RDIWKLEGLPGFFKGSIASM 175
            A +G+ +S+++ P  V++TR+++ + + S S    V   + ++++EGL GF++G + S+
Sbjct: 127 AAMSGVATSVLTNPIWVIKTRIMSTSFVDSRSYRSTVDGIKKLYRIEGLAGFWRGLVPSL 186

Query: 176 TTITLTASIMFGTYETIRIYCDENEKTTAAHKKWELATLNH-SAGTIGGVIAKIITFPLE 234
             ++   +I F  Y+T++ +    +      KK +L+ L + +  ++  +++    +PL+
Sbjct: 187 FGVS-QGAIYFTVYDTLKYHYFAAKH---VDKKKKLSNLEYITITSLSKMVSVTAVYPLQ 242

Query: 235 TIRRRMQFMNSKHLEKFSRHSSVYGSYKGYGFARIGLQILKQEGVSSLYRGILVALSKTI 294
            ++  +Q             S+V      +   ++   I  ++GV+ LY+G+L  L + +
Sbjct: 243 LLKSNLQSFEV---------STVINPKTSHRVWKLITTIYVRDGVTGLYKGLLANLIRAV 293

Query: 295 PTTFVSFWGYETAIH 309
           P+T ++F  YE   H
Sbjct: 294 PSTCITFCVYENFRH 308

 Score = 57.8 bits (138), Expect = 2e-09,   Method: Compositional matrix adjust.
 Identities = 47/202 (23%), Positives = 96/202 (47%), Gaps = 16/202 (7%)

Query: 5   EDSLRKGQNVAAWKTLLAGAVSGLLARSITAPMDTIKIRLQLTPANGLKPFGSQVMEVAR 64
            +++   + + +   LLA A+SG+    +T P+  IK R+  T     + + S V  + +
Sbjct: 109 NNTMNNDKEMTSLMYLLAAAMSGVATSVLTNPIWVIKTRIMSTSFVDSRSYRSTVDGI-K 167

Query: 65  SMIKNEGIRSFWKGNIPGSLLYVTYGSAQFSSY-SLFNRYLTPFGLEAR-----LHSLVV 118
            + + EG+  FW+G +P SL  V+ G+  F+ Y +L   Y     ++ +     L  + +
Sbjct: 168 KLYRIEGLAGFWRGLVP-SLFGVSQGAIYFTVYDTLKYHYFAAKHVDKKKKLSNLEYITI 226

Query: 119 GAFAGITSSIVSYPFDVLRTRLVANNQMHSMSITREVRDIWKL-------EGLPGFFKGS 171
            + + + S    YP  +L++ L  + ++ ++   +    +WKL       +G+ G +KG 
Sbjct: 227 TSLSKMVSVTAVYPLQLLKSNL-QSFEVSTVINPKTSHRVWKLITTIYVRDGVTGLYKGL 285

Query: 172 IASMTTITLTASIMFGTYETIR 193
           +A++     +  I F  YE  R
Sbjct: 286 LANLIRAVPSTCITFCVYENFR 307

>AGL311C [4001] [Homologous to ScYJR095W (SFC1) - SH]
           (119645..120733) [1089 bp, 362 aa]
          Length = 362

 Score = 80.1 bits (196), Expect = 7e-17,   Method: Compositional matrix adjust.
 Identities = 82/314 (26%), Positives = 144/314 (45%), Gaps = 39/314 (12%)

Query: 7   SLRKGQNVAAWKTLLAGAVSGLLARSITAPMDTIKIRLQL--TPANGLKPFGSQVMEVAR 64
           S +K  N A    L+AG  +GL       P+DTIK+R+Q+      G KP G   +    
Sbjct: 50  SSKKSTNPAV--NLVAGGTAGLFEALCCHPLDTIKVRMQIYRRANEGTKPPG--FLRTGA 105

Query: 65  SMIKNEGIRSFWKGNIPGSLLYVTYGSAQFSSYSLFNRYLTP--FGLEARLHSLVVGAFA 122
           ++   EG+ +F+KG     +  +   + +FSSY  +   L     G+ +  ++ + G  A
Sbjct: 106 NIYSGEGLLAFYKGLGAVVIGIIPKMAIRFSSYEFYRTLLADRQTGVVSTGNTFLAGVGA 165

Query: 123 GITSSI-VSYPFDVLRTRLVANNQMHSMSITREVRD-------IWKLEGLPGFFKGSIAS 174
           G+T ++ V  P +V++ RL A + +H  +  ++ R+       I K EG+   ++G    
Sbjct: 166 GVTEAVLVVNPMEVVKIRLQAQH-LHGAAEQQKYRNAIQAAYLIVKEEGIGALYRG---- 220

Query: 175 MTTITLTASIMFGTY-ETIRIYCDENEKTTAAHKKWELATLNHS-AGTIGGVIAKIITFP 232
              ++LTA+           +Y    E+    H    L +   S  G + G I      P
Sbjct: 221 ---VSLTAARQATNQGANFTVYSKLMERLQEYHGSQNLPSWETSLIGLVSGAIGPFSNAP 277

Query: 233 LETIRRRMQFMNS-KHLEKFSRHSSVYGSYKGYGFARIGLQILKQEGVSSLYRGILVALS 291
           L+TI+ R+Q   S ++L  + R ++            IG Q++++EG  +LY+GI   + 
Sbjct: 278 LDTIKTRLQKDKSTRNLSNWVRITT------------IGRQLVQEEGFRALYKGITPRVM 325

Query: 292 KTIPTTFVSFWGYE 305
           +  P   V+F  YE
Sbjct: 326 RVAPGQAVTFTVYE 339

 Score = 56.2 bits (134), Expect = 9e-09,   Method: Compositional matrix adjust.
 Identities = 31/98 (31%), Positives = 49/98 (50%)

Query: 12  QNVAAWKTLLAGAVSGLLARSITAPMDTIKIRLQLTPANGLKPFGSQVMEVARSMIKNEG 71
           QN+ +W+T L G VSG +     AP+DTIK RLQ   +        ++  + R +++ EG
Sbjct: 253 QNLPSWETSLIGLVSGAIGPFSNAPLDTIKTRLQKDKSTRNLSNWVRITTIGRQLVQEEG 312

Query: 72  IRSFWKGNIPGSLLYVTYGSAQFSSYSLFNRYLTPFGL 109
            R+ +KG  P  +      +  F+ Y    R+L   GL
Sbjct: 313 FRALYKGITPRVMRVAPGQAVTFTVYEFVRRHLEGLGL 350

 Score = 53.1 bits (126), Expect = 8e-08,   Method: Compositional matrix adjust.
 Identities = 48/194 (24%), Positives = 84/194 (43%), Gaps = 10/194 (5%)

Query: 14  VAAWKTLLAGAVSGLL-ARSITAPMDTIKIRLQLTPANGLKPFGS--QVMEVARSMIKNE 70
           V+   T LAG  +G+  A  +  PM+ +KIRLQ    +G          ++ A  ++K E
Sbjct: 153 VSTGNTFLAGVGAGVTEAVLVVNPMEVVKIRLQAQHLHGAAEQQKYRNAIQAAYLIVKEE 212

Query: 71  GIRSFWKGNIPGSLLYVTYGSAQFSSYSLFNRYLTPFGLEARLHS---LVVGAFAGITSS 127
           GI + ++G    +    T   A F+ YS     L  +     L S    ++G  +G    
Sbjct: 213 GIGALYRGVSLTAARQATNQGANFTVYSKLMERLQEYHGSQNLPSWETSLIGLVSGAIGP 272

Query: 128 IVSYPFDVLRTRLVANNQMHSMS----ITREVRDIWKLEGLPGFFKGSIASMTTITLTAS 183
             + P D ++TRL  +    ++S    IT   R + + EG    +KG    +  +    +
Sbjct: 273 FSNAPLDTIKTRLQKDKSTRNLSNWVRITTIGRQLVQEEGFRALYKGITPRVMRVAPGQA 332

Query: 184 IMFGTYETIRIYCD 197
           + F  YE +R + +
Sbjct: 333 VTFTVYEFVRRHLE 346

>Kwal_26.8669
          Length = 296

 Score = 79.0 bits (193), Expect = 1e-16,   Method: Compositional matrix adjust.
 Identities = 70/278 (25%), Positives = 126/278 (45%), Gaps = 22/278 (7%)

Query: 22  AGAVSGLLARSITAPMDTIKIRLQLTPANGLKPFGSQVMEVARSMIKNEGIRSFWKGNIP 81
           AGAV+G+    +  P+D +K R+QL  + GL P    V++  + ++  EG    +KG   
Sbjct: 15  AGAVAGISEILVMYPLDVVKTRMQLQVSGGLGPQYKGVVDCIKQIVAKEGASRLYKGISS 74

Query: 82  GSLLYVTYGSAQFSSYSLFNR-YLTPFGLEARLHSLVV--GAFAGITSSIVSYPFDVLRT 138
             L+     + +F+    F + Y   FG+E    SL +  GA AG   + V  PF++++ 
Sbjct: 75  PVLMEAPKRATKFACNDEFQKIYKREFGVEKLTQSLSILSGASAGCCEAFVVVPFELVKI 134

Query: 139 RLVANNQMHSMSITREVRDIWKLEGLPGFFKGSIASMTTITLTASIMFGTYETIRIYCDE 198
           RL   +  +   I   VR I   EG+   + G  +++    +  +  FG    +R    E
Sbjct: 135 RLQDVSSSYKGPID-VVRKIIAQEGVLAMYNGLESTLWRHGVWNAGYFGIIFQVRALLPE 193

Query: 199 NEKTTAAHKKWELATLNHSAGTIGGVIAKIITFPLETIRRRMQFMNSKHLEKFSRHSSVY 258
                 A  K +    +  AG+IGG I  +++ P + ++ R+Q             + V 
Sbjct: 194 ------AKSKSQQTRNDLIAGSIGGTIGSLMSTPFDVVKSRIQ-----------NTAVVA 236

Query: 259 GSYKGYGFARIGL-QILKQEGVSSLYRGILVALSKTIP 295
           G  + Y ++   +  I K+EG  +LY+G +  + +  P
Sbjct: 237 GGARKYNWSWPSIFTIYKEEGFRALYKGFVPKVLRLGP 274

 Score = 45.8 bits (107), Expect = 2e-05,   Method: Compositional matrix adjust.
 Identities = 44/179 (24%), Positives = 79/179 (44%), Gaps = 20/179 (11%)

Query: 19  TLLAGAVSGLLARSITAPMDTIKIRLQLTPANGLKPFGSQVMEVARSMIKNEGIRSFWKG 78
           ++L+GA +G     +  P + +KIRLQ   ++   P     ++V R +I  EG+ + + G
Sbjct: 111 SILSGASAGCCEAFVVVPFELVKIRLQDVSSSYKGP-----IDVVRKIIAQEGVLAMYNG 165

Query: 79  NIPGSLLYVTYGSAQFSSYSLFNRYLTPFGLEARLHS------LVVGAFAGITSSIVSYP 132
            +  +L      +A +       R L P   EA+  S      L+ G+  G   S++S P
Sbjct: 166 -LESTLWRHGVWNAGYFGIIFQVRALLP---EAKSKSQQTRNDLIAGSIGGTIGSLMSTP 221

Query: 133 FDVLRTRL-----VANNQMHSMSITREVRDIWKLEGLPGFFKGSIASMTTITLTASIMF 186
           FDV+++R+     VA            +  I+K EG    +KG +  +  +     I+ 
Sbjct: 222 FDVVKSRIQNTAVVAGGARKYNWSWPSIFTIYKEEGFRALYKGFVPKVLRLGPGGGILL 280

 Score = 40.8 bits (94), Expect = 8e-04,   Method: Compositional matrix adjust.
 Identities = 45/181 (24%), Positives = 73/181 (40%), Gaps = 31/181 (17%)

Query: 113 LHSLVVGAFAGITSSIVSYPFDVLRTRLVANNQ----MHSMSITREVRDIWKLEGLPGFF 168
            +    GA AGI+  +V YP DV++TR+              +   ++ I   EG    +
Sbjct: 10  FYQFAAGAVAGISEILVMYPLDVVKTRMQLQVSGGLGPQYKGVVDCIKQIVAKEGASRLY 69

Query: 169 KGSIASMTTITLTASIMFGTYETIRIYC-DENEKTTAAHKKWELATLNHS--AGTIGGVI 225
           KG I+S         +M       +  C DE +K        E  T + S  +G   G  
Sbjct: 70  KG-ISSPV-------LMEAPKRATKFACNDEFQKIYKREFGVEKLTQSLSILSGASAGCC 121

Query: 226 AKIITFPLETIRRRMQFMNSKHLEKFSRHSSVYGSYKGYGFARIGLQILKQEGVSSLYRG 285
              +  P E ++ R+Q ++S              SYKG     +  +I+ QEGV ++Y G
Sbjct: 122 EAFVVVPFELVKIRLQDVSS--------------SYKGP--IDVVRKIIAQEGVLAMYNG 165

Query: 286 I 286
           +
Sbjct: 166 L 166

 Score = 33.9 bits (76), Expect = 0.12,   Method: Compositional matrix adjust.
 Identities = 25/86 (29%), Positives = 41/86 (47%), Gaps = 12/86 (13%)

Query: 20  LLAGAVSGLLARSITAPMDTIKIRLQLTP--ANGLKPFGSQVMEVARSMIKNEGIRSFWK 77
           L+AG++ G +   ++ P D +K R+Q T   A G + +      +  ++ K EG R+ +K
Sbjct: 205 LIAGSIGGTIGSLMSTPFDVVKSRIQNTAVVAGGARKYNWSWPSIF-TIYKEEGFRALYK 263

Query: 78  GNIP---------GSLLYVTYGSAQF 94
           G +P         G LL V  G   F
Sbjct: 264 GFVPKVLRLGPGGGILLVVFTGCMDF 289

>YOR130C (ORT1) [4932] chr15 complement(569929..570807) Ornithine
           transport protein of mitochondria involved in arginine
           metabolism, member of the mitochondrial carrier family
           (MCF) of membrane transporters [879 bp, 292 aa]
          Length = 292

 Score = 78.6 bits (192), Expect = 1e-16,   Method: Compositional matrix adjust.
 Identities = 82/324 (25%), Positives = 139/324 (42%), Gaps = 59/324 (18%)

Query: 5   EDSLRKGQNVAAWKTLLAGAVSGLLARSITAPMDTIKIRLQLTPANGLKPFGSQVMEVAR 64
           EDS +KG    A   ++ G+++G   + I  P DT+K+RLQ   +N        V     
Sbjct: 2   EDSKKKGLIEGAILDIINGSIAGACGKVIEFPFDTVKVRLQTQASN--------VFPTTW 53

Query: 65  SMIK----NEGI-RSFWKGNIPGSLLYVTYGSAQ-FSSYSLFNRYLT------PFGLEAR 112
           S IK    NEGI R F++G I   L+     +A  F SY+  +++L       P G    
Sbjct: 54  SCIKFTYQNEGIARGFFQG-IASPLVGACLENATLFVSYNQCSKFLEKHTNVFPLG---- 108

Query: 113 LHSLVVGAFAGITSSIVSYPFDVLRTRL-VANNQMHSM-----SITREVRDIWKLEGLPG 166
              L+ G  AG  +S+V  P ++++ +L VAN Q+ S       +   ++ I    GL G
Sbjct: 109 -QILISGGVAGSCASLVLTPVELVKCKLQVANLQVASAKTKHTKVLPTIKAIITERGLAG 167

Query: 167 FFKGSIASMTTITLTASIMFGTYETIRIYCDE----NEKTTAAHKKWELATLNHSAGTIG 222
            ++G   +    +      F TYE ++    +    ++      K WEL     SA    
Sbjct: 168 LWQGQSGTFIRESFGGVAWFATYEIVKKSLKDRHSLDDPKRDESKIWELLISGGSA---- 223

Query: 223 GVIAKIITFPLETIRRRMQFMNSKHLEKFSRHSSVYGSYKGYGFARIGLQILKQEGVSSL 282
           G+      FP +T++  MQ   ++H+   +    ++G +                G+   
Sbjct: 224 GLAFNASIFPADTVKSVMQ---TEHISLTNAVKKIFGKF----------------GLKGF 264

Query: 283 YRGILVALSKTIPTTFVSFWGYET 306
           YRG+ + L + +P     F+ +ET
Sbjct: 265 YRGLGITLFRAVPANAAVFYIFET 288

 Score = 53.1 bits (126), Expect = 7e-08,   Method: Compositional matrix adjust.
 Identities = 42/186 (22%), Positives = 92/186 (49%), Gaps = 16/186 (8%)

Query: 18  KTLLAGAVSGLLARSITAPMDTIKIRLQLT--PANGLKPFGSQVMEVARSMIKNEGIRSF 75
           + L++G V+G  A  +  P++ +K +LQ+        K   ++V+   +++I   G+   
Sbjct: 109 QILISGGVAGSCASLVLTPVELVKCKLQVANLQVASAKTKHTKVLPTIKAIITERGLAGL 168

Query: 76  WKGNIPGSLLYVTYGS-AQFSSYSLFNRYL-------TPFGLEARLHSLVV-GAFAGITS 126
           W+G   G+ +  ++G  A F++Y +  + L        P   E+++  L++ G  AG+  
Sbjct: 169 WQGQ-SGTFIRESFGGVAWFATYEIVKKSLKDRHSLDDPKRDESKIWELLISGGSAGLAF 227

Query: 127 SIVSYPFDVLRTRLVANNQMHSMSITREVRDIWKLEGLPGFFKGSIASMTTITLTASIMF 186
           +   +P D +++ +    Q   +S+T  V+ I+   GL GF++G   ++       + +F
Sbjct: 228 NASIFPADTVKSVM----QTEHISLTNAVKKIFGKFGLKGFYRGLGITLFRAVPANAAVF 283

Query: 187 GTYETI 192
             +ET+
Sbjct: 284 YIFETL 289

>AER419W [2919] [Homologous to ScYNL083W - SH]
           complement(1442595..1444076) [1482 bp, 493 aa]
          Length = 493

 Score = 79.3 bits (194), Expect = 2e-16,   Method: Compositional matrix adjust.
 Identities = 56/190 (29%), Positives = 96/190 (50%), Gaps = 15/190 (7%)

Query: 19  TLLAGAVSGLLARSITAPMDTIKIRLQLTPANGLKPFGSQVMEVARSMIKNEGIRSFWKG 78
           T +AG + G++A+    P+DT+K R+Q  P +        +++ A+ M +  G+R F++G
Sbjct: 298 TYVAGGLGGIMAQFSVYPIDTLKFRIQCAPLDTRCRGLPLLIKTAKDMYREGGLRLFYRG 357

Query: 79  NIPGSLLYVTYGSAQFSSYSLFNR-YLT----PFGL---EARLHSLVV---GAFAGITSS 127
              G L    Y +    ++S   R Y+T      G+   E  + +LVV   GAF+G   +
Sbjct: 358 LGVGILGVFPYAALDLGTFSALKRWYITRRANALGISENEVVMSNLVVLPMGAFSGTVGA 417

Query: 128 IVSYPFDVLRTRLVANN---QMHSMSITREV-RDIWKLEGLPGFFKGSIASMTTITLTAS 183
            V YP ++LRTRL A       H     ++V R   + EGLPG +KG + ++  +    +
Sbjct: 418 TVVYPINLLRTRLQAQGTYAHPHRYDGFQDVFRKTVQREGLPGLYKGLVPTLAKVCPAVA 477

Query: 184 IMFGTYETIR 193
           I +  YE ++
Sbjct: 478 ISYLCYENLK 487

 Score = 77.4 bits (189), Expect = 1e-15,   Method: Compositional matrix adjust.
 Identities = 68/313 (21%), Positives = 132/313 (42%), Gaps = 48/313 (15%)

Query: 28  LLARSITAPMDTIKIRL---------------QL---TPANGLKPFGSQVMEVARSMIKN 69
           +++R+ TAP D IK+ L               QL    P        S +++ A S+ + 
Sbjct: 187 VVSRTCTAPFDRIKVFLIARTDLSSPLLHTPEQLLHHNPRADPAKIRSPLVKAATSLYRQ 246

Query: 70  EGIRSFWKGNIPGSLLYVTYGSAQFSSYSLFNRYLTPFGLE--------ARLHSLVVGAF 121
            G+R+F+ GN    +      + +F S+ L  R L   GLE        +RL + V G  
Sbjct: 247 GGLRAFYLGNGLNVIKVFPESAMKFGSFELAKRVLA--GLEGCGETGELSRLSTYVAGGL 304

Query: 122 AGITSSIVSYPFDVLRTRLVA---NNQMHSMSI-TREVRDIWKLEGLPGFFKGSIASMTT 177
            GI +    YP D L+ R+     + +   + +  +  +D+++  GL  F++G    +  
Sbjct: 305 GGIMAQFSVYPIDTLKFRIQCAPLDTRCRGLPLLIKTAKDMYREGGLRLFYRGLGVGILG 364

Query: 178 ITLTASIMFGTYETIRIYCDENEKTTAAHKKWELATLNH---SAGTIGGVIAKIITFPLE 234
           +   A++  GT+  ++ +            + E+   N      G   G +   + +P+ 
Sbjct: 365 VFPYAALDLGTFSALKRWYITRRANALGISENEVVMSNLVVLPMGAFSGTVGATVVYPIN 424

Query: 235 TIRRRMQFMNS-KHLEKFSRHSSVYGSYKGYGFARIGLQILKQEGVSSLYRGILVALSKT 293
            +R R+Q   +  H  ++             GF  +  + +++EG+  LY+G++  L+K 
Sbjct: 425 LLRTRLQAQGTYAHPHRYD------------GFQDVFRKTVQREGLPGLYKGLVPTLAKV 472

Query: 294 IPTTFVSFWGYET 306
            P   +S+  YE 
Sbjct: 473 CPAVAISYLCYEN 485

>Kwal_33.14050
          Length = 314

 Score = 78.2 bits (191), Expect = 3e-16,   Method: Compositional matrix adjust.
 Identities = 80/322 (24%), Positives = 128/322 (39%), Gaps = 34/322 (10%)

Query: 1   MFKEEDSLRKGQNVAAWKTLLAGAVSGLLARSITAPMDTIKIRLQ-----LTPANGLKPF 55
           M +E D      N      L AGA +G++  SI  P+D IK R+Q     +  AN     
Sbjct: 1   MDEEIDYESLPTNAPLTHQLAAGAFAGIMEHSIMFPIDAIKTRMQALSATIGSANAAAKL 60

Query: 56  GSQVMEVARSMIKNEGIRSFWKGNIPGSLLYVTYGSAQFSSYSLFNRYL---TPFGLEAR 112
            S +++    +   EG  + WKG     L      +  F++Y +   YL     F     
Sbjct: 61  PSNIVQQIARISTTEGSMALWKGVQSVILGAGPAHAVYFATYEMCKSYLIDPQDFQTHQP 120

Query: 113 LHSLVVGAFAGITSSIVSYPFDVLRTRLVANNQMHSMSITRE---VRDIWKLEGLPGFFK 169
           L +   G  A + + ++  PFD ++ R+    Q+ + S  R       I++ EGL  FF 
Sbjct: 121 LKTAASGIAATVAADLLMNPFDTIKQRM----QLRTFSKDRMWSVASRIYRNEGLAAFFY 176

Query: 170 GSIASMTTITLTASIMFGTYET-IRIYCDENEKTTAAHKKWELATLNHSAGTIGGVIAKI 228
               ++      A+  F  YE+  + +  EN      H            G I G     
Sbjct: 177 SYPTTIAMNIPFAAFNFAIYESATKFFNPENTYNPLIHCL---------CGGISGATCAA 227

Query: 229 ITFPLETIRRRMQFMNSKH-LEKFSRHSSVYGSYKGYGFARIGLQILKQEGVSSLYRGIL 287
           IT PL+ I+  +Q   S+  ++   R +          F+R    I K  G S  +RG+ 
Sbjct: 228 ITTPLDCIKTVLQVRGSESVVDPLFRQADT--------FSRAASAISKVYGWSGFWRGLK 279

Query: 288 VALSKTIPTTFVSFWGYETAIH 309
             +   +P T +S+  YE A H
Sbjct: 280 PRIISNMPATAISWTAYECAKH 301

>CAGL0M09020g complement(896312..897358) highly similar to sp|P33303
           Saccharomyces cerevisiae YJR095w succinate-fumarate
           transporter, start by similarity
          Length = 348

 Score = 78.6 bits (192), Expect = 3e-16,   Method: Compositional matrix adjust.
 Identities = 80/327 (24%), Positives = 131/327 (40%), Gaps = 57/327 (17%)

Query: 20  LLAGAVSGLLARSITAPMDTIKIRLQL------------------------------TPA 49
           L+AG  +GL       P+DTIK+R+Q+                                 
Sbjct: 15  LVAGGTAGLFEALCCHPLDTIKVRMQIYKRQAAPAAAAVASMAGGAGGAATATVGGGDAT 74

Query: 50  NGLKPFGSQVMEVARSMIKNEGIRSFWKGNIPGSLLYVTYGSAQFSSYSLFNRYLTP--F 107
             +KP G   +   R++   EG  + +KG     +  +   + +FSSY  +   L     
Sbjct: 75  AAIKPPG--FIRTGRNIYAQEGFLALYKGLGAVVIGIIPKMAIRFSSYEFYRTLLADKQT 132

Query: 108 GLEARLHSLVVGAFAGITSSI-VSYPFDVLRTRLVA-----NNQMHSMSITREVR---DI 158
           G+ +  ++ + G  AG+T ++ V  P +V++ RL A     N+ +     T  V+    I
Sbjct: 133 GVVSTSNTFIAGVGAGVTEAVLVVNPMEVVKIRLQAQHLNPNHDLAKPKYTNAVQAGYTI 192

Query: 159 WKLEGLPGFFKGSIASMTTITLTASIMFGTYETIRIYCDENEKTTAAHKKWELATLNHSA 218
            K EG+   ++G   +           F  Y  +R +  E   T      WE + +    
Sbjct: 193 IKEEGISALYRGVSLTAARQATNQGANFTVYSKLREFLQEYHGTETL-PSWETSCI---- 247

Query: 219 GTIGGVIAKIITFPLETIRRRMQFMNSKHLEKFSRHSSVYGSYKGYGFARIGLQILKQEG 278
           G I G I      PL+TI+ R+Q           + +S  G       A IG Q+LK+EG
Sbjct: 248 GLISGAIGPFSNAPLDTIKTRLQK---------DKSTSFKGESGWKRIAHIGTQLLKEEG 298

Query: 279 VSSLYRGILVALSKTIPTTFVSFWGYE 305
             +LY+GI   + +  P   V+F  YE
Sbjct: 299 FRALYKGITPRVMRVAPGQAVTFTVYE 325

 Score = 54.3 bits (129), Expect = 3e-08,   Method: Compositional matrix adjust.
 Identities = 49/198 (24%), Positives = 84/198 (42%), Gaps = 14/198 (7%)

Query: 14  VAAWKTLLAGAVSGLL-ARSITAPMDTIKIRLQ---LTPANGL-KPFGSQVMEVARSMIK 68
           V+   T +AG  +G+  A  +  PM+ +KIRLQ   L P + L KP  +  ++   ++IK
Sbjct: 135 VSTSNTFIAGVGAGVTEAVLVVNPMEVVKIRLQAQHLNPNHDLAKPKYTNAVQAGYTIIK 194

Query: 69  NEGIRSFWKGNIPGSLLYVTYGSAQFSSYSLFNRYLTPFGLEARLHSL---VVGAFAGIT 125
            EGI + ++G    +    T   A F+ YS    +L  +     L S     +G  +G  
Sbjct: 195 EEGISALYRGVSLTAARQATNQGANFTVYSKLREFLQEYHGTETLPSWETSCIGLISGAI 254

Query: 126 SSIVSYPFDVLRTRLVANNQMHSMS------ITREVRDIWKLEGLPGFFKGSIASMTTIT 179
               + P D ++TRL  +             I      + K EG    +KG    +  + 
Sbjct: 255 GPFSNAPLDTIKTRLQKDKSTSFKGESGWKRIAHIGTQLLKEEGFRALYKGITPRVMRVA 314

Query: 180 LTASIMFGTYETIRIYCD 197
              ++ F  YE +R + +
Sbjct: 315 PGQAVTFTVYEFVRRHLE 332

 Score = 49.3 bits (116), Expect = 1e-06,   Method: Compositional matrix adjust.
 Identities = 27/100 (27%), Positives = 47/100 (47%), Gaps = 2/100 (2%)

Query: 12  QNVAAWKTLLAGAVSGLLARSITAPMDTIKIRLQLTPANGLKPFG--SQVMEVARSMIKN 69
           + + +W+T   G +SG +     AP+DTIK RLQ   +   K      ++  +   ++K 
Sbjct: 237 ETLPSWETSCIGLISGAIGPFSNAPLDTIKTRLQKDKSTSFKGESGWKRIAHIGTQLLKE 296

Query: 70  EGIRSFWKGNIPGSLLYVTYGSAQFSSYSLFNRYLTPFGL 109
           EG R+ +KG  P  +      +  F+ Y    R+L   G+
Sbjct: 297 EGFRALYKGITPRVMRVAPGQAVTFTVYEFVRRHLENLGV 336

 Score = 38.1 bits (87), Expect = 0.006,   Method: Compositional matrix adjust.
 Identities = 28/109 (25%), Positives = 40/109 (36%), Gaps = 17/109 (15%)

Query: 214 LNHSAGTIGGVIAKIITFPLETIRRRMQFMNSK-----------------HLEKFSRHSS 256
           +N  AG   G+   +   PL+TI+ RMQ    +                           
Sbjct: 13  VNLVAGGTAGLFEALCCHPLDTIKVRMQIYKRQAAPAAAAVASMAGGAGGAATATVGGGD 72

Query: 257 VYGSYKGYGFARIGLQILKQEGVSSLYRGILVALSKTIPTTFVSFWGYE 305
              + K  GF R G  I  QEG  +LY+G+   +   IP   + F  YE
Sbjct: 73  ATAAIKPPGFIRTGRNIYAQEGFLALYKGLGAVVIGIIPKMAIRFSSYE 121

>CAGL0K11616g complement(1121834..1122796) highly similar to
           sp|P32332 Saccharomyces cerevisiae YKL120w, hypothetical
           start
          Length = 320

 Score = 77.4 bits (189), Expect = 5e-16,   Method: Compositional matrix adjust.
 Identities = 75/325 (23%), Positives = 143/325 (44%), Gaps = 50/325 (15%)

Query: 1   MFKEEDSLRK--GQNVAAWKTLLAGAVSGLLARSITAPMDTIKIRLQLT----PANG--- 51
           M K ED ++K   Q V+ + +  AG ++  +A ++T P++ +KIR+QL      AN    
Sbjct: 1   MAKGEDKIQKSAAQKVSKFGSFTAGGLAACIAVTVTNPIEVVKIRMQLQGELMAANQRIY 60

Query: 52  LKPFGSQVMEVARSMIKNEGIRSFWKGNIPGSLLYVTYGSAQFSSY----SLFNRYLTPF 107
             PF  Q M V   + +NEGIR   KG +   +  +    ++   Y    ++ N+   P 
Sbjct: 61  TNPF--QAMGV---VFRNEGIRGLQKGLVAAYIYQIALNGSRLGFYEPIRAVMNKTFYPD 115

Query: 108 GLEARLHSLVVGAFAGITSSIVSY----PFDVLRTRLVA-------NNQMHSMSITREVR 156
               ++ S+ +  FAG  S I+      P  +++TRL +         Q H   +   ++
Sbjct: 116 QESHKVQSVGINVFAGAASGIIGAVMGSPLFLVKTRLQSYSNAIKIGEQTHYTGVWNGLK 175

Query: 157 DIWKLEGLPGFFKGSIASMTTITLTASIMFGTYETIRIYCDENEKTTAAHKKWELATLNH 216
            I+  EG+ G F+G  A++      +S+    Y T + +   N+            +L+ 
Sbjct: 176 TIYMTEGVKGLFRGIDAAILRTGAGSSVQLPIYNTAKNFLLRNDIMEDG------PSLHL 229

Query: 217 SAGTIGGVIAKIITFPLETIRRRMQFMNSKHLEKFSRHSSVYGSYKGYGFARIGLQILKQ 276
           +A TI G+   ++  P + I  R+          +++   +Y      G     ++ +K 
Sbjct: 230 TASTISGLGVAVVMNPWDVILTRI----------YNQKGDLY-----KGPIDCLVKTVKI 274

Query: 277 EGVSSLYRGILVALSKTIPTTFVSF 301
           EG+++LY+G    + +  P T +  
Sbjct: 275 EGITALYKGFEAQVFRIGPHTILCL 299

 Score = 54.3 bits (129), Expect = 3e-08,   Method: Compositional matrix adjust.
 Identities = 52/205 (25%), Positives = 92/205 (44%), Gaps = 18/205 (8%)

Query: 111 ARLHSLVVGAFAGITSSIVSYPFDVLRTR------LVANNQMHSMSITREVRDIWKLEGL 164
           ++  S   G  A   +  V+ P +V++ R      L+A NQ    +  + +  +++ EG+
Sbjct: 17  SKFGSFTAGGLAACIAVTVTNPIEVVKIRMQLQGELMAANQRIYTNPFQAMGVVFRNEGI 76

Query: 165 PGFFKGSIAS-MTTITLTASIMFGTYETIRIYCDENEKTTAAHKKWELATLNHSAGTIGG 223
            G  KG +A+ +  I L  S   G YE IR   ++         K +   +N  AG   G
Sbjct: 77  RGLQKGLVAAYIYQIALNGS-RLGFYEPIRAVMNKTFYPDQESHKVQSVGINVFAGAASG 135

Query: 224 VIAKIITFPLETIRRRMQ-FMNSKHLEKFSRHSSVYGSYKGYGFARIGLQILKQEGVSSL 282
           +I  ++  PL  ++ R+Q + N+  + + + ++ V+   K          I   EGV  L
Sbjct: 136 IIGAVMGSPLFLVKTRLQSYSNAIKIGEQTHYTGVWNGLK---------TIYMTEGVKGL 186

Query: 283 YRGILVALSKTIPTTFVSFWGYETA 307
           +RGI  A+ +T   + V    Y TA
Sbjct: 187 FRGIDAAILRTGAGSSVQLPIYNTA 211

>YOR100C (CRC1) [4905] chr15 complement(513295..514278)
           Mitochondrial carnitine carrier, member of the
           mitochondrial carrier family (MCF) of membrane
           transporters [984 bp, 327 aa]
          Length = 327

 Score = 77.4 bits (189), Expect = 5e-16,   Method: Compositional matrix adjust.
 Identities = 69/299 (23%), Positives = 133/299 (44%), Gaps = 30/299 (10%)

Query: 18  KTLLAGAVSGLLARSITAPMDTIKIRLQLTPANGLKPFGSQVMEVARSMIKN----EGIR 73
           K+ +AG V G+ A     P D IK+R Q   AN      + +++ A++ +K       ++
Sbjct: 37  KSFVAGGVGGVCAVFTGHPFDLIKVRCQNGQANSTVHAITNIIKEAKTQVKGTLFTNSVK 96

Query: 74  SFWKGNIPGSLLYVTYGSAQFSSYSLFNRYLTPFGLEARLHSLVVGAFA------GITSS 127
            F+KG IP  L      +  F  Y +  + +T    +   + L +G  A       I ++
Sbjct: 97  GFYKGVIPPLLGVTPIFAVSFWGYDVGKKLVTFNNKQGGSNELTMGQMAAAGFISAIPTT 156

Query: 128 IVSYPFDVLRTRLVANNQMHSMSITREVRDIWKLEGLPGFFKGSIASMTTITLTASIMFG 187
           +V+ P + ++  L  +++    S  +  + I K  G+   FKGS+A++      +++ F 
Sbjct: 157 LVTAPTERVKVVLQTSSK---GSFIQAAKTIVKEGGIASLFKGSLATLARDGPGSALYFA 213

Query: 188 TYETIRIYCDENEKTTAAHKKWELATLNHS-AGTIGGVIAKIITFPLETIRRRMQFMNSK 246
           +YE  + Y +  +    A K   +  LN   AG I G+   +  FP++TI+ ++Q  +++
Sbjct: 214 SYEISKNYLNSRQPRQDAGKDEPVNILNVCLAGGIAGMSMWLAVFPIDTIKTKLQASSTR 273

Query: 247 HLEKFSRHSSVYGSYKGYGFARIGLQILKQEGVSSLYRGILVALSKTIPTTFVSFWGYE 305
                S    +Y               L++ G+   + G+  AL ++ P    +F G E
Sbjct: 274 Q-NMLSATKEIY---------------LQRGGIKGFFPGLGPALLRSFPANAATFLGVE 316

 Score = 30.0 bits (66), Expect = 2.5,   Method: Compositional matrix adjust.
 Identities = 25/99 (25%), Positives = 44/99 (44%), Gaps = 11/99 (11%)

Query: 10  KGQNVAAWKTLLAGAVSGLLARSITAPMDTIKIRLQLTPANGLKPFGSQVMEVARSM-IK 68
           K + V      LAG ++G+       P+DTIK +LQ +           ++   + + ++
Sbjct: 233 KDEPVNILNVCLAGGIAGMSMWLAVFPIDTIKTKLQASSTR------QNMLSATKEIYLQ 286

Query: 69  NEGIRSFWKGNIPGSLLYVTYGSAQF----SSYSLFNRY 103
             GI+ F+ G  P  L      +A F     ++SLF +Y
Sbjct: 287 RGGIKGFFPGLGPALLRSFPANAATFLGVEMTHSLFKKY 325

>CAGL0G08910g complement(853693..854562) similar to sp|P40464
           Saccharomyces cerevisiae YIL134w FLX1, hypothetical
           start
          Length = 289

 Score = 76.3 bits (186), Expect = 1e-15,   Method: Compositional matrix adjust.
 Identities = 52/194 (26%), Positives = 96/194 (49%), Gaps = 17/194 (8%)

Query: 8   LRKGQNVAAWKTLLAGAVSGLLARSITAPMDTIKIRLQLTPANGLKPFGSQVMEVARSMI 67
           +R  +++++W  L A A SG+L   +T P+  IK R+     + L       M+V R +I
Sbjct: 102 IRNDKDLSSWMYLSASASSGMLTTVLTNPLWVIKTRMMSKANSDLTS-----MKVLRDLI 156

Query: 68  KNEGIRSFWKGNIPGSLLYVTYGSAQFSSYSLFNRYLTPFGLEA----RLHSLVVGAFAG 123
           KN+G++  WKG +P +L+ V+ G+  F+ Y      L     ++     L ++ V + + 
Sbjct: 157 KNDGVQGLWKGLVP-ALVGVSQGALHFTCYDTLKHKLVLKNRDSDEITNLETIAVTSVSK 215

Query: 124 ITSSIVSYPFDVLRTRL----VANNQMHSMSITREVRDIWKLEGLPGFFKGSIASMTTIT 179
           + S+   YPF +L++ L     + N    + +++    I+   GL GF+KG  A++    
Sbjct: 216 MLSTSAVYPFQLLKSNLQSFQASENDFKLLPLSKM---IYSRSGLLGFYKGLSANLLRSV 272

Query: 180 LTASIMFGTYETIR 193
            +  I F  YE  +
Sbjct: 273 PSTCITFCIYENFK 286

 Score = 63.9 bits (154), Expect = 2e-11,   Method: Compositional matrix adjust.
 Identities = 67/305 (21%), Positives = 141/305 (46%), Gaps = 48/305 (15%)

Query: 18  KTLLAGAVSGLLARSITAPMDTIKIRLQL----TPANGLKPFGSQVMEVARSMIKNEGIR 73
           K +++G  +G +   I  P+D  K+RLQL    T   G +   S+++    S+      R
Sbjct: 10  KEVISGLTAGSVTTLIVHPLDLFKVRLQLLITSTTKKGYRNLWSEIVGSDLSLT-----R 64

Query: 74  SFWKG---NIPGSLLYVTYGSAQFSSYSLFNRYLTPFGLEAR----LHS---LVVGAFAG 123
             ++G   N+ G+   + +G   F+SY +   YL  +    R    L S   L   A +G
Sbjct: 65  ELYRGLTVNLVGNT--IAWG-LYFASYRVAKDYLINYNHRIRNDKDLSSWMYLSASASSG 121

Query: 124 ITSSIVSYPFDVLRTRLV--ANNQMHSMSITREVRDIWKLEGLPGFFKGSIASMTTITLT 181
           + +++++ P  V++TR++  AN+ + SM +   +RD+ K +G+ G +KG + ++  ++  
Sbjct: 122 MLTTVLTNPLWVIKTRMMSKANSDLTSMKV---LRDLIKNDGVQGLWKGLVPALVGVS-Q 177

Query: 182 ASIMFGTYETIRIYCDENEKTTAAHKKWELATLNHSAGT-IGGVIAKIITFPLETIRRRM 240
            ++ F  Y+T++     ++         E+  L   A T +  +++    +P + ++  +
Sbjct: 178 GALHFTCYDTLK-----HKLVLKNRDSDEITNLETIAVTSVSKMLSTSAVYPFQLLKSNL 232

Query: 241 QFMNSKHLEKFSRHSSVYGSYKGYGFARIGLQILKQEGVSSLYRGILVALSKTIPTTFVS 300
           Q              S   S   +    +   I  + G+   Y+G+   L +++P+T ++
Sbjct: 233 Q--------------SFQASENDFKLLPLSKMIYSRSGLLGFYKGLSANLLRSVPSTCIT 278

Query: 301 FWGYE 305
           F  YE
Sbjct: 279 FCIYE 283

>Scas_691.4
          Length = 334

 Score = 76.6 bits (187), Expect = 1e-15,   Method: Compositional matrix adjust.
 Identities = 79/313 (25%), Positives = 133/313 (42%), Gaps = 47/313 (15%)

Query: 20  LLAGAVSGLLARSITAPMDTIKIRLQLTP-ANGLKPFGSQVMEVARSMIKNEGIRSFWKG 78
           L+AG  +GL       P+DTIK+R+Q+     G++P G   +   R++  +EG  + +KG
Sbjct: 17  LVAGGTAGLFEALCCHPLDTIKVRMQIAKRTEGMRPHG--FITTGRNIYSHEGFLALYKG 74

Query: 79  NIPGSLLYVTYGSAQFSSYSLFNRYLTPFGLEARL----HSLVVGAFAGITSSI-VSYPF 133
                +  +   + +FSSY  +   LT    E R     ++ + G  AGIT ++ V  P 
Sbjct: 75  LGAVVIGIIPKMAIRFSSYEFYRNALT--DKETRTITTGNTFLAGVGAGITEAVLVVNPM 132

Query: 134 DVLRTRLVAN--NQM-----------HSMSITRE--------VRDIWKLEGLPGFFKGSI 172
           +V++ RL A   N +            + ++T+            I K EG    ++G  
Sbjct: 133 EVVKIRLQAQHLNDLIPQPAGVSAAGTAATVTKPKYANAIHAAYTIVKEEGAGALYRGVS 192

Query: 173 ASMTTITLTASIMFGTYETIRIYCDENEKTTAAHKKWELATLNHSAGTIGGVIAKIITFP 232
            +           F  Y  ++ Y  +     +    WE + +    G I G I      P
Sbjct: 193 LTAARQATNQGANFTVYSYLKDYLQKYHNRESL-PSWETSCI----GLISGAIGPFSNAP 247

Query: 233 LETIRRRMQFMNSKHLEKFSRHSSVYGSYKGYGFARIGLQILKQEGVSSLYRGILVALSK 292
           L+TI+ R+Q    K +   S    +Y          IG Q++K+EG  +LY+GI   + +
Sbjct: 248 LDTIKTRLQ--KDKSISSNSAWKKIY---------IIGTQLIKEEGFRALYKGITPRVMR 296

Query: 293 TIPTTFVSFWGYE 305
             P   V+F  YE
Sbjct: 297 VAPGQAVTFTVYE 309

 Score = 57.0 bits (136), Expect = 5e-09,   Method: Compositional matrix adjust.
 Identities = 49/214 (22%), Positives = 88/214 (41%), Gaps = 25/214 (11%)

Query: 9   RKGQNVAAWKTLLAGAVSGLL-ARSITAPMDTIKIRLQLTPANGL--------------- 52
           ++ + +    T LAG  +G+  A  +  PM+ +KIRLQ    N L               
Sbjct: 103 KETRTITTGNTFLAGVGAGITEAVLVVNPMEVVKIRLQAQHLNDLIPQPAGVSAAGTAAT 162

Query: 53  --KPFGSQVMEVARSMIKNEGIRSFWKGNIPGSLLYVTYGSAQFSSYSLFNRYLTPFGLE 110
             KP  +  +  A +++K EG  + ++G    +    T   A F+ YS    YL  +   
Sbjct: 163 VTKPKYANAIHAAYTIVKEEGAGALYRGVSLTAARQATNQGANFTVYSYLKDYLQKYHNR 222

Query: 111 ARLHS---LVVGAFAGITSSIVSYPFDVLRTRLVANNQMHSMSITREV----RDIWKLEG 163
             L S     +G  +G      + P D ++TRL  +  + S S  +++      + K EG
Sbjct: 223 ESLPSWETSCIGLISGAIGPFSNAPLDTIKTRLQKDKSISSNSAWKKIYIIGTQLIKEEG 282

Query: 164 LPGFFKGSIASMTTITLTASIMFGTYETIRIYCD 197
               +KG    +  +    ++ F  YE +R + +
Sbjct: 283 FRALYKGITPRVMRVAPGQAVTFTVYEFVRKHLE 316

 Score = 48.1 bits (113), Expect = 4e-06,   Method: Compositional matrix adjust.
 Identities = 47/185 (25%), Positives = 77/185 (41%), Gaps = 18/185 (9%)

Query: 113 LHSLVVGAFAGITSSIVSYPFDVLRTRLVANNQMHSM---SITREVRDIWKLEGLPGFFK 169
           L +LV G  AG+  ++  +P D ++ R+    +   M         R+I+  EG    +K
Sbjct: 14  LINLVAGGTAGLFEALCCHPLDTIKVRMQIAKRTEGMRPHGFITTGRNIYSHEGFLALYK 73

Query: 170 GSIASMTTITLTASIMFGTYETIRIYCDENEKTTAAHKKWELATLNHSAGTIGGVI--AK 227
           G  A +  I    +I F +YE  R    + E  T       + T N     +G  I  A 
Sbjct: 74  GLGAVVIGIIPKMAIRFSSYEFYRNALTDKETRT-------ITTGNTFLAGVGAGITEAV 126

Query: 228 IITFPLETIRRRMQFMNSKHLEKFSRHSSVYG-----SYKGYGFA-RIGLQILKQEGVSS 281
           ++  P+E ++ R+Q  +   L       S  G     +   Y  A      I+K+EG  +
Sbjct: 127 LVVNPMEVVKIRLQAQHLNDLIPQPAGVSAAGTAATVTKPKYANAIHAAYTIVKEEGAGA 186

Query: 282 LYRGI 286
           LYRG+
Sbjct: 187 LYRGV 191

 Score = 47.8 bits (112), Expect = 5e-06,   Method: Compositional matrix adjust.
 Identities = 29/103 (28%), Positives = 49/103 (47%), Gaps = 3/103 (2%)

Query: 5   EDSLRKGQN---VAAWKTLLAGAVSGLLARSITAPMDTIKIRLQLTPANGLKPFGSQVME 61
           +D L+K  N   + +W+T   G +SG +     AP+DTIK RLQ   +        ++  
Sbjct: 213 KDYLQKYHNRESLPSWETSCIGLISGAIGPFSNAPLDTIKTRLQKDKSISSNSAWKKIYI 272

Query: 62  VARSMIKNEGIRSFWKGNIPGSLLYVTYGSAQFSSYSLFNRYL 104
           +   +IK EG R+ +KG  P  +      +  F+ Y    ++L
Sbjct: 273 IGTQLIKEEGFRALYKGITPRVMRVAPGQAVTFTVYEFVRKHL 315

 Score = 41.6 bits (96), Expect = 5e-04,   Method: Compositional matrix adjust.
 Identities = 28/92 (30%), Positives = 39/92 (42%), Gaps = 12/92 (13%)

Query: 214 LNHSAGTIGGVIAKIITFPLETIRRRMQFMNSKHLEKFSRHSSVYGSYKGYGFARIGLQI 273
           +N  AG   G+   +   PL+TI+ RMQ   +K  E    H          GF   G  I
Sbjct: 15  INLVAGGTAGLFEALCCHPLDTIKVRMQI--AKRTEGMRPH----------GFITTGRNI 62

Query: 274 LKQEGVSSLYRGILVALSKTIPTTFVSFWGYE 305
              EG  +LY+G+   +   IP   + F  YE
Sbjct: 63  YSHEGFLALYKGLGAVVIGIIPKMAIRFSSYE 94

>Scas_714.18
          Length = 305

 Score = 75.9 bits (185), Expect = 1e-15,   Method: Compositional matrix adjust.
 Identities = 77/328 (23%), Positives = 145/328 (44%), Gaps = 58/328 (17%)

Query: 6   DSLRKGQNVAAWKTLLAGAVSGLLARSITAPMDTIKIRLQLTPANGLKPFGSQVMEVARS 65
           +++ +G   AA + +LAG+++G + + I  P DT+K+RLQ   A       S +    + 
Sbjct: 2   NAVEEGGFGAALREILAGSIAGAIGKFIEYPFDTVKVRLQTQEAYMFPSTWSCI----KY 57

Query: 66  MIKNEGI-RSFWKGNIPGSLLYVTYGSA-QFSSYSLFNRYLTPFG-LEARLHSLVVGAFA 122
             +NEGI   F++G I   L+     +A  F +Y+  + +L  F    A L  L+   FA
Sbjct: 58  TYENEGILEGFYQG-IESPLIGAALENAILFLAYNQCSSFLNAFTEFSAFLIILISAGFA 116

Query: 123 GITSSIVSYPFDVLRTRLVANNQMHSMS-------------------------ITREVRD 157
           G  +S V  P ++++ +L  +N  +S+                          I   ++ 
Sbjct: 117 GSCASFVLTPVELIKCKLQISNLHYSLHDNDGEQQDEEDEDQGMVIGEGRHTRIIPTIKS 176

Query: 158 IWKLEGLPGFFKGSIASMTTITLTASIMFGTYETIRIYCDENEKTTAAHKKWELATLNHS 217
           I K +GL G ++G  ++    ++ + + F TYE ++      +  +  +  W+L      
Sbjct: 177 IIKEKGLFGLWQGQSSTFIRESIGSVVWFATYELMKQTL--RDPKSEVNTTWQLLI---- 230

Query: 218 AGTIGGVIAKIITFPLETIRRRMQFMNSKHLEKFSRHSSVYGSYKGYGFARIGLQILKQE 277
           +G   G+      FP +T++  MQ   ++HL       S                IL+++
Sbjct: 231 SGATAGLAFNGSVFPADTVKSIMQ---TEHLALMETVRS----------------ILERD 271

Query: 278 GVSSLYRGILVALSKTIPTTFVSFWGYE 305
           GV+  YRG+ + L + +P+    F+ YE
Sbjct: 272 GVAGFYRGLGITLLRAVPSNAAVFYTYE 299

 Score = 40.8 bits (94), Expect = 7e-04,   Method: Compositional matrix adjust.
 Identities = 32/139 (23%), Positives = 69/139 (49%), Gaps = 8/139 (5%)

Query: 57  SQVMEVARSMIKNEGIRSFWKGNIPGSLLYVTYGSAQ-FSSYSLFNRYLTPFGLEARL-- 113
           ++++   +S+IK +G+   W+G    + +  + GS   F++Y L  + L     E     
Sbjct: 168 TRIIPTIKSIIKEKGLFGLWQGQ-SSTFIRESIGSVVWFATYELMKQTLRDPKSEVNTTW 226

Query: 114 HSLVVGAFAGITSSIVSYPFDVLRTRLVANNQMHSMSITREVRDIWKLEGLPGFFKGSIA 173
             L+ GA AG+  +   +P D +++ +    Q   +++   VR I + +G+ GF++G   
Sbjct: 227 QLLISGATAGLAFNGSVFPADTVKSIM----QTEHLALMETVRSILERDGVAGFYRGLGI 282

Query: 174 SMTTITLTASIMFGTYETI 192
           ++     + + +F TYE +
Sbjct: 283 TLLRAVPSNAAVFYTYEKL 301

 Score = 36.6 bits (83), Expect = 0.019,   Method: Compositional matrix adjust.
 Identities = 24/88 (27%), Positives = 42/88 (47%), Gaps = 8/88 (9%)

Query: 17  WKTLLAGAVSGLLARSITAPMDTIKIRLQLTPANGLKPFGSQVMEVARSMIKNEGIRSFW 76
           W+ L++GA +GL       P DT+K  +Q             +ME  RS+++ +G+  F+
Sbjct: 226 WQLLISGATAGLAFNGSVFPADTVKSIMQTEHL--------ALMETVRSILERDGVAGFY 277

Query: 77  KGNIPGSLLYVTYGSAQFSSYSLFNRYL 104
           +G     L  V   +A F +Y   ++ L
Sbjct: 278 RGLGITLLRAVPSNAAVFYTYEKLSKIL 305

>YJL133W (MRS3) [2785] chr10 (160537..161481) Member of the
           mitochondrial carrier (MCF) family of membrane
           transporters, overexpression suppresses mitochondrial
           splicing defects [945 bp, 314 aa]
          Length = 314

 Score = 75.9 bits (185), Expect = 2e-15,   Method: Compositional matrix adjust.
 Identities = 77/302 (25%), Positives = 128/302 (42%), Gaps = 41/302 (13%)

Query: 20  LLAGAVSGLLARSITAPMDTIKIRLQLTPANGL--KPFGSQVMEVARSMIKNEGIRSFWK 77
           L+AGA +G++  S+  P+D +K R+Q   A  L  K   SQ+  ++ S    EG  + WK
Sbjct: 37  LIAGAFAGIMEHSVMFPIDALKTRIQSANAKSLSAKNMLSQISHISTS----EGTLALWK 92

Query: 78  GNI-----PGSLLYVTYGSAQFSSYSLFNRYLT----PFGLEARLHSLVVGAFAGITSSI 128
           G        G    V +G+ +F   +L +   T    PF       + + GA A   S  
Sbjct: 93  GVQSVILGAGPAHAVYFGTYEFCKKNLIDSSDTQTHHPF------KTAISGACATTASDA 146

Query: 129 VSYPFDVLRTRLVANNQMHSMSITREVRDIWKLEGLPGFFKGSIASMTTITLTASIMFGT 188
           +  PFD ++ R+  N    S S+ +  + I++ EGL  F+     ++      A+  F  
Sbjct: 147 LMNPFDTIKQRIQLNT---SASVWQTTKQIYQSEGLAAFYYSYPTTLVMNIPFAAFNFVI 203

Query: 189 YETIRIYCDENEKTTAAHKKWELATLNHS-AGTIGGVIAKIITFPLETIRRRMQFMNSKH 247
           YE+   + + +          E   L H   G+I G     IT PL+ I+  +Q   S+ 
Sbjct: 204 YESSTKFLNPSN---------EYNPLIHCLCGSISGSTCAAITTPLDCIKTVLQIRGSQT 254

Query: 248 LEKFSRHSSVYGSYKGYGFARIGLQILKQEGVSSLYRGILVALSKTIPTTFVSFWGYETA 307
           +       S+    K   F++    I +  G    +RG    +   +P T +S+  YE A
Sbjct: 255 V-------SLEIMRKADTFSKAASAIYQVYGWKGFWRGWKPRIVANMPATAISWTAYECA 307

Query: 308 IH 309
            H
Sbjct: 308 KH 309

 Score = 61.2 bits (147), Expect = 1e-10,   Method: Compositional matrix adjust.
 Identities = 51/199 (25%), Positives = 88/199 (44%), Gaps = 31/199 (15%)

Query: 114 HSLVVGAFAGITSSIVSYPFDVLRTRLVANN--QMHSMSITREVRDIWKLEGLPGFFKGS 171
           H L+ GAFAGI    V +P D L+TR+ + N   + + ++  ++  I   EG    +KG 
Sbjct: 35  HQLIAGAFAGIMEHSVMFPIDALKTRIQSANAKSLSAKNMLSQISHISTSEGTLALWKGV 94

Query: 172 IASMTTITLTASIMFGTYETIRIYCDEN---EKTTAAHKKWELATLNHSAGTIGGVIAKI 228
            + +       ++ FGTYE    +C +N      T  H  ++ A     +G      +  
Sbjct: 95  QSVILGAGPAHAVYFGTYE----FCKKNLIDSSDTQTHHPFKTAI----SGACATTASDA 146

Query: 229 ITFPLETIRRRMQFMNSKHLEKFSRHSSVYGSYKGYGFARIGLQILKQEGVSSLYRGILV 288
           +  P +TI++R+Q   S         +SV+ + K         QI + EG+++ Y     
Sbjct: 147 LMNPFDTIKQRIQLNTS---------ASVWQTTK---------QIYQSEGLAAFYYSYPT 188

Query: 289 ALSKTIPTTFVSFWGYETA 307
            L   IP    +F  YE++
Sbjct: 189 TLVMNIPFAAFNFVIYESS 207

 Score = 55.1 bits (131), Expect = 2e-08,   Method: Compositional matrix adjust.
 Identities = 37/162 (22%), Positives = 79/162 (48%), Gaps = 15/162 (9%)

Query: 17  WKTLLAGAVSGLLARSITAPMDTIKIRLQLTPANGLKPFGSQVMEVARSMIKNEGIRSFW 76
           +KT ++GA +   + ++  P DTIK R+QL  +       + V +  + + ++EG+ +F+
Sbjct: 131 FKTAISGACATTASDALMNPFDTIKQRIQLNTS-------ASVWQTTKQIYQSEGLAAFY 183

Query: 77  KGNIPGSLLYVTYGSAQFSSYSLFNRYLTPFGLEARLHSLVVGAFAGITSSIVSYPFDVL 136
                  ++ + + +  F  Y    ++L P      L   + G+ +G T + ++ P D +
Sbjct: 184 YSYPTTLVMNIPFAAFNFVIYESSTKFLNPSNEYNPLIHCLCGSISGSTCAAITTPLDCI 243

Query: 137 RTRL-VANNQMHSMSITREVRD-------IWKLEGLPGFFKG 170
           +T L +  +Q  S+ I R+          I+++ G  GF++G
Sbjct: 244 KTVLQIRGSQTVSLEIMRKADTFSKAASAIYQVYGWKGFWRG 285

>YKR052C (MRS4) [3303] chr11 complement(532192..533106) Member of
           the mitochondrial carrier (MCF) family of membrane
           transporters, overexpression suppresses defects in
           splicing of mitochondrial introns [915 bp, 304 aa]
          Length = 304

 Score = 75.1 bits (183), Expect = 3e-15,   Method: Compositional matrix adjust.
 Identities = 71/298 (23%), Positives = 129/298 (43%), Gaps = 33/298 (11%)

Query: 20  LLAGAVSGLLARSITAPMDTIKIRLQLTPANGLKPFG--SQVMEVAR---SMIKNEGIRS 74
           LLAGA +G++  S+  P+D +K R+Q    N     G  SQ+ +++    SM   +G++S
Sbjct: 27  LLAGAFAGIMEHSLMFPIDALKTRVQAAGLNKAASTGMISQISKISTMEGSMALWKGVQS 86

Query: 75  FWKGNIPGSLLYVTYGSAQFSSYSLFNRYLTPFGLEAR--LHSLVVGAFAGITSSIVSYP 132
              G  P   +Y  +G+ +F       R ++P  ++    + + + G  A I +  +  P
Sbjct: 87  VILGAGPAHAVY--FGTYEFCK----ARLISPEDMQTHQPMKTALSGTIATIAADALMNP 140

Query: 133 FDVLRTRLVANNQMHSMSITREVRDIWKLEGLPGFFKGSIASMTTITLTASIMFGTYETI 192
           FD ++ RL  +  +   ++T++   I++ EG   F+     ++      A+  F  YE+ 
Sbjct: 141 FDTVKQRLQLDTNLRVWNVTKQ---IYQNEGFAAFYYSYPTTLAMNIPFAAFNFMIYESA 197

Query: 193 -RIYCDENEKTTAAHKKWELATLNHSAGTIGGVIAKIITFPLETIRRRMQFMNSKHLEKF 251
            + +  +N      H            G I G     +T PL+ I+  +Q   S+ +   
Sbjct: 198 SKFFNPQNSYNPLIHCL---------CGGISGATCAALTTPLDCIKTVLQVRGSETV--- 245

Query: 252 SRHSSVYGSYKGYGFARIGLQILKQEGVSSLYRGILVALSKTIPTTFVSFWGYETAIH 309
               S+        F R    IL+  G    +RG+   +   IP T +S+  YE A H
Sbjct: 246 ----SIEIMKDANTFGRASRAILEVHGWKGFWRGLKPRIVANIPATAISWTAYECAKH 299

 Score = 56.6 bits (135), Expect = 5e-09,   Method: Compositional matrix adjust.
 Identities = 43/190 (22%), Positives = 85/190 (44%), Gaps = 15/190 (7%)

Query: 18  KTLLAGAVSGLLARSITAPMDTIKIRLQLTPANGLKPFGSQVMEVARSMIKNEGIRSFWK 77
           KT L+G ++ + A ++  P DT+K RLQL           +V  V + + +NEG  +F+ 
Sbjct: 122 KTALSGTIATIAADALMNPFDTVKQRLQLDT-------NLRVWNVTKQIYQNEGFAAFYY 174

Query: 78  GNIPGSLLYVTYGSAQFSSYSLFNRYLTPFGLEARLHSLVVGAFAGITSSIVSYPFDVLR 137
                  + + + +  F  Y   +++  P      L   + G  +G T + ++ P D ++
Sbjct: 175 SYPTTLAMNIPFAAFNFMIYESASKFFNPQNSYNPLIHCLCGGISGATCAALTTPLDCIK 234

Query: 138 TRL-VANNQMHSMSITREV-------RDIWKLEGLPGFFKGSIASMTTITLTASIMFGTY 189
           T L V  ++  S+ I ++        R I ++ G  GF++G    +       +I +  Y
Sbjct: 235 TVLQVRGSETVSIEIMKDANTFGRASRAILEVHGWKGFWRGLKPRIVANIPATAISWTAY 294

Query: 190 ETIRIYCDEN 199
           E  + +  +N
Sbjct: 295 ECAKHFLMKN 304

>Sklu_2374.7 YNL083W, Contig c2374 13874-15415 reverse complement
          Length = 513

 Score = 76.3 bits (186), Expect = 3e-15,   Method: Compositional matrix adjust.
 Identities = 51/199 (25%), Positives = 95/199 (47%), Gaps = 23/199 (11%)

Query: 14  VAAWKTLLAGAVSGLLARSITAPMDTIKIRLQLTPANGLKPFGSQVMEVARSMIKNEGIR 73
           ++ + T +AG + G++A+    P+DT+K R+Q  P +        ++  AR M ++ G++
Sbjct: 313 LSKFSTYIAGGMGGVVAQFSVYPIDTLKYRVQCAPLDTALKGNELLISTARQMYRDGGLK 372

Query: 74  SFWKGNIPGSLLYVTYGSAQFSSYSLFNRYLTPFGLEARLHSLVV-------------GA 120
            F++G   G +    Y +    ++S   ++      +A++  + V             GA
Sbjct: 373 LFYRGVTVGVMGIFPYAALDLGTFSALKKWY--IARQAKMTGVPVDQVTISNFIVLPMGA 430

Query: 121 FAGITSSIVSYPFDVLRTRLVANN---QMHSMSITREVRDIWKL---EGLPGFFKGSIAS 174
           F+G   + V YP ++LRTRL A       H+ +  R+V  +WK    EG  G FKG + +
Sbjct: 431 FSGTVGATVVYPINLLRTRLQAQGTYAHPHTYTGFRDV--LWKTVQREGYQGLFKGLVPN 488

Query: 175 MTTITLTASIMFGTYETIR 193
           +  +    SI +  YE  +
Sbjct: 489 LAKVCPAVSISYLCYENFK 507

 Score = 74.7 bits (182), Expect = 8e-15,   Method: Compositional matrix adjust.
 Identities = 66/320 (20%), Positives = 134/320 (41%), Gaps = 46/320 (14%)

Query: 20  LLAGAVSGLLARSITAPMDTIKI----RLQLT--------------PANGLKPFGSQVME 61
            +AG  SG+++R+ TAP D IK+    R  L+              P   +    S +++
Sbjct: 199 FIAGGCSGVISRTCTAPFDRIKVFLIARTDLSSTLLNSKDKVLMKNPNADISKIKSPLIK 258

Query: 62  VARSMIKNEGIRSFWKGNIPGSLLYVTYGSAQFSSYSLFNRYLTPF-GLE-----ARLHS 115
            A ++ +  GIR+F+ GN    +      + +F S+ L  + +    G+      ++  +
Sbjct: 259 AATTLYRQGGIRAFYVGNGLNVIKVFPESAMKFGSFELAKQLMAHLEGVHHTSELSKFST 318

Query: 116 LVVGAFAGITSSIVSYPFDVLRTRLVANNQMHSMS----ITREVRDIWKLEGLPGFFKGS 171
            + G   G+ +    YP D L+ R+       ++     +    R +++  GL  F++G 
Sbjct: 319 YIAGGMGGVVAQFSVYPIDTLKYRVQCAPLDTALKGNELLISTARQMYRDGGLKLFYRGV 378

Query: 172 IASMTTITLTASIMFGTYETIRI-YCDENEKTTAAHKKWELATLNH----SAGTIGGVIA 226
              +  I   A++  GT+  ++  Y     K T      +  T+++      G   G + 
Sbjct: 379 TVGVMGIFPYAALDLGTFSALKKWYIARQAKMTGV--PVDQVTISNFIVLPMGAFSGTVG 436

Query: 227 KIITFPLETIRRRMQFMNSKHLEKFSRHSSVYGSYKGYGFARIGLQILKQEGVSSLYRGI 286
             + +P+  +R R+Q   +        H   Y      GF  +  + +++EG   L++G+
Sbjct: 437 ATVVYPINLLRTRLQAQGT------YAHPHTYT-----GFRDVLWKTVQREGYQGLFKGL 485

Query: 287 LVALSKTIPTTFVSFWGYET 306
           +  L+K  P   +S+  YE 
Sbjct: 486 VPNLAKVCPAVSISYLCYEN 505

 Score = 28.5 bits (62), Expect = 7.6,   Method: Compositional matrix adjust.
 Identities = 19/91 (20%), Positives = 38/91 (41%)

Query: 14  VAAWKTLLAGAVSGLLARSITAPMDTIKIRLQLTPANGLKPFGSQVMEVARSMIKNEGIR 73
           ++ +  L  GA SG +  ++  P++ ++ RLQ           +   +V    ++ EG +
Sbjct: 420 ISNFIVLPMGAFSGTVGATVVYPINLLRTRLQAQGTYAHPHTYTGFRDVLWKTVQREGYQ 479

Query: 74  SFWKGNIPGSLLYVTYGSAQFSSYSLFNRYL 104
             +KG +P         S  +  Y  F R +
Sbjct: 480 GLFKGLVPNLAKVCPAVSISYLCYENFKRLM 510

>Scas_379.2
          Length = 301

 Score = 74.7 bits (182), Expect = 3e-15,   Method: Compositional matrix adjust.
 Identities = 69/294 (23%), Positives = 123/294 (41%), Gaps = 27/294 (9%)

Query: 20  LLAGAVSGLLARSITAPMDTIKIRLQLTPANGLKPFGSQVMEVARSMIKNEGIRSFWKGN 79
           LLAGA +G++  S+  P+D +K R+Q T A       SQ+ +++ +    EG  + WKG 
Sbjct: 27  LLAGAFAGIMEHSVMFPIDALKTRIQSTSAKSTSNMLSQMAKISTA----EGSLALWKGV 82

Query: 80  IPGSLLYVTYGSAQFSSYSLFNRYL---TPFGLEARLHSLVVGAFAGITSSIVSYPFDVL 136
               L      +  F++Y    +YL           L + + G  A I +  +  PFD L
Sbjct: 83  QSVILGAGPAHAVYFATYEYTKKYLIDEKDMQTHQPLKTALSGTVATIAADALMNPFDTL 142

Query: 137 RTRLVANNQMHSMSITREVRDIWKLEGLPGFFKGSIASMTTITLTASIMFGTYET-IRIY 195
           + R+  N      ++T++   I+K EG   F+     ++      A+  F  YE+  + +
Sbjct: 143 KQRMQLNTNTTVWNVTKQ---IYKNEGFSAFYYSYPTTLAMNIPFAAFNFMIYESATKFF 199

Query: 196 CDENEKTTAAHKKWELATLNHSAGTIGGVIAKIITFPLETIRRRMQFMNSKHLEKFSRHS 255
              N+     H           +G + G     IT PL+ I+  +Q   S+ +       
Sbjct: 200 NPTNDYNPLVHCL---------SGGLSGATCAAITTPLDCIKTVLQVRGSESV------- 243

Query: 256 SVYGSYKGYGFARIGLQILKQEGVSSLYRGILVALSKTIPTTFVSFWGYETAIH 309
           S+    +   F +    I +  G    +RG+   +   +P T +++  YE A H
Sbjct: 244 SLQVMKEANTFQKATKAIYQVHGAKGFWRGLQPRVFANMPATAIAWTAYECAKH 297

 Score = 69.7 bits (169), Expect = 2e-13,   Method: Compositional matrix adjust.
 Identities = 52/194 (26%), Positives = 89/194 (45%), Gaps = 23/194 (11%)

Query: 114 HSLVVGAFAGITSSIVSYPFDVLRTRLVANNQMHSMSITREVRDIWKLEGLPGFFKGSIA 173
           H L+ GAFAGI    V +P D L+TR+ + +   + ++  ++  I   EG    +KG  +
Sbjct: 25  HQLLAGAFAGIMEHSVMFPIDALKTRIQSTSAKSTSNMLSQMAKISTAEGSLALWKGVQS 84

Query: 174 SMTTITLTASIMFGTYETIRIYCDENEKTTAAHKKWELATLNHSAGTIGGVIAKIITFPL 233
            +       ++ F TYE  + Y  + EK    H+  + A     +GT+  + A  +  P 
Sbjct: 85  VILGAGPAHAVYFATYEYTKKYLID-EKDMQTHQPLKTAL----SGTVATIAADALMNPF 139

Query: 234 ETIRRRMQFMNSKHLEKFSRHSSVYGSYKGYGFARIGLQILKQEGVSSLYRGILVALSKT 293
           +T+++RMQ          + +++V+   K         QI K EG S+ Y      L+  
Sbjct: 140 DTLKQRMQ---------LNTNTTVWNVTK---------QIYKNEGFSAFYYSYPTTLAMN 181

Query: 294 IPTTFVSFWGYETA 307
           IP    +F  YE+A
Sbjct: 182 IPFAAFNFMIYESA 195

 Score = 59.3 bits (142), Expect = 7e-10,   Method: Compositional matrix adjust.
 Identities = 43/176 (24%), Positives = 85/176 (48%), Gaps = 20/176 (11%)

Query: 4   EEDSLRKGQNVAAWKTLLAGAVSGLLARSITAPMDTIKIRLQLTPANGLKPFGSQVMEVA 63
           +E  ++  Q +   KT L+G V+ + A ++  P DT+K R+QL          + V  V 
Sbjct: 109 DEKDMQTHQPL---KTALSGTVATIAADALMNPFDTLKQRMQLNT-------NTTVWNVT 158

Query: 64  RSMIKNEGIRSFWKGNIPGSL-LYVTYGSAQFSSYSLFNRYLTPFGLEARLHSLVVGAFA 122
           + + KNEG  +F+  + P +L + + + +  F  Y    ++  P      L   + G  +
Sbjct: 159 KQIYKNEGFSAFYY-SYPTTLAMNIPFAAFNFMIYESATKFFNPTNDYNPLVHCLSGGLS 217

Query: 123 GITSSIVSYPFDVLRTRL-VANNQMHSMSITREV-------RDIWKLEGLPGFFKG 170
           G T + ++ P D ++T L V  ++  S+ + +E        + I+++ G  GF++G
Sbjct: 218 GATCAAITTPLDCIKTVLQVRGSESVSLQVMKEANTFQKATKAIYQVHGAKGFWRG 273

>ACR109W [1156] [Homologous to ScYOR222W (ODC2) - SH; ScYPL134C
           (ODC1) - SH] complement(546745..547644) [900 bp, 299 aa]
          Length = 299

 Score = 74.7 bits (182), Expect = 4e-15,   Method: Compositional matrix adjust.
 Identities = 70/300 (23%), Positives = 131/300 (43%), Gaps = 28/300 (9%)

Query: 20  LLAGAVSGLLARSITAPMDTIKIRLQLTPANGLKPFGSQVMEVARSMIKNEGIRSFWKGN 79
             AGAV+G+    +  P+D +K R+QL    G  P  + V++  + ++  EG+   +KG 
Sbjct: 15  FFAGAVAGVSEILVMYPLDVVKTRMQLQVQGGAGPHYTGVVDCLKKIVAGEGVGRLYKGI 74

Query: 80  IPGSLLYVTYGSAQFSSYSLFNR-YLTPFGLE--ARLHSLVVGAFAGITSSIVSYPFDVL 136
               L+     + +F+    F + Y   FG+E  ++  S++ GA AG   + V  PF+++
Sbjct: 75  SSPILMEAPKRATKFACNDEFQKLYKQAFGVEKLSQPLSMLAGASAGCVEAFVVVPFELV 134

Query: 137 RTRLVANNQMHSMSITREVRDIWKLEGLPGFFKGSIASMTTITLTASIMFGTYETIRIYC 196
           + RL   +  +   +   VR I   EG+   + G  +++    L     FG     R   
Sbjct: 135 KIRLQDASSSYKGPVD-VVRKIVAREGVLAMYNGLESTLWRHALWNGGYFGIIFQARAL- 192

Query: 197 DENEKTTAAHKKWELATLNHSAGTIGGVIAKIITFPLETIRRRMQFMNSKHLEKFSRHSS 256
                  AAH K +  T +  + +IG  I  +++ P + ++ R+Q             + 
Sbjct: 193 -----LPAAHNKTQCITNDLISDSIGCSIGCMLSTPFDVVKSRIQ-----------NTAV 236

Query: 257 VYGSYKGYGFARIG-LQILKQEGVSSLYRGILVALSKTIP------TTFVSFWGYETAIH 309
           + G  + Y ++    L I ++EG  +LY+G +  + +  P        F     +  AIH
Sbjct: 237 IPGVVRKYNWSLPSLLTIYREEGFRALYKGFVPKVLRLGPGGGILLVVFTGVLDFCRAIH 296

 Score = 44.7 bits (104), Expect = 4e-05,   Method: Compositional matrix adjust.
 Identities = 44/181 (24%), Positives = 76/181 (41%), Gaps = 31/181 (17%)

Query: 113 LHSLVVGAFAGITSSIVSYPFDVLRTRLVANNQ----MHSMSITREVRDIWKLEGLPGFF 168
           L+    GA AG++  +V YP DV++TR+    Q     H   +   ++ I   EG+   +
Sbjct: 12  LYQFFAGAVAGVSEILVMYPLDVVKTRMQLQVQGGAGPHYTGVVDCLKKIVAGEGVGRLY 71

Query: 169 KGSIASMTTITLTASIMFGTYETIRIYC-DENEKTTAAHKKWELAT--LNHSAGTIGGVI 225
           KG  + +        +M       +  C DE +K        E  +  L+  AG   G +
Sbjct: 72  KGISSPI--------LMEAPKRATKFACNDEFQKLYKQAFGVEKLSQPLSMLAGASAGCV 123

Query: 226 AKIITFPLETIRRRMQFMNSKHLEKFSRHSSVYGSYKGYGFARIGLQILKQEGVSSLYRG 285
              +  P E ++ R+Q  +S              SYKG     +  +I+ +EGV ++Y G
Sbjct: 124 EAFVVVPFELVKIRLQDASS--------------SYKGP--VDVVRKIVAREGVLAMYNG 167

Query: 286 I 286
           +
Sbjct: 168 L 168

 Score = 40.0 bits (92), Expect = 0.001,   Method: Compositional matrix adjust.
 Identities = 37/188 (19%), Positives = 80/188 (42%), Gaps = 18/188 (9%)

Query: 19  TLLAGAVSGLLARSITAPMDTIKIRLQLTPANGLKPFGSQVMEVARSMIKNEGIRSFWKG 78
           ++LAGA +G +   +  P + +KIRLQ   ++   P     ++V R ++  EG+ + + G
Sbjct: 113 SMLAGASAGCVEAFVVVPFELVKIRLQDASSSYKGP-----VDVVRKIVAREGVLAMYNG 167

Query: 79  NIPGSLLYVTYGSAQFSSYSLFNRYLTPFG---LEARLHSLVVGAFAGITSSIVSYPFDV 135
            +  +L      +  +       R L P      +   + L+  +       ++S PFDV
Sbjct: 168 -LESTLWRHALWNGGYFGIIFQARALLPAAHNKTQCITNDLISDSIGCSIGCMLSTPFDV 226

Query: 136 LRTRLVANNQMHSMSITRE-------VRDIWKLEGLPGFFKGSIASMTTITLTASIMFGT 188
           +++R+   N      + R+       +  I++ EG    +KG +  +  +     I+   
Sbjct: 227 VKSRI--QNTAVIPGVVRKYNWSLPSLLTIYREEGFRALYKGFVPKVLRLGPGGGILLVV 284

Query: 189 YETIRIYC 196
           +  +  +C
Sbjct: 285 FTGVLDFC 292

>KLLA0C13431g 1145919..1146905 similar to sgd|S0005626 Saccharomyces
           cerevisiae YOR100c CRC1 mitochondrial carnitine carrier,
           member of the mitochondrial carrier (MCF) family, start
           by similarity
          Length = 328

 Score = 74.3 bits (181), Expect = 6e-15,   Method: Compositional matrix adjust.
 Identities = 69/287 (24%), Positives = 121/287 (42%), Gaps = 25/287 (8%)

Query: 7   SLRKGQNVAAWKTLLAGAVSGLLARSITAPMDTIKIRLQLTPANGLKPFGSQVMEVARSM 66
           S  K Q     K+L AG V G+ A     P D +K+R Q   A       S +++ AR  
Sbjct: 19  SQTKSQLTENLKSLAAGGVGGVCAVLTGHPFDLVKVRCQSNQARSAMDAVSHILQAARQA 78

Query: 67  IKN---EGIRSFWKGNIPGSLLYVTYGSAQFSSYSLFNRYLTPFGL-----------EAR 112
                   +R F+KG +P  L      +  F  Y +  + +T               E  
Sbjct: 79  AGPTSLNAVRGFYKGVVPPLLGVTPIFAVSFWGYDVGKKLVTSVPSSAASGAAAVEPELT 138

Query: 113 LHSLVVGAF-AGITSSIVSYPFDVLRTRLVANNQMHSMSITREVRDIWKLEGLPGFFKGS 171
           L  +    F + I +++V+ P +  R ++V        S     + I + +G    FKGS
Sbjct: 139 LSQMAAAGFISAIPTTLVTAPTE--RVKVVLQTTQGKASFLDAAKQIVRTQGFQSLFKGS 196

Query: 172 IASMTTITLTASIMFGTYETIRIYCDENEKTTAAHKKWELATLNHS-AGTIGGVIAKIIT 230
           +A+++     +++ F +YE     C E     + H   EL+  N   +G + GV   ++ 
Sbjct: 197 LATLSRDGPGSALYFASYE----ICKEYLNKASGHTSGELSITNVCISGGMAGVSMWVVV 252

Query: 231 FPLETIRRRMQFMNSKH--LEKFSRHSSVYGSYKGYGFARIGLQILK 275
           FP++T++ ++Q  + +   LE      +  G  KG+ F  +G  IL+
Sbjct: 253 FPIDTVKTQLQSSSKRQSMLEVTRMIYNTRGGIKGF-FPGVGPAILR 298

>YEL006W (YEL006W) [1417] chr5 (144326..145333) Member of the
           mitochondrial carrier (MCF) family of membrane
           transporters [1008 bp, 335 aa]
          Length = 335

 Score = 73.9 bits (180), Expect = 9e-15,   Method: Compositional matrix adjust.
 Identities = 79/320 (24%), Positives = 129/320 (40%), Gaps = 49/320 (15%)

Query: 9   RKGQNVAAWKTLLAGAVSGLLARSITAPMDTIKIRLQLTPANGLKPFGSQVMEVA----- 63
           R  +N       ++GA+SG L+  +  P D  K RLQ   A GL+    Q          
Sbjct: 31  RLKKNADPRVAAISGALSGALSAMLVCPFDVAKTRLQ---AQGLQNMTHQSQHYKGFFGT 87

Query: 64  -RSMIKNEGIRSFWKGNIPGSLLYVTYGSAQFSSYSLFNRY-LTPFGLEARLHSLVVGAF 121
             ++ K+EG    +KG  P  L Y+      FS Y    +Y +  F     L +      
Sbjct: 88  FATIFKDEGAAGLYKGLQPTVLGYIPTLMIYFSVYDFCRKYSVDIFPHSPFLSNASSAIT 147

Query: 122 AGITSSIVSYPFDVLRTRL-----VANNQMHSMSITREVRDIWKLEGLPGFFKGSIASMT 176
           AG  S++ + P  V++TRL     +     H        R I + EG    + G + ++ 
Sbjct: 148 AGAISTVATNPIWVVKTRLMLQTGIGKYSTHYKGTIDTFRKIIQQEGAKALYAGLVPALL 207

Query: 177 TITLTASIMFGTYETIRIYCDENEK-------TTAAHKKWELATLNHSAGTIGGVIAKII 229
            + L  +I F  YE ++I    +E        T++  +K  LA++      +  ++A  +
Sbjct: 208 GM-LNVAIQFPLYENLKIRFGYSESTDVSTDVTSSNFQKLILASM------LSKMVASTV 260

Query: 230 TFPLETIRRRMQFMNSKHLEKFSRHSSVYGSYKGYGFARIGLQILK----QEGVSSLYRG 285
           T+P E +R RMQ + S       RH                L ++K    QEG +  Y G
Sbjct: 261 TYPHEILRTRMQ-LKSDLPNTVQRHL---------------LPLIKITYRQEGFAGFYSG 304

Query: 286 ILVALSKTIPTTFVSFWGYE 305
               L +T+P   V+   +E
Sbjct: 305 FATNLVRTVPAAVVTLVSFE 324

 Score = 40.0 bits (92), Expect = 0.002,   Method: Compositional matrix adjust.
 Identities = 44/199 (22%), Positives = 90/199 (45%), Gaps = 30/199 (15%)

Query: 16  AWKTLLAGAVSGLLARSITAPMDTIKIRLQLTPANGLKPFGSQ---VMEVARSMIKNEGI 72
           A   + AGA+S +     T P+  +K RL L    G+  + +     ++  R +I+ EG 
Sbjct: 142 ASSAITAGAISTV----ATNPIWVVKTRLML--QTGIGKYSTHYKGTIDTFRKIIQQEGA 195

Query: 73  RSFWKGNIPGSLLYVTYGSAQFSSYSLFNRYLTPFGLE-----------ARLHSLVVGA- 120
           ++ + G +P +LL +   + QF    L+      FG             +    L++ + 
Sbjct: 196 KALYAGLVP-ALLGMLNVAIQFP---LYENLKIRFGYSESTDVSTDVTSSNFQKLILASM 251

Query: 121 FAGITSSIVSYPFDVLRTRLVANNQMHSMSITREVRDIWKL----EGLPGFFKGSIASMT 176
            + + +S V+YP ++LRTR+   + + + ++ R +  + K+    EG  GF+ G   ++ 
Sbjct: 252 LSKMVASTVTYPHEILRTRMQLKSDLPN-TVQRHLLPLIKITYRQEGFAGFYSGFATNLV 310

Query: 177 TITLTASIMFGTYETIRIY 195
                A +   ++E  + Y
Sbjct: 311 RTVPAAVVTLVSFEYSKKY 329

>Scas_667.4
          Length = 308

 Score = 73.6 bits (179), Expect = 9e-15,   Method: Compositional matrix adjust.
 Identities = 70/305 (22%), Positives = 138/305 (45%), Gaps = 51/305 (16%)

Query: 3   KEEDSLRKGQNVAAWKTLLAGAVSGLLARSITAPMDTIKIRLQ----LTPANGLKPFGSQ 58
           KEE  ++K  N A     L G VS  +A++  +P++ +K+ +Q    +     L      
Sbjct: 4   KEE--VKKESNFAI--DFLMGGVSAAVAKTAASPIERVKLLIQNQDEMIKQGSLDSKYKG 59

Query: 59  VMEVARSMIKNEGIRSFWKGNIPGSLLYVTYGSAQFSSYSLFNRYLTPFGLEAR------ 112
           ++E  +   K EGI +FW+GN    + Y      Q  +++  ++    FG +        
Sbjct: 60  IIECFQRTAKTEGIIAFWRGNTANVIRYF---PTQALNFAFKDKIKAMFGFKKEEGYGKW 116

Query: 113 -LHSLVVGAFAGITSSIVSYPFDVLRTRLVANNQMHSMSITREVR---DIWK----LEGL 164
              +L  G  AG  S +  Y  D  RTRL A+ +      +R+ +   D++K     +G+
Sbjct: 117 FAGNLASGGAAGGLSLLFVYSLDYARTRLAADAKSSKKGGSRQYKGLIDVYKQTLATDGM 176

Query: 165 PGFFKGSIASMTTITLTASIMFGTYETIRIYCDENEKTTAAHKKWELATLNHSAGTIGGV 224
            G ++G + S+  I +   + FG Y++++         T + +   LA+       +G +
Sbjct: 177 AGLYRGFLPSVVGIIVYRGLYFGLYDSLKPAV-----LTGSLEGSFLASF-----LLGWI 226

Query: 225 I---AKIITFPLETIRRRMQFMNSKHLEKFSRHSSVYGSYKGYGFARIGLQILKQEGVSS 281
           +   A   ++PL+T+RRRM   + + +    ++   +  ++         +++  EGVSS
Sbjct: 227 VTTGASTASYPLDTVRRRMMMTSGQAV----KYDGAFDCFR---------KVVAAEGVSS 273

Query: 282 LYRGI 286
           L++G 
Sbjct: 274 LFKGC 278

 Score = 31.6 bits (70), Expect = 0.72,   Method: Compositional matrix adjust.
 Identities = 33/128 (25%), Positives = 56/128 (43%), Gaps = 12/128 (9%)

Query: 160 KLEGLPGFFKGSIASMTTITLTASIMFGTYETIRIYCDENEKTTAAHKKWELATLNHSAG 219
           K EG+  F++G+ A++     T ++ F   + I+       K    + KW    L  S G
Sbjct: 69  KTEGIIAFWRGNTANVIRYFPTQALNFAFKDKIKAMF--GFKKEEGYGKWFAGNL-ASGG 125

Query: 220 TIGGVIAKIITFPLETIRRRMQFMNSKHLEKFSRHSSVYGSYKGYGFARIGLQILKQEGV 279
             GG ++ +  + L+  R R        L   ++ S   GS +  G   +  Q L  +G+
Sbjct: 126 AAGG-LSLLFVYSLDYARTR--------LAADAKSSKKGGSRQYKGLIDVYKQTLATDGM 176

Query: 280 SSLYRGIL 287
           + LYRG L
Sbjct: 177 AGLYRGFL 184

>Scas_582.7
          Length = 329

 Score = 73.9 bits (180), Expect = 1e-14,   Method: Compositional matrix adjust.
 Identities = 74/294 (25%), Positives = 128/294 (43%), Gaps = 21/294 (7%)

Query: 20  LLAGAVSGLLARSITAPMDTIKIRLQLTPANGLKPFGSQVMEVARSMIKNEGIRSFWKGN 79
           LLAGA +G++  S   P+D +K R+Q T   G +   + +++    +   EG  + WKG 
Sbjct: 40  LLAGAFAGIMEHSTMFPIDALKTRIQSTTTKGTEQTSTSIIKQISKISTMEGSLALWKGV 99

Query: 80  IPGSLLYVTYGSAQFSSYSLFNRYLTPFGLEARLHSLVVGAFAGITSSIVS----YPFDV 135
               L      +  F++Y     +L P   +   H  +  A +G T+++ S     PFD 
Sbjct: 100 QSVILGAGPAHAVYFATYEFTKAHLIP-DSQRETHQPIKVAVSGATATVASDFFMNPFDT 158

Query: 136 LRTRLVANNQMHSMSITREVRDIWKLEGLPGFFKGSIASMTTITLTASIMFGTYETIRIY 195
           ++ R+  ++ +    +    + I+ LEGL  F+    +  TTI +  +I F  +    IY
Sbjct: 159 IKQRMQISD-LKKEKVYNVAKKIYNLEGLSAFY---YSYPTTIAM--NIPFAAFN-FMIY 211

Query: 196 CDENEKTTAAHKKWELATLNHSAGTIGGVIAKIITFPLETIRRRMQFMNSKHLEKFSRHS 255
              ++     H    L  ++   G I G IA  +T PL+ I+  +Q   S  +       
Sbjct: 212 ESASKFFNPLHHYNPL--IHCLCGGISGAIAAAVTTPLDCIKTVIQIRGSSVV------- 262

Query: 256 SVYGSYKGYGFARIGLQILKQEGVSSLYRGILVALSKTIPTTFVSFWGYETAIH 309
           S+    K   F +    IL   G    +RG+   +   +P T +S+  YE A H
Sbjct: 263 SLEVMKKANTFKKATSAILMVYGWKGFWRGLQPRILANMPATAISWTAYECAKH 316

 Score = 61.2 bits (147), Expect = 2e-10,   Method: Compositional matrix adjust.
 Identities = 52/200 (26%), Positives = 87/200 (43%), Gaps = 29/200 (14%)

Query: 114 HSLVVGAFAGITSSIVSYPFDVLRTRLVAN----NQMHSMSITREVRDIWKLEGLPGFFK 169
           H L+ GAFAGI      +P D L+TR+ +      +  S SI +++  I  +EG    +K
Sbjct: 38  HQLLAGAFAGIMEHSTMFPIDALKTRIQSTTTKGTEQTSTSIIKQISKISTMEGSLALWK 97

Query: 170 GSIASMTTITLTASIMFGTYETIRIYC--DENEKTTAAHKKWELATLNHSAGTIGGVIAK 227
           G  + +       ++ F TYE  + +   D   +T   H+  ++A     +G    V + 
Sbjct: 98  GVQSVILGAGPAHAVYFATYEFTKAHLIPDSQRET---HQPIKVAV----SGATATVASD 150

Query: 228 IITFPLETIRRRMQFMNSKHLEKFSRHSSVYGSYKGYGFARIGLQILKQEGVSSLYRGIL 287
               P +TI++RMQ  + K               K Y  A+   +I   EG+S+ Y    
Sbjct: 151 FFMNPFDTIKQRMQISDLK-------------KEKVYNVAK---KIYNLEGLSAFYYSYP 194

Query: 288 VALSKTIPTTFVSFWGYETA 307
             ++  IP    +F  YE+A
Sbjct: 195 TTIAMNIPFAAFNFMIYESA 214

 Score = 42.4 bits (98), Expect = 2e-04,   Method: Compositional matrix adjust.
 Identities = 28/121 (23%), Positives = 56/121 (46%), Gaps = 5/121 (4%)

Query: 18  KTLLAGAVSGLLARSITAPMDTIKIRLQLTPANGLKPFGSQVMEVARSMIKNEGIRSFWK 77
           K  ++GA + + +     P DTIK R+Q++    LK    +V  VA+ +   EG+ +F+ 
Sbjct: 137 KVAVSGATATVASDFFMNPFDTIKQRMQIS---DLK--KEKVYNVAKKIYNLEGLSAFYY 191

Query: 78  GNIPGSLLYVTYGSAQFSSYSLFNRYLTPFGLEARLHSLVVGAFAGITSSIVSYPFDVLR 137
                  + + + +  F  Y   +++  P      L   + G  +G  ++ V+ P D ++
Sbjct: 192 SYPTTIAMNIPFAAFNFMIYESASKFFNPLHHYNPLIHCLCGGISGAIAAAVTTPLDCIK 251

Query: 138 T 138
           T
Sbjct: 252 T 252

>Scas_721.27
          Length = 374

 Score = 73.9 bits (180), Expect = 1e-14,   Method: Compositional matrix adjust.
 Identities = 89/356 (25%), Positives = 150/356 (42%), Gaps = 73/356 (20%)

Query: 5   EDSLRKGQ-----NVAAWKTLLAGAVSGLLARSITAPMDTIKIRLQLTP----------- 48
           EDS +K +     NV  W   +AG + G+    +T P D +K RLQ              
Sbjct: 36  EDSTKKIKPESHPNVKPWVHFVAGGIGGMAGAVVTCPFDLVKTRLQSDIYQSVYKSKAAT 95

Query: 49  ---------ANGLKPFGSQVME---VARSMIKNEGIRSFWKGNIPG--------SLLYVT 88
                    AN L   G+   E   +  ++ K EG RS +KG  P         S+ + T
Sbjct: 96  VTAAHNSKIANSLVQAGTHFKETFGILGNVYKREGFRSLFKGLGPNLVGVIPARSINFFT 155

Query: 89  YGSAQFSSYSLFNRYLTPFGLEARLHSLVVGAFAGITSSIVSYPFDVLRTRLVANNQMHS 148
           YG+ +      FN      G E  L  L+  A AG  +S  + P  +++TR+    Q+  
Sbjct: 156 YGTTKEIYSKAFNN-----GQETPLIHLMSAATAGWATSTATNPIWMIKTRV----QLDK 206

Query: 149 MSITREVRDIW-------KLEGLPGFFKGSIASMTTITLTASIMFGTYE---------TI 192
              TR+ ++ W       K EG+ G ++G  AS    ++   + +  YE         +I
Sbjct: 207 AGTTRKYKNSWDCLKTVLKSEGIYGLYRGLSASYLG-SIEGILQWLLYEQMKHLIKQRSI 265

Query: 193 RIYCDENEKTTAAHKKWELATLNHSAGTIGGVIAKIITFPLETIRRRMQFMNSKHLEKFS 252
             +  E + T +  +K +       +  +   IA I+T+P E +R R++ M  ++     
Sbjct: 266 EKFGHEGQLTKSRTEKIKEWCQRSGSAGVAKFIASIVTYPHEVVRTRLRQMPMEN----- 320

Query: 253 RHSSVYGSYKGYGFARIGLQILKQEGVSSLYRGILVALSKTIPTTFVSFWGYETAI 308
                 G  K  G  +    I+K+EG++S+Y G+   L +T+P + + F  +E  I
Sbjct: 321 ------GKPKYTGLVQSFRVIIKEEGLASMYSGLTPHLMRTVPNSIIMFGTWELVI 370

>KLLA0E18788g complement(1661093..1662238) similar to sp|P38702
           Saccharomyces cerevisiae YHR002w, start by similarity
          Length = 381

 Score = 73.6 bits (179), Expect = 2e-14,   Method: Compositional matrix adjust.
 Identities = 77/331 (23%), Positives = 137/331 (41%), Gaps = 55/331 (16%)

Query: 18  KTLLAGAVSGLLARSITAPMDTIKIRLQLTPANGLKPFGS--QVMEVARSMIKNEGIRSF 75
           K+ LAG V+G  A+++ AP+D IKI  Q +  + +K  GS   ++     +   + +R  
Sbjct: 55  KSGLAGGVAGSCAKTLIAPLDRIKILFQTSNPHYVKYAGSFQGLLNAGVHIWSRDRLRGV 114

Query: 76  WKGNIPGSLLYVTYGSAQFSSYSLFNRYLTPFG-LEARLHSLVVGAFAGITSSIVSYPFD 134
           ++G+    L    Y + +F +Y      + P    E     L  G+ AG+ S   +YP D
Sbjct: 115 FQGHSATLLRIFPYAAVKFIAYEQIRNVIIPSKEYETHFRRLCSGSLAGLCSVFCTYPLD 174

Query: 135 VLRTRLVANNQMHSMSITREVRDIWKLEG---------LP-------GFFKGSIASMTTI 178
           ++R RL    + H + +   V+ I+             +P        F++G I ++  +
Sbjct: 175 LIRVRLAYVTEHHKVRVWPLVKQIYSEPASEALSSKAYVPKWFAQWCNFYRGYIPTVIGM 234

Query: 179 TLTASIMF---------------GTYETIRI-YCDENE-----KTTAAHKKWELATLNH- 216
              A + F                 Y  +R+   D ++     +TT   K+  L T    
Sbjct: 235 IPYAGVSFFAHDLFHDILRHPVIAPYSVLRVDDLDADDLKVDVQTTRTGKRIPLNTWAEL 294

Query: 217 SAGTIGGVIAKIITFPLETIRRRMQF--MNSKHLEKFSRHSSVYGSYKGYGFARIGLQIL 274
            AG + G+ ++   +P E IRRR+Q   + +    KF+  S +         A+I   I 
Sbjct: 295 LAGGLAGMASQTAAYPFEIIRRRLQVGAVTNPLEHKFTSMSEM---------AKI---IF 342

Query: 275 KQEGVSSLYRGILVALSKTIPTTFVSFWGYE 305
            + G    + G+ +   K  P    SF+ YE
Sbjct: 343 HERGWRGFFVGLSIGYIKVTPMVACSFFVYE 373

 Score = 49.7 bits (117), Expect = 1e-06,   Method: Compositional matrix adjust.
 Identities = 52/226 (23%), Positives = 96/226 (42%), Gaps = 47/226 (20%)

Query: 17  WKTLLAGAVSGLLARSITAPMDTIKIRLQ-LTPANGLK--PFGSQVM-EVARSMIKNEGI 72
           ++ L +G+++GL +   T P+D I++RL  +T  + ++  P   Q+  E A   + ++  
Sbjct: 153 FRRLCSGSLAGLCSVFCTYPLDLIRVRLAYVTEHHKVRVWPLVKQIYSEPASEALSSKAY 212

Query: 73  --------RSFWKGNIPGSLLYVTYGSAQFSSYSLFNRYL-----TPFG----------- 108
                    +F++G IP  +  + Y    F ++ LF+  L      P+            
Sbjct: 213 VPKWFAQWCNFYRGYIPTVIGMIPYAGVSFFAHDLFHDILRHPVIAPYSVLRVDDLDADD 272

Query: 109 LEARLHS--------------LVVGAFAGITSSIVSYPFDVLRTRL----VANNQMHSM- 149
           L+  + +              L+ G  AG+ S   +YPF+++R RL    V N   H   
Sbjct: 273 LKVDVQTTRTGKRIPLNTWAELLAGGLAGMASQTAAYPFEIIRRRLQVGAVTNPLEHKFT 332

Query: 150 SITREVRDIWKLEGLPGFFKGSIASMTTITLTASIMFGTYETIRIY 195
           S++   + I+   G  GFF G       +T   +  F  YE ++ Y
Sbjct: 333 SMSEMAKIIFHERGWRGFFVGLSIGYIKVTPMVACSFFVYERMKWY 378

 Score = 45.8 bits (107), Expect = 2e-05,   Method: Compositional matrix adjust.
 Identities = 48/210 (22%), Positives = 84/210 (40%), Gaps = 34/210 (16%)

Query: 113 LHSLVVGAFAGITSSIVSYPFDVLRTRLVANNQMHS------MSITREVRDIWKLEGLPG 166
           L S + G  AG  +  +  P D ++     +N  +         +      IW  + L G
Sbjct: 54  LKSGLAGGVAGSCAKTLIAPLDRIKILFQTSNPHYVKYAGSFQGLLNAGVHIWSRDRLRG 113

Query: 167 FFKGSIASMTTITLTASIMFGTYETIRIYCDENEKTTAAHKKWELATLNHSAGTIGGVIA 226
            F+G  A++  I   A++ F  YE IR             K++E       +G++ G+ +
Sbjct: 114 VFQGHSATLLRIFPYAAVKFIAYEQIR-------NVIIPSKEYETHFRRLCSGSLAGLCS 166

Query: 227 KIITFPLETIRRRMQFMNSKHLEK--------FSRHSSVYGSYKGY---GFARIGLQILK 275
              T+PL+ IR R+ ++   H  +        +S  +S   S K Y    FA+       
Sbjct: 167 VFCTYPLDLIRVRLAYVTEHHKVRVWPLVKQIYSEPASEALSSKAYVPKWFAQW------ 220

Query: 276 QEGVSSLYRGILVALSKTIPTTFVSFWGYE 305
                + YRG +  +   IP   VSF+ ++
Sbjct: 221 ----CNFYRGYIPTVIGMIPYAGVSFFAHD 246

 Score = 34.7 bits (78), Expect = 0.085,   Method: Compositional matrix adjust.
 Identities = 21/78 (26%), Positives = 41/78 (52%), Gaps = 3/78 (3%)

Query: 4   EEDSLRKGQNVA--AWKTLLAGAVSGLLARSITAPMDTIKIRLQLTPA-NGLKPFGSQVM 60
           +  + R G+ +    W  LLAG ++G+ +++   P + I+ RLQ+    N L+   + + 
Sbjct: 276 DVQTTRTGKRIPLNTWAELLAGGLAGMASQTAAYPFEIIRRRLQVGAVTNPLEHKFTSMS 335

Query: 61  EVARSMIKNEGIRSFWKG 78
           E+A+ +    G R F+ G
Sbjct: 336 EMAKIIFHERGWRGFFVG 353

>KLLA0F04697g complement(461126..462049) similar to sp|P40464
           Saccharomyces cerevisiae YIL134w FLX1 FAD carrier
           protein (MCF), mitochondrial, start by similarity
          Length = 307

 Score = 72.8 bits (177), Expect = 2e-14,   Method: Compositional matrix adjust.
 Identities = 77/316 (24%), Positives = 151/316 (47%), Gaps = 48/316 (15%)

Query: 18  KTLLAGAVSGLLARSITAPMDTIKIRLQLTPANGLKPFGSQVMEVARSMIKNEGIRSFWK 77
           K +++G  +G +   +T P+D IK+RLQL  A  LKP  S   +V R +    G +   K
Sbjct: 14  KEIISGLTAGTITTIVTHPLDLIKLRLQLA-AIDLKP-SSYYNQVQRIIKDGSGTQQLLK 71

Query: 78  G-------NIPGS-----LLYVTYGSAQFSSYSLF------NRYLTPFGLEARLHSLVVG 119
                   NI G+     L +  Y  ++   YSL       N+++    + + ++ +  G
Sbjct: 72  EAYRGLGINIIGNAVAWGLYFGLYRCSKDVVYSLSSEPALQNKFMNDRKMTSSMYLVSAG 131

Query: 120 AFAGITSSIVSYPFDVLRTRLVANNQMHS-MSITREVRDIWKLEGLPGFFKGSIASMTTI 178
           A +G+ +++++ P  V++TR+++        SI   +  I+  EGL  F++G + S+  +
Sbjct: 132 A-SGLATALLTNPMWVIKTRIMSTKSSQGYTSILNAITRIYTEEGLKTFWRGLVPSLFGV 190

Query: 179 TLTASIMFGTYETIRIYCDENEKTTAAHKKWELATLNHSAGTIGGV-IAKIIT----FPL 233
           T   ++ F  Y+T+++    +       +      LN +  TIG + ++K+I+    +PL
Sbjct: 191 T-QGALYFAIYDTLKLKYLHDRNDIQERR------LN-AVETIGIISLSKMISVSSVYPL 242

Query: 234 ETIRRRMQFMNSKHLEKFSRHSSVYGSYKGYGFARIGLQILKQEGVSSLYRGILVALSKT 293
           + ++  +Q   ++H E  S+ +S+  S            I    G++  Y+G+   L + 
Sbjct: 243 QLLKTNLQTFRTEHNEN-SKMNSLIRS------------IWHTNGIAGFYKGLFANLVRA 289

Query: 294 IPTTFVSFWGYETAIH 309
           IP+T ++F  YE   H
Sbjct: 290 IPSTCITFGVYEHFKH 305

>CAGL0L05742g complement(630844..631761) similar to sp|P10566
           Saccharomyces cerevisiae YJL133w MRS3 or sp|P23500
           Saccharomyces cerevisiae YKR052c MRS4, start by
           similarity
          Length = 305

 Score = 72.8 bits (177), Expect = 2e-14,   Method: Compositional matrix adjust.
 Identities = 72/300 (24%), Positives = 127/300 (42%), Gaps = 31/300 (10%)

Query: 20  LLAGAVSGLLARSITAPMDTIKIRLQLTPA---NGLKPFGSQVMEVARSMIKNEGIRSFW 76
           L+AGA +G+   S+  P+D +K RLQ   A    G +P  S ++    S+   EG    W
Sbjct: 22  LMAGAFAGIAEHSVIFPLDALKTRLQAMHAISTTGGQPIPSTMLRQLSSISAQEGSMVLW 81

Query: 77  KGNIPGSLLYVTYGSA-QFSSYSLFNRYLTPFGLEARLHSLVVGAFAGITSSIVS----Y 131
           KG +   LL      A  F++Y +   +L         +     AF+G T++I +     
Sbjct: 82  KG-VQSVLLGAGPAHAVYFATYEMVKSFLIDEATSTSKYHFFKTAFSGATATIAADALMN 140

Query: 132 PFDVLRTRLVANNQMHSMSITREVRDIWKLEGLPGFFKGSIASMTTITLTASIMFGTYET 191
           PFDV++ R+  N    ++S+    + I+  EG   F+     ++      A+  FG Y+T
Sbjct: 141 PFDVIKQRIQLNT---NISVWDTAKRIYSKEGFQAFYSSYPTTLAINIPFAAFNFGIYDT 197

Query: 192 IRIYCDENEKTTAAHKKWELATLNHSAGTIGGVIAKIITFPLETIRRRMQFMNSKH--LE 249
              Y +     +  +  +    ++   G I G     +T PL+ I+  +Q   S+   +E
Sbjct: 198 ATRYFNP----SGVYNPF----IHCLCGGISGAACAGLTTPLDCIKTALQVRGSEKVSME 249

Query: 250 KFSRHSSVYGSYKGYGFARIGLQILKQEGVSSLYRGILVALSKTIPTTFVSFWGYETAIH 309
            F +  +         F +    I +  G    + G+   +   +P T +S+  YE A H
Sbjct: 250 VFKQADT---------FKKATRAIYQVYGWRGFWSGVKPRILANMPATAISWTAYEFAKH 300

 Score = 59.3 bits (142), Expect = 7e-10,   Method: Compositional matrix adjust.
 Identities = 52/204 (25%), Positives = 90/204 (44%), Gaps = 35/204 (17%)

Query: 114 HSLVVGAFAGITSSIVSYPFDVLRTRLVANNQMHSMSIT----------REVRDIWKLEG 163
           H L+ GAFAGI    V +P D L+TRL A   MH++S T          R++  I   EG
Sbjct: 20  HQLMAGAFAGIAEHSVIFPLDALKTRLQA---MHAISTTGGQPIPSTMLRQLSSISAQEG 76

Query: 164 LPGFFKGSIASMTTITLTASIMFGTYETIRIYCDENEKTTAAHKKWELATLNHSAGTIGG 223
               +KG  + +       ++ F TYE ++ +  +   +T+ +  ++ A     +G    
Sbjct: 77  SMVLWKGVQSVLLGAGPAHAVYFATYEMVKSFLIDEATSTSKYHFFKTAF----SGATAT 132

Query: 224 VIAKIITFPLETIRRRMQFMNSKHLEKFSRHSSVYGSYKGYGFARIGLQILKQEGVSSLY 283
           + A  +  P + I++R+Q          + + SV+ + K         +I  +EG  + Y
Sbjct: 133 IAADALMNPFDVIKQRIQ---------LNTNISVWDTAK---------RIYSKEGFQAFY 174

Query: 284 RGILVALSKTIPTTFVSFWGYETA 307
                 L+  IP    +F  Y+TA
Sbjct: 175 SSYPTTLAINIPFAAFNFGIYDTA 198

 Score = 55.1 bits (131), Expect = 2e-08,   Method: Compositional matrix adjust.
 Identities = 38/162 (23%), Positives = 72/162 (44%), Gaps = 15/162 (9%)

Query: 17  WKTLLAGAVSGLLARSITAPMDTIKIRLQLTPANGLKPFGSQVMEVARSMIKNEGIRSFW 76
           +KT  +GA + + A ++  P D IK R+QL            V + A+ +   EG ++F+
Sbjct: 122 FKTAFSGATATIAADALMNPFDVIKQRIQLNT-------NISVWDTAKRIYSKEGFQAFY 174

Query: 77  KGNIPGSLLYVTYGSAQFSSYSLFNRYLTPFGLEARLHSLVVGAFAGITSSIVSYPFDVL 136
                   + + + +  F  Y    RY  P G+       + G  +G   + ++ P D +
Sbjct: 175 SSYPTTLAINIPFAAFNFGIYDTATRYFNPSGVYNPFIHCLCGGISGAACAGLTTPLDCI 234

Query: 137 RTRL-VANNQMHSMSITREV-------RDIWKLEGLPGFFKG 170
           +T L V  ++  SM + ++        R I+++ G  GF+ G
Sbjct: 235 KTALQVRGSEKVSMEVFKQADTFKKATRAIYQVYGWRGFWSG 276

 Score = 34.3 bits (77), Expect = 0.087,   Method: Compositional matrix adjust.
 Identities = 25/96 (26%), Positives = 45/96 (46%), Gaps = 19/96 (19%)

Query: 20  LLAGAVSGLLARSITAPMDTIKIRLQLTPANGLKPFGSQVMEVA-------RSMIKNEGI 72
            L G +SG     +T P+D IK  LQ+    G +    +V + A       R++ +  G 
Sbjct: 214 CLCGGISGAACAGLTTPLDCIKTALQV---RGSEKVSMEVFKQADTFKKATRAIYQVYGW 270

Query: 73  RSFWKG-------NIPGSLLYVTYGSAQFSSYSLFN 101
           R FW G       N+P +   +++ + +F+ + LF+
Sbjct: 271 RGFWSGVKPRILANMPATA--ISWTAYEFAKHFLFH 304

>AGL065C [4246] [Homologous to ScYHR002W (LEU5) - SH]
           (585963..586970) [1008 bp, 335 aa]
          Length = 335

 Score = 72.4 bits (176), Expect = 3e-14,   Method: Compositional matrix adjust.
 Identities = 71/321 (22%), Positives = 133/321 (41%), Gaps = 47/321 (14%)

Query: 18  KTLLAGAVSGLLARSITAPMDTIKIRLQLTPANGLKPFGSQ--VMEVARSMIKNEGIRSF 75
           K+ LAG ++G  A+++ AP+D IKI  Q +     +  GS   ++  ++ ++ ++G R F
Sbjct: 21  KSGLAGGIAGSCAKTLVAPLDRIKILFQTSNPQFAQFAGSMGGLVRASKYIMAHDGPRGF 80

Query: 76  WKGNIPGSLLYVTYGSAQFSSYSLFNRYLTP-FGLEARLHSLVVGAFAGITSSIVSYPFD 134
           ++G+    L    Y + +F +Y      + P +  E+    L+ G+ AG+ S  V+YP D
Sbjct: 81  FQGHSATLLRIFPYAAIKFIAYEQIRSVVIPTWRHESHWRRLLSGSLAGLCSVFVTYPLD 140

Query: 135 VLRTRLVANNQMHSMSITREVRDIWK---------------LEGLPGFFKGSIASMTTIT 179
           ++R RL    + H   + + +  I+                      F++G   ++  + 
Sbjct: 141 LVRVRLAYVTERHDAKVRKIMACIYNERPSEALRKWYIPQWFAHWSNFYRGYTPTVIGMI 200

Query: 180 LTASIMFGTYETIRIYCDENEK--------------TTAAHKKWELATLNH-SAGTIGGV 224
             A + F  ++     C +  +              ++A  +   L T     AG + G+
Sbjct: 201 PYAGVSFFAHDL----CQDIFRHPMLEPYSVLSPGGSSAYDRTVPLKTWAQLVAGGLAGM 256

Query: 225 IAKIITFPLETIRRRMQFMNSKHLEKFSRHSSVYGSYKGYGFARIGLQILKQEGVSSLYR 284
            ++   +P E IRRR+Q   S   +   RH          G   I   I  + G    + 
Sbjct: 257 ASQTAAYPFEIIRRRLQV--SAITDPTRRHFV--------GINEIAKIIYTEGGWRGFFV 306

Query: 285 GILVALSKTIPTTFVSFWGYE 305
           G+ +   K  P    SF+ YE
Sbjct: 307 GLSIGYIKVTPMVACSFFIYE 327

 Score = 55.8 bits (133), Expect = 1e-08,   Method: Compositional matrix adjust.
 Identities = 51/216 (23%), Positives = 91/216 (42%), Gaps = 39/216 (18%)

Query: 17  WKTLLAGAVSGLLARSITAPMDTIKIRLQ-LTPANGLKPFGSQVMEVARSMIKNEGIR-- 73
           W+ LL+G+++GL +  +T P+D +++RL  +T  +  K    ++M    +   +E +R  
Sbjct: 119 WRRLLSGSLAGLCSVFVTYPLDLVRVRLAYVTERHDAKV--RKIMACIYNERPSEALRKW 176

Query: 74  ----------SFWKGNIPGSLLYVTYGSAQFSSYSLFNR-----------YLTPFGLEAR 112
                     +F++G  P  +  + Y    F ++ L               L+P G  A 
Sbjct: 177 YIPQWFAHWSNFYRGYTPTVIGMIPYAGVSFFAHDLCQDIFRHPMLEPYSVLSPGGSSAY 236

Query: 113 LHS--------LVVGAFAGITSSIVSYPFDVLRTRLVAN-----NQMHSMSITREVRDIW 159
             +        LV G  AG+ S   +YPF+++R RL  +      + H + I    + I+
Sbjct: 237 DRTVPLKTWAQLVAGGLAGMASQTAAYPFEIIRRRLQVSAITDPTRRHFVGINEIAKIIY 296

Query: 160 KLEGLPGFFKGSIASMTTITLTASIMFGTYETIRIY 195
              G  GFF G       +T   +  F  YE  + Y
Sbjct: 297 TEGGWRGFFVGLSIGYIKVTPMVACSFFIYERTKWY 332

>Kwal_27.12481
          Length = 304

 Score = 72.0 bits (175), Expect = 3e-14,   Method: Compositional matrix adjust.
 Identities = 65/285 (22%), Positives = 128/285 (44%), Gaps = 41/285 (14%)

Query: 20  LLAGAVSGLLARSITAPMDTIKIRLQ----LTPANGLKPFGSQVMEVARSMIKNEGIRSF 75
            L G VS  ++++  AP++ +K+ +Q    +     L    + + E  +    NEGI SF
Sbjct: 14  FLMGGVSAAVSKTAAAPIERVKLLIQNQDEMIKQGSLDRRYTGIGECFKRTAANEGIASF 73

Query: 76  WKGNIPGSLLYVTYGSAQFSSYSLFNRYLTPFGLEAR-------LHSLVVGAFAGITSSI 128
           W+GN    + Y      Q  +++  ++    FG +           +L  G  AG  S +
Sbjct: 74  WRGNTANVIRYFP---TQALNFAFKDKIKAMFGFKKEEGYAKWFAGNLASGGAAGGLSLM 130

Query: 129 VSYPFDVLRTRLVANNQMHSMSITREVR---DIWKL----EGLPGFFKGSIASMTTITLT 181
             Y  D  RTRL A+++       R+     D++K     +G+ G ++G + S+  I + 
Sbjct: 131 FVYSLDYARTRLAADSKGAKKGGERQFNGLVDVYKKTLASDGIAGLYRGFLPSVVGIVVY 190

Query: 182 ASIMFGTYETIRIYCDENEKTTAAHKKWELATLNHSAGTIGGVIAKIITFPLETIRRRMQ 241
             + FG Y++++        T +    +  + L   A T G   A   ++PL+T+RRRM 
Sbjct: 191 RGLYFGGYDSLKPLL----LTGSLEGSFLASFLLGWAVTTG---ASTASYPLDTVRRRMM 243

Query: 242 FMNSKHLEKFSRHSSVYGSYKGYGFARIGLQILKQEGVSSLYRGI 286
             + + +    +++  + +++         +I+  EG+ SL++G 
Sbjct: 244 MTSGQAV----KYNGAFDAFR---------KIVAAEGIKSLFKGC 275

 Score = 35.0 bits (79), Expect = 0.049,   Method: Compositional matrix adjust.
 Identities = 44/202 (21%), Positives = 85/202 (42%), Gaps = 24/202 (11%)

Query: 115 SLVVGAFAGITSSIVSYPFDVLRTRLVANNQ---MHSMSITREVRDIWKL-------EGL 164
             ++G  +   S   + P +  R +L+  NQ   +   S+ R    I +        EG+
Sbjct: 13  DFLMGGVSAAVSKTAAAPIE--RVKLLIQNQDEMIKQGSLDRRYTGIGECFKRTAANEGI 70

Query: 165 PGFFKGSIASMTTITLTASIMFGTYETIRIYCDENEKTTAAHKKWELATLNHSAGTIGGV 224
             F++G+ A++     T ++ F   + I+       K    + KW    L  S G  GG 
Sbjct: 71  ASFWRGNTANVIRYFPTQALNFAFKDKIKAMF--GFKKEEGYAKWFAGNL-ASGGAAGG- 126

Query: 225 IAKIITFPLETIRRRMQFMNSKHLEKFSRHSSVYGSYKGYGFARIGLQILKQEGVSSLYR 284
           ++ +  + L+  R R+   +SK  +K        G  +  G   +  + L  +G++ LYR
Sbjct: 127 LSLMFVYSLDYARTRLA-ADSKGAKK-------GGERQFNGLVDVYKKTLASDGIAGLYR 178

Query: 285 GILVALSKTIPTTFVSFWGYET 306
           G L ++   +    + F GY++
Sbjct: 179 GFLPSVVGIVVYRGLYFGGYDS 200

>KLLA0D07073g 606857..607750 similar to sp|Q03028 Saccharomyces
           cerevisiae YPL134c ODC1, start by similarity
          Length = 297

 Score = 71.6 bits (174), Expect = 4e-14,   Method: Compositional matrix adjust.
 Identities = 67/272 (24%), Positives = 122/272 (44%), Gaps = 22/272 (8%)

Query: 20  LLAGAVSGLLARSITAPMDTIKIRLQLTPANGLKPFGSQVMEVARSMIKNEGIRSFWKGN 79
            +AGAV+G+    +  P+D +K  +QL  + G  P    V +  + +   EG    +KG 
Sbjct: 13  FMAGAVAGVSEILVMYPLDMVKTVMQLQVSGGSGPQYKGVFDCLKQIAAKEGPSRLYKGI 72

Query: 80  IPGSLLYVTYGSAQFSSYSLFNR-YLTPFGLEARLHSLVV--GAFAGITSSIVSYPFDVL 136
               L+     + +F+    F + Y   FG E     L +  GA AGI  S V  PF+++
Sbjct: 73  SSPILMEAPKRATKFACNDEFQKIYKDLFGAEKLTQPLSILSGASAGICESFVVVPFELV 132

Query: 137 RTRLVANNQMHSMSITREVRDIWKLEGLPGFFKGSIASMTTITLTASIMFGTYETIRIYC 196
           + RL   +   +  I   V++I + EG+   + G  ++M    +  +  FG    +R   
Sbjct: 133 KIRLQDVSSKFTSPIAV-VKNIVEKEGILAMYNGLESTMWRHGIWNAGYFGIIFQVRALL 191

Query: 197 DENEKTTAAHKKWELATLNHSAGTIGGVIAKIITFPLETIRRRMQFMNSKHLEKFSRHSS 256
            +      A  K E    +  AGT+GG ++ +++ P + ++ R+Q             + 
Sbjct: 192 PK------ASTKSEQTRNDLLAGTVGGTLSSLLSTPFDVVKSRVQ-----------NTAV 234

Query: 257 VYGSYKGYGFARIGLQ-ILKQEGVSSLYRGIL 287
           + G  + Y ++   L  I K+EG  +LY+G +
Sbjct: 235 IPGVPRKYNWSWPALATIYKEEGFKALYKGFV 266

 Score = 45.1 bits (105), Expect = 3e-05,   Method: Compositional matrix adjust.
 Identities = 40/167 (23%), Positives = 77/167 (46%), Gaps = 18/167 (10%)

Query: 19  TLLAGAVSGLLARSITAPMDTIKIRLQLTPANGLKPFGSQVMEVARSMIKNEGIRSFWKG 78
           ++L+GA +G+    +  P + +KIRLQ   +    P     + V +++++ EGI + + G
Sbjct: 111 SILSGASAGICESFVVVPFELVKIRLQDVSSKFTSP-----IAVVKNIVEKEGILAMYNG 165

Query: 79  NIPGSLLYVTYGSAQFSSYSLFNRYLTPFG---LEARLHSLVVGAFAGITSSIVSYPFDV 135
            +  ++      +A +       R L P      E   + L+ G   G  SS++S PFDV
Sbjct: 166 -LESTMWRHGIWNAGYFGIIFQVRALLPKASTKSEQTRNDLLAGTVGGTLSSLLSTPFDV 224

Query: 136 LRTRLVANNQMHSMSITRE-------VRDIWKLEGLPGFFKGSIASM 175
           +++R+   N      + R+       +  I+K EG    +KG +  +
Sbjct: 225 VKSRV--QNTAVIPGVPRKYNWSWPALATIYKEEGFKALYKGFVPKV 269

 Score = 35.0 bits (79), Expect = 0.051,   Method: Compositional matrix adjust.
 Identities = 40/181 (22%), Positives = 76/181 (41%), Gaps = 31/181 (17%)

Query: 113 LHSLVVGAFAGITSSIVSYPFDVLRTRLVANNQMHSMSITREVRDIWKL----EGLPGFF 168
           ++  + GA AG++  +V YP D+++T +       S    + V D  K     EG    +
Sbjct: 10  VYQFMAGAVAGVSEILVMYPLDMVKTVMQLQVSGGSGPQYKGVFDCLKQIAAKEGPSRLY 69

Query: 169 KGSIASMTTITLTASIMFGTYETI-RIYCD--ENEKTTAAHKKWELATLNHSAGTIGGVI 225
           KG  + +       +  F   +   +IY D    EK T          L+  +G   G+ 
Sbjct: 70  KGISSPILMEAPKRATKFACNDEFQKIYKDLFGAEKLTQP--------LSILSGASAGIC 121

Query: 226 AKIITFPLETIRRRMQFMNSKHLEKFSRHSSVYGSYKGYGFARIGLQILKQEGVSSLYRG 285
              +  P E ++ R+Q ++S    KF+   +V  +            I+++EG+ ++Y G
Sbjct: 122 ESFVVVPFELVKIRLQDVSS----KFTSPIAVVKN------------IVEKEGILAMYNG 165

Query: 286 I 286
           +
Sbjct: 166 L 166

>AGR383W [4694] [Homologous to ScYDL119C - SH]
           complement(1436769..1437650) [882 bp, 293 aa]
          Length = 293

 Score = 71.6 bits (174), Expect = 4e-14,   Method: Compositional matrix adjust.
 Identities = 75/308 (24%), Positives = 127/308 (41%), Gaps = 55/308 (17%)

Query: 20  LLAGAVSGLLARSITAPMDTIKIRLQLTPANGLKPFGSQVMEVARSMIKNEGIRSFWKGN 79
           L++G   GL +     P+D +K RLQ   A+ L+     V+   R+       R  W+G 
Sbjct: 12  LVSGFFGGLASVCALQPLDLLKTRLQQAQASSLR----SVLREVRT------TRELWRGT 61

Query: 80  IPGSLLYVTYGSAQFSSYSLFNRYLTPFGLEARLHS-----------LVVGAFAGITSSI 128
           +P S L  + GSA + S   ++R     G EAR  S           L+ GA +     +
Sbjct: 62  LP-SALRTSIGSALYLSLLNYSRSALARGSEARTRSSLLPRLQSYQNLLTGALSRAAVGL 120

Query: 129 VSYPFDVLRTRLVANNQMHSMSITREVRDIWKLEGLPGFFKGSIASMTTITLTASIMFGT 188
           V+ P  V++ R  +    ++  +    R IW+ EG  GFFKG+ A+       A +    
Sbjct: 121 VTMPITVIKVRYESTLYAYN-GLAEATRHIWRSEGARGFFKGAAATTLRDAPYAGLYVLL 179

Query: 189 YETIR-----------IYCDENEKTTAAHKKWELATLNHSAGTIGGVIAKIITFPLETIR 237
           YE  +           +  DE+ K TA       A +N  +  +   +A  +T P +TI+
Sbjct: 180 YEQAKEMLPRALPATLLGADESGKLTAPAS----AMVNGVSAFLSASLATTLTAPFDTIK 235

Query: 238 RRMQFMNSKHLEKFSRHSSVYGSYKGYGFARIGLQILKQEGVSSLYRGILVALSKTIPTT 297
            RMQ  +                    GF +    I+ +E   +L+ G+ + L +   + 
Sbjct: 236 TRMQLQSHP-----------------VGFVQTLRHIVCEERARTLFDGLSLRLCRKAMSA 278

Query: 298 FVSFWGYE 305
            +++  YE
Sbjct: 279 CIAWGIYE 286

 Score = 47.8 bits (112), Expect = 4e-06,   Method: Compositional matrix adjust.
 Identities = 51/195 (26%), Positives = 83/195 (42%), Gaps = 28/195 (14%)

Query: 16  AWKTLLAGAVSGLLARSITAPMDTIKIRLQ--LTPANGLKPFGSQVMEVARSMIKNEGIR 73
           +++ LL GA+S      +T P+  IK+R +  L   NGL        E  R + ++EG R
Sbjct: 104 SYQNLLTGALSRAAVGLVTMPITVIKVRYESTLYAYNGLA-------EATRHIWRSEGAR 156

Query: 74  SFWKGNIPGSLLYVTYGSAQFSSYSLFNRYLTPFGLEARL-------------HSLVVGA 120
            F+KG    +L    Y       Y      L P  L A L              ++V G 
Sbjct: 157 GFFKGAAATTLRDAPYAGLYVLLYEQAKEML-PRALPATLLGADESGKLTAPASAMVNGV 215

Query: 121 FAGITSSI---VSYPFDVLRTRLVANNQMHSMSITREVRDIWKLEGLPGFFKGSIASMTT 177
            A +++S+   ++ PFD ++TR+    Q H +   + +R I   E     F G    +  
Sbjct: 216 SAFLSASLATTLTAPFDTIKTRM--QLQSHPVGFVQTLRHIVCEERARTLFDGLSLRLCR 273

Query: 178 ITLTASIMFGTYETI 192
             ++A I +G YE +
Sbjct: 274 KAMSACIAWGIYEEL 288

>KLLA0D14036g complement(1203522..1204817) some similarities with
           sp|P40556 Saccharomyces cerevisiae YIL006w, hypothetical
           start
          Length = 431

 Score = 72.4 bits (176), Expect = 4e-14,   Method: Compositional matrix adjust.
 Identities = 88/333 (26%), Positives = 145/333 (43%), Gaps = 72/333 (21%)

Query: 19  TLLAGAVSGLLARSITAPMDTIKIRLQLTPANGLK---PFGSQVMEVA------------ 63
           T L+GA++G LA  I  P+D  K RLQ   A GL+   P    V  VA            
Sbjct: 106 TALSGALAGFLAGVIVCPLDVAKTRLQ---AQGLQLNGPVTRPVGSVATTFGGKYYSGIW 162

Query: 64  ---RSMIKNEGIRSFWKGNIPGSLLYVTYGSAQFSSYSL----FNRYLTPFGLEARLHSL 116
               +++++E IR  +KG +P  L Y       FS Y      + RY   F     L   
Sbjct: 163 GTLTTIVRDESIRGLYKGIVPIVLGYFPTWMIYFSVYERCKLSYPRY---FNNSEFLSHS 219

Query: 117 VVGAFAGITSSIVSYPFDVLRTRLV--ANNQMHSMSITREVRD----IWKLEGLPGFFKG 170
           +    AG  S+ ++ P  V++TRL+  +   +  M+  +   D    I+K+EG+  F+ G
Sbjct: 220 MSALTAGAISTTLTNPIWVVKTRLMLQSGKNIKGMTHYKNTLDAFIKIYKVEGIKSFYSG 279

Query: 171 SIASMTTITLTASIMFGTYETIR--IYC---------------DENEKTTAAHKKWELAT 213
            I S+  + L  +I F  YE ++  ++C               + N +TT +   ++L  
Sbjct: 280 LIPSLFGL-LHVAIHFPVYEKLKKVLHCYPSGRPNQETMNVNGNSNPQTTGS-TNFQLGR 337

Query: 214 L-NHSAGTIGGVIAKIITFPLETIRRRMQFMNSKHLEKFSRHSSVYGSYKGYGFARIGLQ 272
           L   S G+   +IA  +T+P E +R R+Q    K   K S  S +  +Y           
Sbjct: 338 LIVASCGS--KMIASTLTYPHEILRTRLQL---KSDMKPSIKSIIRTTY----------- 381

Query: 273 ILKQEGVSSLYRGILVALSKTIPTTFVSFWGYE 305
              +EG+   Y G L  + +T+P + ++   +E
Sbjct: 382 --AKEGIRGFYSGFLTNMFRTVPASAITLVSFE 412

 Score = 50.8 bits (120), Expect = 6e-07,   Method: Compositional matrix adjust.
 Identities = 47/198 (23%), Positives = 86/198 (43%), Gaps = 27/198 (13%)

Query: 21  LAGAVSGLLARSITAPMDTIKIRLQLTPANGLKPFG--SQVMEVARSMIKNEGIRSFWKG 78
           ++   +G ++ ++T P+  +K RL L     +K        ++    + K EGI+SF+ G
Sbjct: 220 MSALTAGAISTTLTNPIWVVKTRLMLQSGKNIKGMTHYKNTLDAFIKIYKVEGIKSFYSG 279

Query: 79  NIPGSLLYVTYGSAQFSSYSLFNRYL----------------------TPFGLEARLHSL 116
            IP SL  + + +  F  Y    + L                      T      +L  L
Sbjct: 280 LIP-SLFGLLHVAIHFPVYEKLKKVLHCYPSGRPNQETMNVNGNSNPQTTGSTNFQLGRL 338

Query: 117 VVGAFAG-ITSSIVSYPFDVLRTRLVANNQMHSMSITREVRDIWKLEGLPGFFKGSIASM 175
           +V +    + +S ++YP ++LRTRL   + M   SI   +R  +  EG+ GF+ G + +M
Sbjct: 339 IVASCGSKMIASTLTYPHEILRTRLQLKSDMKP-SIKSIIRTTYAKEGIRGFYSGFLTNM 397

Query: 176 TTITLTASIMFGTYETIR 193
                 ++I   ++E  R
Sbjct: 398 FRTVPASAITLVSFEYFR 415

 Score = 35.0 bits (79), Expect = 0.073,   Method: Compositional matrix adjust.
 Identities = 22/92 (23%), Positives = 43/92 (46%), Gaps = 5/92 (5%)

Query: 13  NVAAWKTLLAGAVSGLLARSITAPMDTIKIRLQLTPANGLKPFGSQVMEVARSMIKNEGI 72
           N    + ++A   S ++A ++T P + ++ RLQL   + +KP    +  + R+    EGI
Sbjct: 332 NFQLGRLIVASCGSKMIASTLTYPHEILRTRLQL--KSDMKP---SIKSIIRTTYAKEGI 386

Query: 73  RSFWKGNIPGSLLYVTYGSAQFSSYSLFNRYL 104
           R F+ G +      V   +    S+  F ++ 
Sbjct: 387 RGFYSGFLTNMFRTVPASAITLVSFEYFRKHF 418

>CAGL0J02002g 198226..199311 similar to sp|P40556 Saccharomyces
           cerevisiae YIL006w or sp|P39953 Saccharomyces cerevisiae
           YEL006w, hypothetical start
          Length = 361

 Score = 72.0 bits (175), Expect = 4e-14,   Method: Compositional matrix adjust.
 Identities = 72/302 (23%), Positives = 138/302 (45%), Gaps = 39/302 (12%)

Query: 21  LAGAVSGLLARSITAPMDTIKIRLQLTPANGLKPFGSQVME------VARSMIKNEGIRS 74
           ++GA++GLL+  +  P+D  K RLQ   A GL+   ++ +          +++++EG+R 
Sbjct: 73  ISGALAGLLSGIVVCPLDVAKTRLQ---AQGLQTRTTENLYYRGSIGTMTTIVRDEGVRG 129

Query: 75  FWKGNIPGSLLYVTYGSAQFSSYSLFNRYLTPFGLEARLHSLVVGAFAGIT----SSIVS 130
            +KG +P  + Y       FS Y      L      +   S V  +F+ IT    S++V+
Sbjct: 130 LYKGLVPIIMGYFPTWMIYFSVYEFCKDNLR---TNSSNWSFVSHSFSAITAGAVSTVVT 186

Query: 131 YPFDVLRTRL-----VANNQMHSMSITREVRDIWKLEGLPGFFKGSIASMTTITLTASIM 185
            P  V++TRL     + +N  H        + I   EG+   + G + S+  + L  +I 
Sbjct: 187 NPIWVVKTRLMLQTHIGSNTTHYQGTYDAFKKIINQEGVKALYAGLVPSLLGL-LHVAIH 245

Query: 186 FGTYETIRI--YCDENEKTTAAHKKWELATLNHSAGTIGGVIAKIITFPLETIRRRMQFM 243
           F  YE +++   C + +++ +   K  L  L   A ++  ++A ++++P E +R R+Q  
Sbjct: 246 FPVYERLKVSFKCYQRDES-SNESKINLKRL-ILASSVSKMVASVLSYPHEILRTRLQL- 302

Query: 244 NSKHLEKFSRHSSVYGSYKGYGFARIGLQILKQEGVSSLYRGILVALSKTIPTTFVSFWG 303
                       S   S++      I +  + QEG+   Y G    L +T+P + ++   
Sbjct: 303 -----------KSDLPSHQRRLIPLIKITYI-QEGIFGFYSGFGTNLFRTLPASAITLVS 350

Query: 304 YE 305
           +E
Sbjct: 351 FE 352

 Score = 63.9 bits (154), Expect = 2e-11,   Method: Compositional matrix adjust.
 Identities = 59/195 (30%), Positives = 93/195 (47%), Gaps = 32/195 (16%)

Query: 107 FGLEARLHSLVVGAFAGITSSIVSYPFDVLRTRLVAN--------NQMHSMSI---TREV 155
           F L     + + GA AG+ S IV  P DV +TRL A         N  +  SI   T  V
Sbjct: 63  FTLNDNRINAISGALAGLLSGIVVCPLDVAKTRLQAQGLQTRTTENLYYRGSIGTMTTIV 122

Query: 156 RDIWKLEGLPGFFKGSIASMTTITLTASIMFGTYETIRIYCDENEKTTAAHKKWELATLN 215
           RD    EG+ G +KG +  +     T  I F  YE    +C +N +T +++  W   + +
Sbjct: 123 RD----EGVRGLYKGLVPIIMGYFPTWMIYFSVYE----FCKDNLRTNSSN--WSFVSHS 172

Query: 216 HSAGTIGGVIAKIITFPLETIRRRMQFMNSKHLEKFSRHSSVYGSYKGYGFARIGLQILK 275
            SA T G V + ++T P+  ++ R+  M   H+   + H    G+Y  +       +I+ 
Sbjct: 173 FSAITAGAV-STVVTNPIWVVKTRL--MLQTHIGSNTTHYQ--GTYDAFK------KIIN 221

Query: 276 QEGVSSLYRGILVAL 290
           QEGV +LY G++ +L
Sbjct: 222 QEGVKALYAGLVPSL 236

 Score = 48.5 bits (114), Expect = 3e-06,   Method: Compositional matrix adjust.
 Identities = 44/194 (22%), Positives = 94/194 (48%), Gaps = 16/194 (8%)

Query: 16  AWKTLLAGAVSGLLARSITAPMDTIKIRLQLTPANGLKPFGSQ-VMEVARSMIKNEGIRS 74
           ++  + AGAVS +    +T P+  +K RL L    G      Q   +  + +I  EG+++
Sbjct: 172 SFSAITAGAVSTV----VTNPIWVVKTRLMLQTHIGSNTTHYQGTYDAFKKIINQEGVKA 227

Query: 75  FWKGNIPGSLLYVTYGSAQFS-------SYSLFNRYLTPFGLEARLHSLVVGA-FAGITS 126
            + G +P SLL + + +  F        S+  + R  +    +  L  L++ +  + + +
Sbjct: 228 LYAGLVP-SLLGLLHVAIHFPVYERLKVSFKCYQRDESSNESKINLKRLILASSVSKMVA 286

Query: 127 SIVSYPFDVLRTRLVANNQM--HSMSITREVRDIWKLEGLPGFFKGSIASMTTITLTASI 184
           S++SYP ++LRTRL   + +  H   +   ++  +  EG+ GF+ G   ++      ++I
Sbjct: 287 SVLSYPHEILRTRLQLKSDLPSHQRRLIPLIKITYIQEGIFGFYSGFGTNLFRTLPASAI 346

Query: 185 MFGTYETIRIYCDE 198
              ++E +R + ++
Sbjct: 347 TLVSFEYVRNFLNK 360

 Score = 33.9 bits (76), Expect = 0.14,   Method: Compositional matrix adjust.
 Identities = 23/92 (25%), Positives = 45/92 (48%), Gaps = 8/92 (8%)

Query: 214 LNHSAGTIGGVIAKIITFPLETIRRRMQFMNSKHLEKFSRHSSVYGSYKGYGFARIGLQI 273
           +N  +G + G+++ I+  PL+  + R+Q   ++ L+  +  +  Y    G         I
Sbjct: 70  INAISGALAGLLSGIVVCPLDVAKTRLQ---AQGLQTRTTENLYYRGSIG-----TMTTI 121

Query: 274 LKQEGVSSLYRGILVALSKTIPTTFVSFWGYE 305
           ++ EGV  LY+G++  +    PT  + F  YE
Sbjct: 122 VRDEGVRGLYKGLVPIIMGYFPTWMIYFSVYE 153

>ACR260W [1307] [Homologous to ScYJL133W (MRS3) - SH; ScYKR052C
           (MRS4) - SH] complement(823895..824830) [936 bp, 311 aa]
          Length = 311

 Score = 71.6 bits (174), Expect = 5e-14,   Method: Compositional matrix adjust.
 Identities = 72/298 (24%), Positives = 129/298 (43%), Gaps = 28/298 (9%)

Query: 20  LLAGAVSGLLARSITAPMDTIKIRLQLTPANGLKP---FGSQVMEVARSMIKNEGIRSFW 76
           L AGA +G++  SI  P+D IK R+Q     G        S ++     +   EG  + W
Sbjct: 21  LAAGAFAGIMEHSIMFPIDAIKTRMQAVSTTGSSAATRLPSNMLAQIAKISTTEGSLALW 80

Query: 77  KGNIPGSLLYVTYGSAQFSSYSLF-NRYLTPFGLEAR--LHSLVVGAFAGITSSIVSYPF 133
           KG     L      +  F++Y +  +R + P   +    L + + G  A + +  +  PF
Sbjct: 81  KGVQSVVLGAGPAHAVYFATYEMCKSRLIDPEDRQTHQPLKTALSGTLATVAADALMNPF 140

Query: 134 DVLRTRLVANNQMH-SMSITREVRDIWKLEGLPGFFKGSIASMTTITLTASIMFGTYE-T 191
           D ++ RL    Q+H S S+T+    +++ EG+  FF     ++      A++ F  YE +
Sbjct: 141 DTIKQRL----QLHPSDSMTKCAVRMYQREGIAAFFYSYPTTIAMNIPFAALNFVIYESS 196

Query: 192 IRIYCDENEKTTAAHKKWELATLNHSAGTIGGVIAKIITFPLETIRRRMQFMNSKHLEKF 251
            +I+   N      +  W    ++   G I G     IT PL+ ++  +Q   +  ++  
Sbjct: 197 TKIFNPSNN-----YNPW----IHCLCGGISGATCAAITTPLDCVKTVLQIRGADSVQ-- 245

Query: 252 SRHSSVYGSYKGYGFARIGLQILKQEGVSSLYRGILVALSKTIPTTFVSFWGYETAIH 309
              S ++   +   F +    I K  G S  +RG+   +   +P T +S+  YE A H
Sbjct: 246 ---SQLFK--EADTFRKAASAIHKTYGWSGFFRGLKPRIISNMPATAISWTSYEFAKH 298

 Score = 57.4 bits (137), Expect = 3e-09,   Method: Compositional matrix adjust.
 Identities = 47/204 (23%), Positives = 91/204 (44%), Gaps = 34/204 (16%)

Query: 113 LHSLVVGAFAGITSSIVSYPFDVLRTRLVANNQMHSMSITR-------EVRDIWKLEGLP 165
           ++ L  GAFAGI    + +P D ++TR+ A +   S + TR       ++  I   EG  
Sbjct: 18  VYQLAAGAFAGIMEHSIMFPIDAIKTRMQAVSTTGSSAATRLPSNMLAQIAKISTTEGSL 77

Query: 166 GFFKGSIASMTTITLTASIMFGTYETI--RIYCDENEKTTAAHKKWELATLNHSAGTIGG 223
             +KG  + +       ++ F TYE    R+   E+ +T   H+  + A     +GT+  
Sbjct: 78  ALWKGVQSVVLGAGPAHAVYFATYEMCKSRLIDPEDRQT---HQPLKTAL----SGTLAT 130

Query: 224 VIAKIITFPLETIRRRMQFMNSKHLEKFSRHSSVYGSYKGYGFARIGLQILKQEGVSSLY 283
           V A  +  P +TI++R+Q   S  + K                    +++ ++EG+++ +
Sbjct: 131 VAADALMNPFDTIKQRLQLHPSDSMTK------------------CAVRMYQREGIAAFF 172

Query: 284 RGILVALSKTIPTTFVSFWGYETA 307
                 ++  IP   ++F  YE++
Sbjct: 173 YSYPTTIAMNIPFAALNFVIYESS 196

 Score = 52.4 bits (124), Expect = 1e-07,   Method: Compositional matrix adjust.
 Identities = 51/191 (26%), Positives = 88/191 (46%), Gaps = 35/191 (18%)

Query: 18  KTLLAGAVSGLLARSITAPMDTIKIRLQLTPANGLKPFGSQVMEVARSMIKNEGIRSFWK 77
           KT L+G ++ + A ++  P DTIK RLQL P++ +        + A  M + EGI +F+ 
Sbjct: 121 KTALSGTLATVAADALMNPFDTIKQRLQLHPSDSMT-------KCAVRMYQREGIAAFFY 173

Query: 78  G-------NIP-GSLLYVTYGSAQ--FSSYSLFNRYLTPFGLEARLHSLVVGAFAGITSS 127
                   NIP  +L +V Y S+   F+  + +N +         +H L  G  +G T +
Sbjct: 174 SYPTTIAMNIPFAALNFVIYESSTKIFNPSNNYNPW---------IHCL-CGGISGATCA 223

Query: 128 IVSYPFDVLRTRL------VANNQMHSMSIT--REVRDIWKLEGLPGFFKGSIASMTTIT 179
            ++ P D ++T L         +Q+   + T  +    I K  G  GFF+G    + +  
Sbjct: 224 AITTPLDCVKTVLQIRGADSVQSQLFKEADTFRKAASAIHKTYGWSGFFRGLKPRIISNM 283

Query: 180 LTASIMFGTYE 190
              +I + +YE
Sbjct: 284 PATAISWTSYE 294

 Score = 36.6 bits (83), Expect = 0.021,   Method: Compositional matrix adjust.
 Identities = 27/107 (25%), Positives = 49/107 (45%), Gaps = 19/107 (17%)

Query: 8   LRKGQNVAAWKTLLAGAVSGLLARSITAPMDTIKIRLQLTPANGLKPFGSQVM------- 60
                N   W   L G +SG    +IT P+D +K  LQ+  A+ ++   SQ+        
Sbjct: 200 FNPSNNYNPWIHCLCGGISGATCAAITTPLDCVKTVLQIRGADSVQ---SQLFKEADTFR 256

Query: 61  EVARSMIKNEGIRSFWKG-------NIPGSLLYVTYGSAQFSSYSLF 100
           + A ++ K  G   F++G       N+P +   +++ S +F+ + LF
Sbjct: 257 KAASAIHKTYGWSGFFRGLKPRIISNMPATA--ISWTSYEFAKHLLF 301

>Sklu_2431.5 YBR192W, Contig c2431 8526-9638
          Length = 370

 Score = 71.6 bits (174), Expect = 6e-14,   Method: Compositional matrix adjust.
 Identities = 90/352 (25%), Positives = 157/352 (44%), Gaps = 70/352 (19%)

Query: 3   KEEDSLRKGQNVAAWKTLLAGAVSGLLARSITAPMDTIKIRLQ--------------LTP 48
           + + S +  + V  W   +AG + G+    +T P D +K RLQ              + P
Sbjct: 39  RADSSQQNIKEVKPWVHFVAGGIGGMAGAVVTCPFDVVKTRLQSDVFQAAYKSHAKSIGP 98

Query: 49  ------ANGLKPFGSQVMEVARSMIKNEGIRSFWKG---NIPG-----SLLYVTYGSAQF 94
                 A G++ F  +   +  ++ +NEG RS +KG   N+ G     S+ + TYG+ + 
Sbjct: 99  NQANVIAQGVRHF-KETFGIISNVYRNEGFRSLFKGLGPNLVGVIPARSINFFTYGTTK- 156

Query: 95  SSYSLFNRYLTPFGLEARLHSLVVGAFAGITSSIVSYPFDVLRTRLVANNQMHSMSITRE 154
               ++++ L   G EA    L+  A AG  +S  + P  +++TRL    Q+     T++
Sbjct: 157 ---EIYSKTLNN-GQEAVWIHLMAAATAGWATSTATNPIWLVKTRL----QLDKAGTTKK 208

Query: 155 VRDIWKL-------EGLPGFFKGSIASMTTITLTASIMFGTYETIRIYC----------- 196
            ++ W         EG+ G +KG  AS    ++   + +  YE ++              
Sbjct: 209 YKNSWDCLKNVVQKEGILGLYKGLSASYLG-SVEGILQWVLYEQMKHIIKQRSMEKFGNI 267

Query: 197 DENEKTTAAHKKWELATLNHSAGTIGGVIAKIITFPLETIRRRMQFMNSKHLEKFSRHSS 256
            E EK+T+   K E    + SAG +   +A IIT+P E +R R++      LE       
Sbjct: 268 SEVEKSTSDKIK-EWCQRSGSAG-LAKFVASIITYPHEVVRTRLR---QAPLEN------ 316

Query: 257 VYGSYKGYGFARIGLQILKQEGVSSLYRGILVALSKTIPTTFVSFWGYETAI 308
             G  K  G  +    I+K+EG++S+Y G+   L +T+P + + F  +E  I
Sbjct: 317 --GKLKYTGLVQSIRVIIKEEGLASMYGGLTPHLLRTVPNSIIMFGTWELVI 366

>Scas_718.24
          Length = 337

 Score = 71.6 bits (174), Expect = 6e-14,   Method: Compositional matrix adjust.
 Identities = 66/288 (22%), Positives = 130/288 (45%), Gaps = 47/288 (16%)

Query: 20  LLAGAVSGLLARSITAPMDTIKIRLQ----LTPANGLKPFGSQVMEVARSMIKNEGIRSF 75
            L G VS  +A++  +P++ +K+ +Q    +     L      +++  R   + EGI SF
Sbjct: 46  FLMGGVSAAVAKTAASPIERVKLLIQNQNEMLKQGTLDTKYKGIVDCFRRTAQQEGIISF 105

Query: 76  WKGNIPGSLLYVTYGSAQFSSYSLFNRYLTPFGLEAR-------LHSLVVGAFAGITSSI 128
           W+GN    + Y      Q  +++  ++    FG +           +L  G  AG  S +
Sbjct: 106 WRGNTANVIRYF---PTQALNFAFKDKIKLMFGFKKEDGYGKWFAGNLASGGAAGGLSLL 162

Query: 129 VSYPFDVLRTRLVANNQMHSMSITREVR---DIWKL----EGLPGFFKGSIASMTTITLT 181
             Y  D  RTRL A+++      +R+     D++K     +G+ G ++G + S+  I + 
Sbjct: 163 FVYSLDFARTRLAADSKSSKKGGSRQFNGLIDVYKKTLKSDGVAGLYRGFLPSVVGIIVY 222

Query: 182 ASIMFGTYETIRIYCDENEKTTAAHKKWELATLNHSAGTIGGVI---AKIITFPLETIRR 238
             + FG Y++I+         T + +   LA+       +G V+   A   ++PL+T+RR
Sbjct: 223 RGLYFGLYDSIKPVL-----LTGSLEGSFLASF-----LLGWVVTTGASTCSYPLDTVRR 272

Query: 239 RMQFMNSKHLEKFSRHSSVYGSYKGYGFARIGLQILKQEGVSSLYRGI 286
           +M   + + +    ++   +  +K         +I+  EGV+SL++G 
Sbjct: 273 KMMMTSGQAV----KYKGAFDCFK---------KIVAAEGVASLFKGC 307

 Score = 35.8 bits (81), Expect = 0.036,   Method: Compositional matrix adjust.
 Identities = 42/183 (22%), Positives = 75/183 (40%), Gaps = 24/183 (13%)

Query: 115 SLVVGAFAGITSSIVSYPFDVLRTRLVANNQMHSM----------SITREVRDIWKLEGL 164
             ++G  +   +   + P +  R +L+  NQ   +           I    R   + EG+
Sbjct: 45  DFLMGGVSAAVAKTAASPIE--RVKLLIQNQNEMLKQGTLDTKYKGIVDCFRRTAQQEGI 102

Query: 165 PGFFKGSIASMTTITLTASIMFGTYETIRIYCDENEKTTAAHKKWELATLNHSAGTIGGV 224
             F++G+ A++     T ++ F   + I++      K    + KW    L  S G  GG 
Sbjct: 103 ISFWRGNTANVIRYFPTQALNFAFKDKIKLMF--GFKKEDGYGKWFAGNL-ASGGAAGG- 158

Query: 225 IAKIITFPLETIRRRMQFMNSKHLEKFSRHSSVYGSYKGYGFARIGLQILKQEGVSSLYR 284
           ++ +  + L+  R R        L   S+ S   GS +  G   +  + LK +GV+ LYR
Sbjct: 159 LSLLFVYSLDFARTR--------LAADSKSSKKGGSRQFNGLIDVYKKTLKSDGVAGLYR 210

Query: 285 GIL 287
           G L
Sbjct: 211 GFL 213

>AFR146W [3338] [Homologous to ScYOR130C (ORT1) - SH]
           complement(702404..703249) [846 bp, 281 aa]
          Length = 281

 Score = 70.9 bits (172), Expect = 6e-14,   Method: Compositional matrix adjust.
 Identities = 78/305 (25%), Positives = 134/305 (43%), Gaps = 49/305 (16%)

Query: 16  AWKTLLAGAVSGLLARSITAPMDTIKIRLQLTPANGLKPFGSQVMEVARSMIKNEGI-RS 74
           A+K LL G V+G L + +  P DT+K+RLQ T +  L P             K EG+ R 
Sbjct: 8   AYKDLLYGGVAGSLGKLVEYPFDTVKVRLQ-TQSAALFP---TTWSCVSHTYKQEGLWRG 63

Query: 75  FWKGN--------IPGSLLYVTYGSAQFSSYSLFNRYLTPFGLEARLHSLVVGAFAGITS 126
           F++G         +  ++L+V++  AQ    ++     +   LE  + +   GA AG  +
Sbjct: 64  FYQGMASPVFGAFLEHAVLFVSFNRAQ----AVLENCYSCGPLEKVVFA---GAIAGACT 116

Query: 127 SIVSYPFDVLRTRLVANNQM-----HSMSITREVRDIWKLEGLPGFFKGSIASMTTITLT 181
           S V  P ++++ +L  +N          ++   +R I K  GL G ++G   +    +  
Sbjct: 117 SYVLTPVELVKCKLQVSNLTGVSGPRYTAVLPTLRAIVKQNGLGGLWQGQSGTFIRESAG 176

Query: 182 ASIMFGTYETIRIYCDENEKTTAAHKKWELATLNHSAGTIGGVIAKIITFPLETIRRRMQ 241
            ++ F  YE ++ +      +T  +  WEL  L   AG      A I  FP +T++  MQ
Sbjct: 177 GAVWFTAYEVLKGWLARRRGST-ENTVWEL--LASGAGAGAAFHASI--FPADTVKSTMQ 231

Query: 242 FMNSKHLEKFSRHSSVYGSYKGYGFARIGLQILKQEGVSSLYRGILVALSKTIPTTFVSF 301
              ++HL                G       +LK+ G +  YRG+ + L + +P   V F
Sbjct: 232 ---TEHL----------------GLGPAVRTVLKKHGPTGFYRGVGITLLRALPANAVIF 272

Query: 302 WGYET 306
           + YE+
Sbjct: 273 YVYES 277

 Score = 47.8 bits (112), Expect = 3e-06,   Method: Compositional matrix adjust.
 Identities = 37/179 (20%), Positives = 81/179 (45%), Gaps = 8/179 (4%)

Query: 18  KTLLAGAVSGLLARSITAPMDTIKIRLQLTPANGLK-PFGSQVMEVARSMIKNEGIRSFW 76
           K + AGA++G     +  P++ +K +LQ++   G+  P  + V+   R+++K  G+   W
Sbjct: 104 KVVFAGAIAGACTSYVLTPVELVKCKLQVSNLTGVSGPRYTAVLPTLRAIVKQNGLGGLW 163

Query: 77  KGNIPGSLLYVTYGSAQFSSYSLFNRYLTPF--GLEARLHSLVVGAFAGITSSIVS-YPF 133
           +G     +     G+  F++Y +   +L       E  +  L+        +   S +P 
Sbjct: 164 QGQSGTFIRESAGGAVWFTAYEVLKGWLARRRGSTENTVWELLASGAGAGAAFHASIFPA 223

Query: 134 DVLRTRLVANNQMHSMSITREVRDIWKLEGLPGFFKGSIASMTTITLTASIMFGTYETI 192
           D +++ +    Q   + +   VR + K  G  GF++G   ++       +++F  YE++
Sbjct: 224 DTVKSTM----QTEHLGLGPAVRTVLKKHGPTGFYRGVGITLLRALPANAVIFYVYESL 278

>YKL120W (OAC1) [3145] chr11 (216990..217964) Mitochondrial
           oxaloacetate transporter, member of the mitochondrial
           carrier (MCF) family of membrane transporters [975 bp,
           324 aa]
          Length = 324

 Score = 71.2 bits (173), Expect = 6e-14,   Method: Compositional matrix adjust.
 Identities = 70/319 (21%), Positives = 142/319 (44%), Gaps = 42/319 (13%)

Query: 3   KEEDSLRK--GQNVAAWKTLLAGAVSGLLARSITAPMDTIKIRLQLT---PANGLKPFGS 57
           K++  + K   Q ++ + + +AG ++  +A ++T P++ IKIR+QL     A+  K + +
Sbjct: 7   KQDKQIEKTAAQKISKFGSFVAGGLAACIAVTVTNPIELIKIRMQLQGEMSASAAKVYKN 66

Query: 58  QVMEVARSMIKNEGIRSFWKGNIPGSLLYVTYGSAQFSSY----SLFNRYLTPFGLEARL 113
            +  +A  + KNEGI+   KG     +  +    ++   Y    S  N+   P     ++
Sbjct: 67  PIQGMA-VIFKNEGIKGLQKGLNAAYIYQIGLNGSRLGFYEPIRSSLNQLFFPDQEPHKV 125

Query: 114 HSLVV----GAFAGITSSIVSYPFDVLRTRLVA-------NNQMHSMSITREVRDIWKLE 162
            S+ V    GA +GI  +++  P  +++TRL +         Q H   +   +  I+K E
Sbjct: 126 QSVGVNVFSGAASGIIGAVIGSPLFLVKTRLQSYSEFIKIGEQTHYTGVWNGLVTIFKTE 185

Query: 163 GLPGFFKGSIASMTTITLTASIMFGTYETIRIYCDENEKTTAAHKKWELATLNHSAGTIG 222
           G+ G F+G  A++      +S+    Y T +    +N+             L+ +A TI 
Sbjct: 186 GVKGLFRGIDAAILRTGAGSSVQLPIYNTAKNILVKNDLMKDG------PALHLTASTIS 239

Query: 223 GVIAKIITFPLETIRRRMQFMNSKHLEKFSRHSSVYGSYKGYGFARIGLQILKQEGVSSL 282
           G+   ++  P + I  R+          +++   +Y      G     ++ ++ EGV++L
Sbjct: 240 GLGVAVVMNPWDVILTRI----------YNQKGDLY-----KGPIDCLVKTVRIEGVTAL 284

Query: 283 YRGILVALSKTIPTTFVSF 301
           Y+G    + +  P T +  
Sbjct: 285 YKGFAAQVFRIAPHTIMCL 303

 Score = 52.8 bits (125), Expect = 1e-07,   Method: Compositional matrix adjust.
 Identities = 54/205 (26%), Positives = 89/205 (43%), Gaps = 18/205 (8%)

Query: 111 ARLHSLVVGAFAGITSSIVSYPFDVLRTRLVANNQMHSMSITREVRD-------IWKLEG 163
           ++  S V G  A   +  V+ P ++++ R+    +M S S  +  ++       I+K EG
Sbjct: 21  SKFGSFVAGGLAACIAVTVTNPIELIKIRMQLQGEM-SASAAKVYKNPIQGMAVIFKNEG 79

Query: 164 LPGFFKG-SIASMTTITLTASIMFGTYETIRIYCDENEKTTAAHKKWELATLNHSAGTIG 222
           + G  KG + A +  I L  S   G YE IR   ++         K +   +N  +G   
Sbjct: 80  IKGLQKGLNAAYIYQIGLNGS-RLGFYEPIRSSLNQLFFPDQEPHKVQSVGVNVFSGAAS 138

Query: 223 GVIAKIITFPLETIRRRMQFMNSKHLEKFSRHSSVYGSYKGYGFARIGLQILKQEGVSSL 282
           G+I  +I  PL  ++ R+Q  +     K    +   G + G       + I K EGV  L
Sbjct: 139 GIIGAVIGSPLFLVKTRLQ--SYSEFIKIGEQTHYTGVWNGL------VTIFKTEGVKGL 190

Query: 283 YRGILVALSKTIPTTFVSFWGYETA 307
           +RGI  A+ +T   + V    Y TA
Sbjct: 191 FRGIDAAILRTGAGSSVQLPIYNTA 215

>Scas_640.25
          Length = 306

 Score = 71.2 bits (173), Expect = 7e-14,   Method: Compositional matrix adjust.
 Identities = 64/283 (22%), Positives = 127/283 (44%), Gaps = 23/283 (8%)

Query: 20  LLAGAVSGLLARSITAPMDTIKIRLQLTPANGLKPFGSQ----VMEVARSMIKNEGIRSF 75
            +AGA++G+    +  P+D +K R+QL  + G     +     V++    ++K EG    
Sbjct: 17  FMAGAIAGISELMVMYPLDVVKTRMQLQVSTGAAGASATHYKGVIDCLSQIVKKEGPMHM 76

Query: 76  WKGNIPGSLLYVTYGSAQFSSYSLFNR-YLTPFGLEARLHSLVV--GAFAGITSSIVSYP 132
           +KG     L+     + +F+S   F + + + FG +     + V  GA AGIT ++V  P
Sbjct: 77  YKGISSPMLMEAPKRAVKFASNDEFIKLWKSVFGTKQLTQQISVLSGASAGITEALVIVP 136

Query: 133 FDVLRTRLVANNQMHSMSITREVRDIWKLEGLPGFFKGSIASMTTITLTASIMFGTYETI 192
           F++++ RL   N      +   ++ I K +GL G + G  +++    +  +  FG    +
Sbjct: 137 FELVKIRLQDVNSKFKGPV-EVLKHIIKQDGLKGLYSGVESTVWRNAVWNAGYFGVIFQV 195

Query: 193 RIYCDENEKTTAAHKKWELATLNHSAGTIGGVIAKIITFPLETIRRRMQFMNSKHLEKFS 252
           R      E    A  K E    +  AG +GG    +   P + ++ R+Q   ++ +    
Sbjct: 196 R------ELLPVAKSKQEKTRNDLCAGFVGGTFGVMFNTPFDVVKSRIQSDGNEIINGVR 249

Query: 253 RHSSVYGSYKGYGFARIGLQILKQEGVSSLYRGILVALSKTIP 295
           +++  + S          ++I  +EG  +LY+G +  + +  P
Sbjct: 250 KYNWTWPSV---------MKIYHEEGFRALYKGFVPKVLRLGP 283

 Score = 46.2 bits (108), Expect = 1e-05,   Method: Compositional matrix adjust.
 Identities = 44/184 (23%), Positives = 81/184 (44%), Gaps = 35/184 (19%)

Query: 114 HSLVVGAFAGITSSIVSYPFDVLRTRL--------VANNQMHSMSITREVRDIWKLEGLP 165
           +  + GA AGI+  +V YP DV++TR+           +  H   +   +  I K EG  
Sbjct: 15  YQFMAGAIAGISELMVMYPLDVVKTRMQLQVSTGAAGASATHYKGVIDCLSQIVKKEGPM 74

Query: 166 GFFKGSIASMTTITLTASIMFGTY-ETIRIYCDENEKTTAAHKKW--ELATLNHSAGTIG 222
             +KG  + M       ++ F +  E I+++     K+    K+   +++ L   +G   
Sbjct: 75  HMYKGISSPMLMEAPKRAVKFASNDEFIKLW-----KSVFGTKQLTQQISVL---SGASA 126

Query: 223 GVIAKIITFPLETIRRRMQFMNSKHLEKFSRHSSVYGSYKGYGFARIGLQILKQEGVSSL 282
           G+   ++  P E ++ R+Q +NSK              +KG     +   I+KQ+G+  L
Sbjct: 127 GITEALVIVPFELVKIRLQDVNSK--------------FKGP--VEVLKHIIKQDGLKGL 170

Query: 283 YRGI 286
           Y G+
Sbjct: 171 YSGV 174

 Score = 41.6 bits (96), Expect = 4e-04,   Method: Compositional matrix adjust.
 Identities = 36/183 (19%), Positives = 78/183 (42%), Gaps = 15/183 (8%)

Query: 19  TLLAGAVSGLLARSITAPMDTIKIRLQLTPANGLKPFGSQVMEVARSMIKNEGIRSFWKG 78
           ++L+GA +G+    +  P + +KIRLQ   +    P     +EV + +IK +G++  + G
Sbjct: 119 SVLSGASAGITEALVIVPFELVKIRLQDVNSKFKGP-----VEVLKHIIKQDGLKGLYSG 173

Query: 79  NIPGSLLYVTYGSAQFSSYSLFNRYLTPFG---LEARLHSLVVGAFAGITSSIVSYPFDV 135
            +  ++      +A +       R L P      E   + L  G   G    + + PFDV
Sbjct: 174 -VESTVWRNAVWNAGYFGVIFQVRELLPVAKSKQEKTRNDLCAGFVGGTFGVMFNTPFDV 232

Query: 136 LRTRLVANNQMHSMSITR------EVRDIWKLEGLPGFFKGSIASMTTITLTASIMFGTY 189
           +++R+ ++       + +       V  I+  EG    +KG +  +  +    +++   +
Sbjct: 233 VKSRIQSDGNEIINGVRKYNWTWPSVMKIYHEEGFRALYKGFVPKVLRLGPGGAVLLVVF 292

Query: 190 ETI 192
             +
Sbjct: 293 TNV 295

 Score = 33.1 bits (74), Expect = 0.22,   Method: Compositional matrix adjust.
 Identities = 25/84 (29%), Positives = 37/84 (44%), Gaps = 7/84 (8%)

Query: 218 AGTIGGVIAKIITFPLETIRRRMQFMNSKHLEKFSRHSSVYGSYKGYGFARIGLQILKQE 277
           AG I G+   ++ +PL+ ++ RMQ   S      S        YKG        QI+K+E
Sbjct: 19  AGAIAGISELMVMYPLDVVKTRMQLQVSTGAAGASATH-----YKG--VIDCLSQIVKKE 71

Query: 278 GVSSLYRGILVALSKTIPTTFVSF 301
           G   +Y+GI   +    P   V F
Sbjct: 72  GPMHMYKGISSPMLMEAPKRAVKF 95

>CAGL0B04543g 441599..442552 highly similar to tr|Q12289
           Saccharomyces cerevisiae YOR100c CRC1, start by
           similarity
          Length = 317

 Score = 70.9 bits (172), Expect = 9e-14,   Method: Compositional matrix adjust.
 Identities = 70/304 (23%), Positives = 130/304 (42%), Gaps = 36/304 (11%)

Query: 18  KTLLAGAVSGLLARSITAPMDTIKIRLQLTPANGLKPFGSQVMEVARSMIKNEG------ 71
           K L+AG V G+ A     P D IK+R Q   A       S +++ ARS+    G      
Sbjct: 23  KALVAGGVGGVCAVLTGHPFDLIKVRCQSNQAKSTMDAVSIILKEARSLSTVNGSLTTSL 82

Query: 72  -----IRSFWKGNIPGSLLYVTYGSAQFSSYSLFNRYLT-PFGLEARLHS---LVVGAFA 122
                ++ F+KG IP  +      +  F  Y +  R +T     +A L +      G  +
Sbjct: 83  FFKNSVKGFYKGVIPPLIGVTPIFAVSFWGYDIGKRLVTWKQASDAPLTTAQMATAGFIS 142

Query: 123 GITSSIVSYPFDVLRTRLVANNQMHSMSITREVRDIWKLEGLPGFFKGSIASMTTITLTA 182
            I +++V+ P + ++  L  N++    S  +  + I    G+   F GS+A++      +
Sbjct: 143 AIPTTLVTAPTERIKVVLQTNSEFKG-SFIKAAKHIVSTGGVKSLFNGSLATLARDGPGS 201

Query: 183 SIMFGTYETIRIYCDENEKTTAAHKKWELATLNHS-AGTIGGVIAKIITFPLETIRRRMQ 241
           ++ F +YE  + + +   K+ A   K E+   N   AG I G+   ++ FP++TI+ R+Q
Sbjct: 202 ALYFASYELSKAFLN---KSVAKKDKDEVNLANVCLAGGIAGMSMWLVVFPIDTIKTRLQ 258

Query: 242 FMNSKHLEKFSRHSSVYGSYKGYGFARIGLQILKQEGVSSLYRGILVALSKTIPTTFVSF 301
              +  +        +Y               +++ G+   + G+  AL ++ P    +F
Sbjct: 259 VATTP-ISMVQATKDIY---------------IQRGGIKGFFPGLGPALLRSFPANAATF 302

Query: 302 WGYE 305
            G E
Sbjct: 303 LGVE 306

>KLLA0E23705g complement(2099965..2101071) highly similar to
           sp|P38127 Saccharomyces cerevisiae YBR192w RIM2
           mitochondrial carrier protein (MCF), start by similarity
          Length = 368

 Score = 71.2 bits (173), Expect = 9e-14,   Method: Compositional matrix adjust.
 Identities = 89/337 (26%), Positives = 157/337 (46%), Gaps = 62/337 (18%)

Query: 14  VAAWKTLLAGAVSGLLARSITAPMDTIKIRLQLT------PANGLKPFGSQVME-VARSM 66
           V  W   +AG + G+    +T P D +K RLQ         +  ++  GS  +  V+RS+
Sbjct: 48  VKPWVHFVAGGIGGMAGAIVTCPFDVVKTRLQSDVFRTQYKSAAMQNNGSSTLHFVSRSL 107

Query: 67  I-------------KNEGIRSFWKG---NIPG-----SLLYVTYGSAQFSSYSLFNRYLT 105
           +             + EG RS +KG   N+ G     S+ ++TYG+ +     +++R L 
Sbjct: 108 LHFKETFGIIGNVYRQEGFRSLFKGLGPNLVGVIPARSINFLTYGTTK----DIYSRTLN 163

Query: 106 PFGLEARLHSLVVGAFAGITSSIVSYPFDVLRTRLV---ANNQMHSMSITREVRDIWKLE 162
             G EA    L+  A AG  +S V+ P  +++TRL    A  + +  S+   ++ + K E
Sbjct: 164 N-GQEAPWIHLLAAATAGWATSTVTNPIWLVKTRLQLDKAGTKTYKNSLDC-IKSVVKNE 221

Query: 163 GLPGFFKGSIASMTTITLTASIMFGTYETI-RI----------YCDENEKTTAAHKKWEL 211
           G+ G +KG  AS    ++   + +  YE + RI          +  E+ K+T+   K E 
Sbjct: 222 GVLGLYKGLSASYLG-SVEGILQWILYEQMKRIIKERSIEKFGHIHEDAKSTSDKVK-EW 279

Query: 212 ATLNHSAGTIGGVIAKIITFPLETIRRRMQFMNSKHLEKFSRHSSVYGSYKGYGFARIGL 271
              + SAG +   +A I+T+P E +R R++   +++           G  K  G  +   
Sbjct: 280 CQRSGSAG-LAKFVASIVTYPHEVVRTRLRQAPTEN-----------GKLKYTGLVQSFR 327

Query: 272 QILKQEGVSSLYRGILVALSKTIPTTFVSFWGYETAI 308
            I+K+EG+ S+Y G+   L +T+P + + F  +E  I
Sbjct: 328 VIIKEEGLVSMYSGLTPHLLRTVPNSIIMFGTWELVI 364

>AFR131C [3323] [Homologous to ScYGR257C - SH] (672999..674033)
           [1035 bp, 344 aa]
          Length = 344

 Score = 70.9 bits (172), Expect = 1e-13,   Method: Compositional matrix adjust.
 Identities = 68/266 (25%), Positives = 116/266 (43%), Gaps = 33/266 (12%)

Query: 60  MEVARSMIKNEGIRSFWKG-------NIPGSLLYVTYGSAQFSSYSLFNRYLTPFGLEAR 112
           +E  R + + EG+ + W+G        +P +++Y       FS Y    R  +P  L +R
Sbjct: 84  LEGLRKIAQLEGLPTLWRGLGITLVMAVPANVVY-------FSGYEAL-RDNSP--LASR 133

Query: 113 L---HSLVVGAFAGITSSIVSYPFDVLRTRLVANNQMHSMSIT--------REVRDIWKL 161
           L   + LV GAFA I ++    P ++LRTRL +  +      T        RE+R    +
Sbjct: 134 LPVANPLVCGAFARILAATTIAPLELLRTRLQSVPRARDTERTIYLIGDLLREMRHEVSV 193

Query: 162 EGLPGFFKGSIASMTTITLTASIMFGTYETIRIYCDENEKTTAAHKKWELATLNHSAGTI 221
            G    FKG   ++      ++I +GTYE  +         T     W+    + + G++
Sbjct: 194 MGYRALFKGLEITLWRDVPFSAIYWGTYEFCKTQFWARHAATHNASNWDHFIGSFACGSM 253

Query: 222 GGVIAKIITFPLETIRRRMQ--FMNSKHLEKFSRHSSVYGSYKGYGFARIGLQILKQEGV 279
           GG +A ++T P +  + RMQ    + + L    + +    S   + F      I K EG+
Sbjct: 254 GGAVAALLTHPFDVGKTRMQIAIASPQQLTVGGKATKTDDSRGMFSFLN---AIRKSEGI 310

Query: 280 SSLYRGILVALSKTIPTTFVSFWGYE 305
            +LY G+L  + K  P+  +    YE
Sbjct: 311 RALYTGLLPRVMKIAPSCAIMISTYE 336

 Score = 52.0 bits (123), Expect = 2e-07,   Method: Compositional matrix adjust.
 Identities = 48/200 (24%), Positives = 93/200 (46%), Gaps = 32/200 (16%)

Query: 20  LLAGAVSGLLARSITAPMDTIKIRLQLTP-----ANGLKPFGSQVMEVARSMIKNEGIRS 74
           L+ GA + +LA +  AP++ ++ RLQ  P        +   G  + E+ R  +   G R+
Sbjct: 140 LVCGAFARILAATTIAPLELLRTRLQSVPRARDTERTIYLIGDLLREM-RHEVSVMGYRA 198

Query: 75  FWKG-------NIPGSLLYVTYGSAQFSSYSLFNRYLTPFGLEARLH---SLVVGAFAGI 124
            +KG       ++P S +Y  +G+ +F     + R+          H   S   G+  G 
Sbjct: 199 LFKGLEITLWRDVPFSAIY--WGTYEFCKTQFWARHAATHNASNWDHFIGSFACGSMGGA 256

Query: 125 TSSIVSYPFDVLRTRL---VANNQMHSM----SITREVRDIW-------KLEGLPGFFKG 170
            ++++++PFDV +TR+   +A+ Q  ++    + T + R ++       K EG+   + G
Sbjct: 257 VAALLTHPFDVGKTRMQIAIASPQQLTVGGKATKTDDSRGMFSFLNAIRKSEGIRALYTG 316

Query: 171 SIASMTTITLTASIMFGTYE 190
            +  +  I  + +IM  TYE
Sbjct: 317 LLPRVMKIAPSCAIMISTYE 336

 Score = 31.6 bits (70), Expect = 0.74,   Method: Compositional matrix adjust.
 Identities = 26/108 (24%), Positives = 48/108 (44%), Gaps = 14/108 (12%)

Query: 12  QNVAAWKTLL----AGAVSGLLARSITAPMDTIKIRLQLTPANGLK-PFGSQVMEV--AR 64
            N + W   +     G++ G +A  +T P D  K R+Q+  A+  +   G +  +   +R
Sbjct: 236 HNASNWDHFIGSFACGSMGGAVAALLTHPFDVGKTRMQIAIASPQQLTVGGKATKTDDSR 295

Query: 65  SMI-------KNEGIRSFWKGNIPGSLLYVTYGSAQFSSYSLFNRYLT 105
            M        K+EGIR+ + G +P  +      +   S+Y L  ++ T
Sbjct: 296 GMFSFLNAIRKSEGIRALYTGLLPRVMKIAPSCAIMISTYELSKKFFT 343

>Scas_721.129
          Length = 323

 Score = 70.5 bits (171), Expect = 1e-13,   Method: Compositional matrix adjust.
 Identities = 64/317 (20%), Positives = 138/317 (43%), Gaps = 40/317 (12%)

Query: 3   KEEDSLRKGQNVAAWKTLLAGAVSGLLARSITAPMDTIKIRLQLT---PANGLKPFGSQV 59
           K+E      Q V+ + + +AG ++  +A + T P++ +KIR+QL     A G K + + +
Sbjct: 8   KKEIEKTAAQKVSKFGSFIAGGMAACIAVTFTNPIELVKIRMQLQGELAAVGQKVYRNPI 67

Query: 60  MEVARSMIKNEGIRSFWKGNIPGSLLYVTYGSAQFSSY----SLFNRYLTPFGLEARLH- 114
             +   + +NEGIR   KG +   +  +    ++   Y    +  N    P     ++  
Sbjct: 68  QGMG-VIFRNEGIRGLQKGLVAAYIYQIGLNGSRLGFYEPIRNALNSTFYPNEESHKIQK 126

Query: 115 ---SLVVGAFAGITSSIVSYPFDVLRTRLVANNQMHSMSITREVRDIW-------KLEGL 164
              ++  GA +GI  +++  P  +++TR+ + +    +      R++W       + EG 
Sbjct: 127 VSINVAAGASSGIIGAVIGSPLFLVKTRMQSYSDAIKIGEQTHYRNVWNGLSTIARTEGF 186

Query: 165 PGFFKGSIASMTTITLTASIMFGTYETIRIYCDENEKTTAAHKKWELATLNHSAGTIGGV 224
            G F+G  A++      +S+    Y T + +  +N+             L+ +A TI G+
Sbjct: 187 KGLFRGIDAAILRTGAGSSVQLPIYNTAKNFLLKNDLMKDG------PGLHLTASTISGL 240

Query: 225 IAKIITFPLETIRRRMQFMNSKHLEKFSRHSSVYGSYKGYGFARIGLQILKQEGVSSLYR 284
              ++  P + I  R+          +++  ++Y      G     ++ ++ EG+S+LY+
Sbjct: 241 GVAVVMNPWDVILTRI----------YNQKGNLY-----KGPVDCFVKTVRTEGISALYK 285

Query: 285 GILVALSKTIPTTFVSF 301
           G    + +  P T +  
Sbjct: 286 GFQAQILRIAPHTIICL 302

 Score = 48.5 bits (114), Expect = 3e-06,   Method: Compositional matrix adjust.
 Identities = 49/211 (23%), Positives = 90/211 (42%), Gaps = 30/211 (14%)

Query: 111 ARLHSLVVGAFAGITSSIVSYPFDVLRTRL------------VANNQMHSMSITREVRDI 158
           ++  S + G  A   +   + P ++++ R+            V  N +  M +      I
Sbjct: 20  SKFGSFIAGGMAACIAVTFTNPIELVKIRMQLQGELAAVGQKVYRNPIQGMGV------I 73

Query: 159 WKLEGLPGFFKGSIAS-MTTITLTASIMFGTYETIRIYCDENEKTTAAHKKWELATLNHS 217
           ++ EG+ G  KG +A+ +  I L  S   G YE IR   +          K +  ++N +
Sbjct: 74  FRNEGIRGLQKGLVAAYIYQIGLNGS-RLGFYEPIRNALNSTFYPNEESHKIQKVSINVA 132

Query: 218 AGTIGGVIAKIITFPLETIRRRMQ-FMNSKHLEKFSRHSSVYGSYKGYGFARIGLQILKQ 276
           AG   G+I  +I  PL  ++ RMQ + ++  + + + + +V+              I + 
Sbjct: 133 AGASSGIIGAVIGSPLFLVKTRMQSYSDAIKIGEQTHYRNVWNGLS---------TIART 183

Query: 277 EGVSSLYRGILVALSKTIPTTFVSFWGYETA 307
           EG   L+RGI  A+ +T   + V    Y TA
Sbjct: 184 EGFKGLFRGIDAAILRTGAGSSVQLPIYNTA 214

>YBR085W (AAC3) [275] chr2 (415940..416863) ADP/ATP transporter
           protein, member of the mitochondrial carrier family
           (MCF) of membrane transporters [924 bp, 307 aa]
          Length = 307

 Score = 69.7 bits (169), Expect = 2e-13,   Method: Compositional matrix adjust.
 Identities = 66/289 (22%), Positives = 127/289 (43%), Gaps = 47/289 (16%)

Query: 19  TLLAGAVSGLLARSITAPMDTIKIRLQ----LTPANGLKPFGSQVMEVARSMIKNEGIRS 74
             L G VS  +A++  +P++ +KI +Q    +     L    S +++  +   K EG+ S
Sbjct: 15  NFLMGGVSAAIAKTAASPIERVKILIQNQDEMIKQGTLDKKYSGIVDCFKRTAKQEGLIS 74

Query: 75  FWKGNIPGSLLYVTYGSAQFSSYSLFNRYLTPFGLEAR-------LHSLVVGAFAGITSS 127
           FW+GN    + Y      Q  +++  ++    FG +           +L  G  AG  S 
Sbjct: 75  FWRGNTANVIRYF---PTQALNFAFKDKIKLMFGFKKEEGYGKWFAGNLASGGAAGALSL 131

Query: 128 IVSYPFDVLRTRLVANNQMHSMSITRE---VRDIWKL----EGLPGFFKGSIASMTTITL 180
           +  Y  D  RTRL A+ +       R+   + D++K     +G+ G ++G + S+  I +
Sbjct: 132 LFVYSLDFARTRLAADAKSSKKGGARQFNGLTDVYKKTLKSDGIAGLYRGFMPSVVGIVV 191

Query: 181 TASIMFGTYETIRIYCDENEKTTAAHKKWELATLNHSAGTIGGVI---AKIITFPLETIR 237
              + FG +++++         T +     LA+       +G V+   A   ++PL+T+R
Sbjct: 192 YRGLYFGMFDSLKPLV-----LTGSLDGSFLASF-----LLGWVVTTGASTCSYPLDTVR 241

Query: 238 RRMQFMNSKHLEKFSRHSSVYGSYKGYGFARIGLQILKQEGVSSLYRGI 286
           RRM   + + +    +++      K         +I+  EGV SL++G 
Sbjct: 242 RRMMMTSGQAV----KYNGAIDCLK---------KIVASEGVGSLFKGC 277

 Score = 34.3 bits (77), Expect = 0.11,   Method: Compositional matrix adjust.
 Identities = 30/128 (23%), Positives = 58/128 (45%), Gaps = 12/128 (9%)

Query: 160 KLEGLPGFFKGSIASMTTITLTASIMFGTYETIRIYCDENEKTTAAHKKWELATLNHSAG 219
           K EGL  F++G+ A++     T ++ F   + I++      K    + KW     N ++G
Sbjct: 68  KQEGLISFWRGNTANVIRYFPTQALNFAFKDKIKLMF--GFKKEEGYGKWFAG--NLASG 123

Query: 220 TIGGVIAKIITFPLETIRRRMQFMNSKHLEKFSRHSSVYGSYKGYGFARIGLQILKQEGV 279
              G ++ +  + L+  R R        L   ++ S   G+ +  G   +  + LK +G+
Sbjct: 124 GAAGALSLLFVYSLDFARTR--------LAADAKSSKKGGARQFNGLTDVYKKTLKSDGI 175

Query: 280 SSLYRGIL 287
           + LYRG +
Sbjct: 176 AGLYRGFM 183

>Kwal_26.7972
          Length = 358

 Score = 70.1 bits (170), Expect = 2e-13,   Method: Compositional matrix adjust.
 Identities = 63/281 (22%), Positives = 119/281 (42%), Gaps = 43/281 (15%)

Query: 4   EEDSLRKGQNVAAWK--------TLLAGAVSGLLARSITAPMDTIKIRLQLTPANGLKPF 55
           ++DS+   +N +  K        + LAG ++G  A+++ AP+D IKI  Q +  + LK  
Sbjct: 7   DDDSMVPSKNQSVDKRSAHYILRSGLAGGIAGSCAKTLIAPLDRIKILFQTSNPHYLKYS 66

Query: 56  GSQ--VMEVARSMIKNEGIRSFWKGNIPGSLLYVTYGSAQFSSYSLFNRYLTPFG-LEAR 112
           GS   ++     +  ++GIR F++G+    +    Y + +F +Y     ++ P    E  
Sbjct: 67  GSTMGLIRAGAHINAHDGIRGFYQGHSATLIRIFPYAAIKFIAYEQIRHFMIPSKEYETH 126

Query: 113 LHSLVVGAFAGITSSIVSYPFDVLRTRLVANNQMHSMSITREVRDIWKLEG--------- 163
              L  G+ AG+ S  ++YP D++R RL        + +   ++ I+             
Sbjct: 127 ARRLASGSMAGLCSVFMTYPLDLIRVRLAYVTDRSRIKMLPVIKQIYTERASESLTSKSY 186

Query: 164 LP-------GFFKGSIASMTTITLTASIMF------------GTYETIRIYCDENEKTTA 204
           +P        F++G   ++  +   A + F            G      +    +E+ T 
Sbjct: 187 VPRWFAHWCNFYRGFTPTVLGMIPYAGVSFFAHDLCGDILRSGALSPYSVLPISDEELTI 246

Query: 205 AHKKWELATLNH----SAGTIGGVIAKIITFPLETIRRRMQ 241
             KK     L       AG + G+ ++  ++P E IRRR+Q
Sbjct: 247 RSKKQSSRPLKTWAELVAGGLAGMASQTASYPFEIIRRRLQ 287

 Score = 49.7 bits (117), Expect = 1e-06,   Method: Compositional matrix adjust.
 Identities = 54/211 (25%), Positives = 93/211 (44%), Gaps = 42/211 (19%)

Query: 18  KTLLAGAVSGLLARSITAPMDTIKIRLQ-LTPANGLK--PFGSQVM--EVARSMIKNEGI 72
           + L +G+++GL +  +T P+D I++RL  +T  + +K  P   Q+     + S+     +
Sbjct: 128 RRLASGSMAGLCSVFMTYPLDLIRVRLAYVTDRSRIKMLPVIKQIYTERASESLTSKSYV 187

Query: 73  R-------SFWKGNIPGSLLYVTYGSAQFSSYSLFNRYL-----TPFGL------EARLH 114
                   +F++G  P  L  + Y    F ++ L    L     +P+ +      E  + 
Sbjct: 188 PRWFAHWCNFYRGFTPTVLGMIPYAGVSFFAHDLCGDILRSGALSPYSVLPISDEELTIR 247

Query: 115 S-------------LVVGAFAGITSSIVSYPFDVLRTRL----VANNQMHSM-SITREVR 156
           S             LV G  AG+ S   SYPF+++R RL    V+   +H+  +I   +R
Sbjct: 248 SKKQSSRPLKTWAELVAGGLAGMASQTASYPFEIIRRRLQVSVVSPTSIHNFQTIPDMIR 307

Query: 157 DIWKLEGLPGFFKG-SIASMTTITLTASIMF 186
            I+K  G  GFF G SI  +    + A   F
Sbjct: 308 IIYKERGWRGFFVGLSIGYIKVTPMVACSFF 338

 Score = 48.9 bits (115), Expect = 2e-06,   Method: Compositional matrix adjust.
 Identities = 34/140 (24%), Positives = 67/140 (47%), Gaps = 13/140 (9%)

Query: 113 LHSLVVGAFAGITSSIVSYPFDVLRTRLVANNQMH------SMSITREVRDIWKLEGLPG 166
           L S + G  AG  +  +  P D ++     +N  +      +M + R    I   +G+ G
Sbjct: 28  LRSGLAGGIAGSCAKTLIAPLDRIKILFQTSNPHYLKYSGSTMGLIRAGAHINAHDGIRG 87

Query: 167 FFKGSIASMTTITLTASIMFGTYETIRIYCDENEKTTAAHKKWELATLNHSAGTIGGVIA 226
           F++G  A++  I   A+I F  YE IR +   +       K++E      ++G++ G+ +
Sbjct: 88  FYQGHSATLIRIFPYAAIKFIAYEQIRHFMIPS-------KEYETHARRLASGSMAGLCS 140

Query: 227 KIITFPLETIRRRMQFMNSK 246
             +T+PL+ IR R+ ++  +
Sbjct: 141 VFMTYPLDLIRVRLAYVTDR 160

 Score = 37.0 bits (84), Expect = 0.014,   Method: Compositional matrix adjust.
 Identities = 27/94 (28%), Positives = 37/94 (39%), Gaps = 13/94 (13%)

Query: 218 AGTIGGVIAKIITFPLETIRRRMQFMNSKHLEKFSRHSSVYGSYKG--YGFARIGLQILK 275
           AG I G  AK +  PL+ I+   Q  N  +L+           Y G   G  R G  I  
Sbjct: 33  AGGIAGSCAKTLIAPLDRIKILFQTSNPHYLK-----------YSGSTMGLIRAGAHINA 81

Query: 276 QEGVSSLYRGILVALSKTIPTTFVSFWGYETAIH 309
            +G+   Y+G    L +  P   + F  YE   H
Sbjct: 82  HDGIRGFYQGHSATLIRIFPYAAIKFIAYEQIRH 115

 Score = 32.7 bits (73), Expect = 0.30,   Method: Compositional matrix adjust.
 Identities = 20/81 (24%), Positives = 42/81 (51%), Gaps = 5/81 (6%)

Query: 3   KEEDSLRKGQN----VAAWKTLLAGAVSGLLARSITAPMDTIKIRLQLTPANGLKPFGSQ 58
            EE ++R  +     +  W  L+AG ++G+ +++ + P + I+ RLQ++  +       Q
Sbjct: 241 DEELTIRSKKQSSRPLKTWAELVAGGLAGMASQTASYPFEIIRRRLQVSVVSPTSIHNFQ 300

Query: 59  VM-EVARSMIKNEGIRSFWKG 78
            + ++ R + K  G R F+ G
Sbjct: 301 TIPDMIRIIYKERGWRGFFVG 321

>CAGL0F04213g 419473..420393 highly similar to sp|P18239
           Saccharomyces cerevisiae YBL030c AAC2 ADP/ATP carrier
           protein, hypothetical start
          Length = 306

 Score = 69.3 bits (168), Expect = 3e-13,   Method: Compositional matrix adjust.
 Identities = 71/286 (24%), Positives = 125/286 (43%), Gaps = 43/286 (15%)

Query: 20  LLAGAVSGLLARSITAPMDTIKIRLQ----LTPANGLKPFGSQVMEVARSMIKNEGIRSF 75
            L G VS  +A++  +P++ +K+ +Q    +     L      +++  +   + EGI SF
Sbjct: 15  FLMGGVSAAVAKTAASPIERVKLLIQNQDEMIKQGSLDHRYKGIVDCFQRTARQEGIISF 74

Query: 76  WKGNIPGSLLYVTYGSAQFSSYSLFNRYLTPFGLEAR-------LHSLVVGAFAGITSSI 128
           W+GN    + Y      Q  +++  ++    FG +           +L  G  AG  S +
Sbjct: 75  WRGNTANVIRYF---PTQALNFAFKDQIKAMFGFKKEEGYAKWFAGNLASGGIAGGLSLM 131

Query: 129 VSYPFDVLRTRLVANNQMHSMSITREVR---DIWKL----EGLPGFFKGSIASMTTITLT 181
             Y  D  RTRL A+ +       R+     D++K     +G+ G ++G + S+  I + 
Sbjct: 132 FVYSLDYARTRLAADAKSSKKGGERQFNGLVDVYKKTIASDGVAGLYRGFLPSVIGIVVY 191

Query: 182 ASIMFGTYETIRIYCDENEKTTAAHKKWELATLNHSAGTIGGVIAKIITFPLETIRRRMQ 241
             + FG Y++    C     T +    +  + L     T G   A   ++PL+T+RRRM 
Sbjct: 192 RGLYFGLYDS----CKPLLLTGSLEGSFIASFLLGWVVTTG---ASTASYPLDTVRRRMM 244

Query: 242 FMNSKHLEKFSRHSSVYGSYKGYGFARIGLQ-ILKQEGVSSLYRGI 286
             + + ++           YKG   A   LQ I+  EGVSSL++G 
Sbjct: 245 MTSGQAVK-----------YKG---AMDCLQKIVAAEGVSSLFKGC 276

 Score = 30.0 bits (66), Expect = 2.5,   Method: Compositional matrix adjust.
 Identities = 29/126 (23%), Positives = 55/126 (43%), Gaps = 12/126 (9%)

Query: 162 EGLPGFFKGSIASMTTITLTASIMFGTYETIRIYCDENEKTTAAHKKWELATLNHSAGTI 221
           EG+  F++G+ A++     T ++ F   + I+       K    + KW     N ++G I
Sbjct: 69  EGIISFWRGNTANVIRYFPTQALNFAFKDQIKAMF--GFKKEEGYAKWFAG--NLASGGI 124

Query: 222 GGVIAKIITFPLETIRRRMQFMNSKHLEKFSRHSSVYGSYKGYGFARIGLQILKQEGVSS 281
            G ++ +  + L+  R R        L   ++ S   G  +  G   +  + +  +GV+ 
Sbjct: 125 AGGLSLMFVYSLDYARTR--------LAADAKSSKKGGERQFNGLVDVYKKTIASDGVAG 176

Query: 282 LYRGIL 287
           LYRG L
Sbjct: 177 LYRGFL 182

>Scas_697.47
          Length = 328

 Score = 69.3 bits (168), Expect = 3e-13,   Method: Compositional matrix adjust.
 Identities = 72/300 (24%), Positives = 132/300 (44%), Gaps = 32/300 (10%)

Query: 18  KTLLAGAVSGLLARSITAPMDTIKIRLQLTPANGLKPFGSQVMEVARS-----MIKNEGI 72
           K+L+AG V G+ A     P D IK+R Q   A+        +++ AR+     M+ N  +
Sbjct: 38  KSLVAGGVGGVCAVLTGHPFDLIKVRCQSGQASSTIHAIKIILKDARAIPTSNMLVNS-V 96

Query: 73  RSFWKGNIPGSLLYVTYGSAQFSSYSLFNRYLTPFGLEARLHSLVVGAFAG------ITS 126
           + F+KG IP  L      +  F  Y +  + +T    ++    L +G  A       I +
Sbjct: 97  KGFYKGVIPPLLGVTPIFAVSFWGYDVGKKIVTRS--DSSSAQLTMGQMAAAGFISAIPT 154

Query: 127 SIVSYPFDVLRTRLVANNQMHSMSITREVRDIWKLEGLPGFFKGSIASMTTITLTASIMF 186
           ++V+ P + ++  L         S     ++I K  G+   FKGS+A++      +++ F
Sbjct: 155 TLVTAPTERIKVVLQTAGANSKTSFIGAAKNIVKDGGVKSLFKGSLATLARDGPGSALYF 214

Query: 187 GTYETIRIYCDENEKTTAAHKKWELATLNHS-AGTIGGVIAKIITFPLETIRRRMQFMNS 245
            +YE  + + ++    TA  K  E+   N   AG I G+   ++ FP++TI+ ++Q    
Sbjct: 215 ASYEISKKFLND-RNATAESKTGEVNIANVCLAGGIAGMSMWLVVFPIDTIKTKLQ---- 269

Query: 246 KHLEKFSRHSSVYGSYKGYGFARIGLQILKQEGVSSLYRGILVALSKTIPTTFVSFWGYE 305
                    S V  + + Y         +K+ G+   + G+  AL ++ P    +F G E
Sbjct: 270 ---SSSGSQSMVAATREIY---------VKRGGIKGFFPGLGPALLRSFPANAATFLGVE 317

 Score = 60.5 bits (145), Expect = 3e-10,   Method: Compositional matrix adjust.
 Identities = 49/205 (23%), Positives = 96/205 (46%), Gaps = 27/205 (13%)

Query: 109 LEARLHSLVVGAFAGITSSIVSYPFDVLRTRL---VANNQMHSMSIT-REVRDIWK---- 160
           +   L SLV G   G+ + +  +PFD+++ R     A++ +H++ I  ++ R I      
Sbjct: 33  IRDNLKSLVAGGVGGVCAVLTGHPFDLIKVRCQSGQASSTIHAIKIILKDARAIPTSNML 92

Query: 161 LEGLPGFFKGSIASMTTITLTASIMFGTYETIRIYCDENEKTTAAHKKWELATLNHSAGT 220
           +  + GF+KG I  +  +T   ++ F  Y+  +     ++ ++A     ++A    +AG 
Sbjct: 93  VNSVKGFYKGVIPPLLGVTPIFAVSFWGYDVGKKIVTRSDSSSAQLTMGQMA----AAGF 148

Query: 221 IGGVIAKIITFPLETIRRRMQFMNSKHLEKFSRHSSVYGSYKGYGFARIGLQILKQEGVS 280
           I  +   ++T P E I+  +Q   +      +  +S  G+ K          I+K  GV 
Sbjct: 149 ISAIPTTLVTAPTERIKVVLQTAGA------NSKTSFIGAAK---------NIVKDGGVK 193

Query: 281 SLYRGILVALSKTIPTTFVSFWGYE 305
           SL++G L  L++  P + + F  YE
Sbjct: 194 SLFKGSLATLARDGPGSALYFASYE 218

>KLLA0E15532g complement(1383230..1384210) similar to sp|P23500
           Saccharomyces cerevisiae YKR052c MRS4 RNA splicing
           protein and member of the mitochondrial carrier family
           (MCF), start by similarity
          Length = 326

 Score = 68.9 bits (167), Expect = 4e-13,   Method: Compositional matrix adjust.
 Identities = 74/313 (23%), Positives = 129/313 (41%), Gaps = 43/313 (13%)

Query: 20  LLAGAVSGLLARSITAPMDTIKIRLQLTP----------------ANGLKPFGSQVMEVA 63
           L+AGA +G++  SI  P+D +K R+Q                   A+G    G+ + +++
Sbjct: 24  LIAGAFAGIMEHSIMFPIDALKTRMQAVSEIKAAASASASGGAGAASGGAGAGTLLQQIS 83

Query: 64  RSMIKNEGIRSFWKGNI-----PGSLLYVTYGSAQFSSYSLFNRYLTPFGLEARLHSLVV 118
           R +   EG  + W+G        G    V + + +F    L +     F     L + V 
Sbjct: 84  R-ISSTEGSLALWRGVQSMVMGAGPAHAVYFATYEFCKEQLIDA--KDFNTHQPLKTAVS 140

Query: 119 GAFAGITSSIVSYPFDVLRTRLVANNQMHSMSITREVRDIWKLEGLPGFFKGSIASMTTI 178
           G  A + +  +  PFD ++ RL   ++    S+ R   +I+K EG   FF     ++   
Sbjct: 141 GVAATVAADALMNPFDTIKQRLQLQSKSSDSSMWRMAFNIYKNEGPMAFFYSYPTTLAMN 200

Query: 179 TLTASIMFGTYETIRIYCDENEKTTAAHKKWELATLNHSAGTIGGVIAKIITFPLETIRR 238
              A++ F  YE+   + +     T A+  W    ++   G I G     +T PL+ I+ 
Sbjct: 201 IPFAALNFVIYESSTKFFNP----TNAYNPW----IHCLCGGIAGATCAAVTTPLDCIKT 252

Query: 239 RMQFMNSK--HLEKFSRHSSVYGSYKGYGFARIGLQILKQEGVSSLYRGILVALSKTIPT 296
            +Q   S   H+E F   ++         F +    I +  G    +RG+   +   IP 
Sbjct: 253 VLQIRGSDTVHVESFKTANT---------FKKAAQAIWQSYGWKGFWRGLQPRVISNIPA 303

Query: 297 TFVSFWGYETAIH 309
           T +S+  YE A H
Sbjct: 304 TAISWTSYEFAKH 316

 Score = 55.1 bits (131), Expect = 2e-08,   Method: Compositional matrix adjust.
 Identities = 42/181 (23%), Positives = 82/181 (45%), Gaps = 12/181 (6%)

Query: 18  KTLLAGAVSGLLARSITAPMDTIKIRLQLTPANGLKPFGSQVMEVARSMIKNEGIRSFWK 77
           KT ++G  + + A ++  P DTIK RLQL      K   S +  +A ++ KNEG  +F+ 
Sbjct: 136 KTAVSGVAATVAADALMNPFDTIKQRLQLQS----KSSDSSMWRMAFNIYKNEGPMAFFY 191

Query: 78  GNIPGSLLYVTYGSAQFSSYSLFNRYLTPFGLEARLHSLVVGAFAGITSSIVSYPFDVLR 137
                  + + + +  F  Y    ++  P          + G  AG T + V+ P D ++
Sbjct: 192 SYPTTLAMNIPFAALNFVIYESSTKFFNPTNAYNPWIHCLCGGIAGATCAAVTTPLDCIK 251

Query: 138 T--RLVANNQMH------SMSITREVRDIWKLEGLPGFFKGSIASMTTITLTASIMFGTY 189
           T  ++  ++ +H      + +  +  + IW+  G  GF++G    + +     +I + +Y
Sbjct: 252 TVLQIRGSDTVHVESFKTANTFKKAAQAIWQSYGWKGFWRGLQPRVISNIPATAISWTSY 311

Query: 190 E 190
           E
Sbjct: 312 E 312

 Score = 53.1 bits (126), Expect = 9e-08,   Method: Compositional matrix adjust.
 Identities = 49/216 (22%), Positives = 91/216 (42%), Gaps = 45/216 (20%)

Query: 114 HSLVVGAFAGITSSIVSYPFDVLRTRLVANNQMH-------------------SMSITRE 154
           + L+ GAFAGI    + +P D L+TR+ A +++                    + ++ ++
Sbjct: 22  YQLIAGAFAGIMEHSIMFPIDALKTRMQAVSEIKAAASASASGGAGAASGGAGAGTLLQQ 81

Query: 155 VRDIWKLEGLPGFFKGSIASMTTITLTASIMFGTYETIRIYCDE---NEKTTAAHKKWEL 211
           +  I   EG    ++G  + +       ++ F TYE    +C E   + K    H+  + 
Sbjct: 82  ISRISSTEGSLALWRGVQSMVMGAGPAHAVYFATYE----FCKEQLIDAKDFNTHQPLKT 137

Query: 212 ATLNHSAGTIGGVIAKIITFPLETIRRRMQFMNSKHLEKFSRHSSVYGSYKGYGFARIGL 271
           A     +G    V A  +  P +TI++R+Q      L+  S  SS++         R+  
Sbjct: 138 AV----SGVAATVAADALMNPFDTIKQRLQ------LQSKSSDSSMW---------RMAF 178

Query: 272 QILKQEGVSSLYRGILVALSKTIPTTFVSFWGYETA 307
            I K EG  + +      L+  IP   ++F  YE++
Sbjct: 179 NIYKNEGPMAFFYSYPTTLAMNIPFAALNFVIYESS 214

 Score = 39.3 bits (90), Expect = 0.003,   Method: Compositional matrix adjust.
 Identities = 23/97 (23%), Positives = 49/97 (50%), Gaps = 13/97 (13%)

Query: 17  WKTLLAGAVSGLLARSITAPMDTIKIRLQLTPANGLK----PFGSQVMEVARSMIKNEGI 72
           W   L G ++G    ++T P+D IK  LQ+  ++ +        +   + A+++ ++ G 
Sbjct: 227 WIHCLCGGIAGATCAAVTTPLDCIKTVLQIRGSDTVHVESFKTANTFKKAAQAIWQSYGW 286

Query: 73  RSFWKG-------NIPGSLLYVTYGSAQFSSYSLFNR 102
           + FW+G       NIP +   +++ S +F+ + LF +
Sbjct: 287 KGFWRGLQPRVISNIPATA--ISWTSYEFAKHLLFTK 321

>AER184W [2686] [Homologous to ScYBL030C (PET9) - SH; ScYBR085W
           (AAC3) - SH] complement(978781..979698) [918 bp, 305 aa]
          Length = 305

 Score = 68.6 bits (166), Expect = 4e-13,   Method: Compositional matrix adjust.
 Identities = 61/291 (20%), Positives = 128/291 (43%), Gaps = 50/291 (17%)

Query: 19  TLLAGAVSGLLARSITAPMDTIKIRLQ----LTPANGLKPFGSQVMEVARSMIKNEGIRS 74
             + G VS  ++++  AP++ +K+ +Q    +     L    + +++  +    +EG+ S
Sbjct: 12  NFMMGGVSAAVSKTAAAPIERVKLLIQNQDEMLKQGSLDRRYNGIVDCFKRTAASEGVIS 71

Query: 75  FWKGNIPGSLLYVTYGSAQFSSYSLFNRYLTPFGLEARLH--------SLVVGAFAGITS 126
           FW+GN    + Y      Q  +++  ++    FG    +         +L  G  AG  S
Sbjct: 72  FWRGNTANVIRYFP---TQALNFAFKDKIKAMFGFRKEVDGYAKWFAGNLASGGAAGGLS 128

Query: 127 SIVSYPFDVLRTRLVANNQMHSMSITREVR---DIWKL----EGLPGFFKGSIASMTTIT 179
            +  Y  D  RTRL A+++       R+     D++K     +G+ G ++G + S+  I 
Sbjct: 129 LLFVYSLDYARTRLAADSKSAKKGGERQFNGLVDVYKKTLASDGIAGLYRGFLPSVVGIV 188

Query: 180 LTASIMFGTYETIR--IYCDENEKTTAAH--KKWELATLNHSAGTIGGVIAKIITFPLET 235
           +   + FG Y++++  +     E +  A     W + T   +A           ++PL+T
Sbjct: 189 VYRGLYFGMYDSLKPLLLTGNLESSFIASFLLGWAVTTGASTA-----------SYPLDT 237

Query: 236 IRRRMQFMNSKHLEKFSRHSSVYGSYKGYGFARIGLQILKQEGVSSLYRGI 286
           +RRRM   + + +    ++   + +++         +I+  EGV SL++G 
Sbjct: 238 VRRRMMMTSGQAV----KYDGAFDAFR---------KIVAAEGVKSLFKGC 275

 Score = 33.1 bits (74), Expect = 0.22,   Method: Compositional matrix adjust.
 Identities = 43/185 (23%), Positives = 80/185 (43%), Gaps = 23/185 (12%)

Query: 113 LHSLVVGAFAGITSSIVSYPFDVLRTRLVANNQ---MHSMSITRE---VRDIWKL----E 162
           L + ++G  +   S   + P +  R +L+  NQ   +   S+ R    + D +K     E
Sbjct: 10  LINFMMGGVSAAVSKTAAAPIE--RVKLLIQNQDEMLKQGSLDRRYNGIVDCFKRTAASE 67

Query: 163 GLPGFFKGSIASMTTITLTASIMFGTYETIRIYCDENEKTTAAHKKWELATLNHSAGTIG 222
           G+  F++G+ A++     T ++ F   + I+       K    + KW    L  S G  G
Sbjct: 68  GVISFWRGNTANVIRYFPTQALNFAFKDKIKAMFGF-RKEVDGYAKWFAGNL-ASGGAAG 125

Query: 223 GVIAKIITFPLETIRRRMQFMNSKHLEKFSRHSSVYGSYKGYGFARIGLQILKQEGVSSL 282
           G ++ +  + L+  R R+   +SK  +K        G  +  G   +  + L  +G++ L
Sbjct: 126 G-LSLLFVYSLDYARTRLA-ADSKSAKK-------GGERQFNGLVDVYKKTLASDGIAGL 176

Query: 283 YRGIL 287
           YRG L
Sbjct: 177 YRGFL 181

>YOR222W (ODC2) [5014] chr15 (758330..759253) 2-Oxodicarboxylate
           transporter, specific for 2-oxoadipate and
           2-oxoglutarate, member of the mitochondrial carrier
           family (MCF) of membrane transporters [924 bp, 307 aa]
          Length = 307

 Score = 68.6 bits (166), Expect = 5e-13,   Method: Compositional matrix adjust.
 Identities = 65/291 (22%), Positives = 128/291 (43%), Gaps = 37/291 (12%)

Query: 20  LLAGAVSGLLARSITAPMDTIKIRLQL---TPANGLKPFGSQ------VMEVARSMIKNE 70
            ++GAV+G+   ++  P+D +K R QL   TP       G Q      V++  + ++K E
Sbjct: 16  FISGAVAGISELTVMYPLDVVKTRFQLEVTTPTAA--AVGKQVERYNGVIDCLKKIVKKE 73

Query: 71  GIRSFWKGNIPGSLLYVTYGSAQFSSYSLFNR-YLTPFGLEARLH--SLVVGAFAGITSS 127
           G    ++G     L+     + +F+    + + +   F         S+  GA AG+T +
Sbjct: 74  GFSRLYRGISSPMLMEAPKRATKFACNDQYQKIFKNLFNTNETTQKISIAAGASAGMTEA 133

Query: 128 IVSYPFDVLRTRL--VANNQMHSMSITREVRDIWKLEGLPGFFKGSIASMTTITLTASIM 185
            V  PF++++ R+  V ++ +  M   ++     K EG+ G +KG  ++M    L     
Sbjct: 134 AVIVPFELIKIRMQDVKSSYLGPMDCLKKT---IKNEGIMGLYKGIESTMWRNALWNGGY 190

Query: 186 FGTYETIRIYCDENEKTTAAHKKWELATLNHSAGTIGGVIAKIITFPLETIRRRMQFMNS 245
           FG    +R           A  K +    +  AG IGG +  ++  P + ++ R+Q ++ 
Sbjct: 191 FGVIYQVR------NSMPVAKTKGQKTRNDLIAGAIGGTVGTMLNTPFDVVKSRIQSVD- 243

Query: 246 KHLEKFSRHSSVYGSYKGYGFARIGLQIL-KQEGVSSLYRGILVALSKTIP 295
                     +V  + K Y +    L ++ ++EG  +LY+G +  + +  P
Sbjct: 244 ----------AVSSAVKKYNWCLPSLLVIYREEGFRALYKGFVPKVCRLAP 284

 Score = 52.4 bits (124), Expect = 1e-07,   Method: Compositional matrix adjust.
 Identities = 43/177 (24%), Positives = 82/177 (46%), Gaps = 16/177 (9%)

Query: 19  TLLAGAVSGLLARSITAPMDTIKIRLQLTPANGLKPFGSQVMEVARSMIKNEGIRSFWKG 78
           ++ AGA +G+   ++  P + IKIR+Q   ++ L P     M+  +  IKNEGI   +KG
Sbjct: 121 SIAAGASAGMTEAAVIVPFELIKIRMQDVKSSYLGP-----MDCLKKTIKNEGIMGLYKG 175

Query: 79  NIPGSLLYVTYGSAQFSSYSLFNRYLTPF----GLEARLHSLVVGAFAGITSSIVSYPFD 134
            I  ++      +  +       R   P     G + R + L+ GA  G   ++++ PFD
Sbjct: 176 -IESTMWRNALWNGGYFGVIYQVRNSMPVAKTKGQKTR-NDLIAGAIGGTVGTMLNTPFD 233

Query: 135 VLRTRLVANNQMHSMS-----ITREVRDIWKLEGLPGFFKGSIASMTTITLTASIMF 186
           V+++R+ + + + S           +  I++ EG    +KG +  +  +    S+M 
Sbjct: 234 VVKSRIQSVDAVSSAVKKYNWCLPSLLVIYREEGFRALYKGFVPKVCRLAPGGSLML 290

 Score = 42.7 bits (99), Expect = 2e-04,   Method: Compositional matrix adjust.
 Identities = 42/185 (22%), Positives = 68/185 (36%), Gaps = 32/185 (17%)

Query: 113 LHSLVVGAFAGITSSIVSYPFDVLRTRL-----------VANNQMHSMSITREVRDIWKL 161
           ++  + GA AGI+   V YP DV++TR            V         +   ++ I K 
Sbjct: 13  IYQFISGAVAGISELTVMYPLDVVKTRFQLEVTTPTAAAVGKQVERYNGVIDCLKKIVKK 72

Query: 162 EGLPGFFKGSIASMTTITLTASIMFGTYETIRIYCDENEKTTAAHKKWELATLNHSAGTI 221
           EG    ++G  + M       +  F   +  +        T    +K  +A     AG  
Sbjct: 73  EGFSRLYRGISSPMLMEAPKRATKFACNDQYQKIFKNLFNTNETTQKISIA-----AGAS 127

Query: 222 GGVIAKIITFPLETIRRRMQFMNSKHLEKFSRHSSVYGSYKGYGFARIGLQILKQEGVSS 281
            G+    +  P E I+ RMQ + S +L                G      + +K EG+  
Sbjct: 128 AGMTEAAVIVPFELIKIRMQDVKSSYL----------------GPMDCLKKTIKNEGIMG 171

Query: 282 LYRGI 286
           LY+GI
Sbjct: 172 LYKGI 176

 Score = 33.9 bits (76), Expect = 0.15,   Method: Compositional matrix adjust.
 Identities = 25/90 (27%), Positives = 43/90 (47%), Gaps = 13/90 (14%)

Query: 10  KGQNVAAWKTLLAGAVSGLLARSITAPMDTIKIRLQLTPA--NGLKPFGSQVMEVARSMI 67
           KGQ       L+AGA+ G +   +  P D +K R+Q   A  + +K + +  +     + 
Sbjct: 207 KGQKTR--NDLIAGAIGGTVGTMLNTPFDVVKSRIQSVDAVSSAVKKY-NWCLPSLLVIY 263

Query: 68  KNEGIRSFWKGNIP--------GSLLYVTY 89
           + EG R+ +KG +P        GSL+ V +
Sbjct: 264 REEGFRALYKGFVPKVCRLAPGGSLMLVVF 293

>KLLA0B08503g complement(753498..754409) similar to sp|P32331
           Saccharomyces cerevisiae YPR058w YMC1 mitochondrial
           carrier protein (MCF), start by similarity
          Length = 303

 Score = 68.6 bits (166), Expect = 5e-13,   Method: Compositional matrix adjust.
 Identities = 74/303 (24%), Positives = 125/303 (41%), Gaps = 28/303 (9%)

Query: 12  QNVAAWKTLLAGAVSGLLARSITAPMDTIKIRLQLTPANGLKPFGSQVMEVARSMIKNEG 71
            N    K LLAG   G+    +  P DT K+RLQ +  +      +  ++V + +IKNEG
Sbjct: 19  DNTRVIKDLLAGTAGGIAQVLVGQPFDTTKVRLQTSETS------TNAVKVIKDLIKNEG 72

Query: 72  IRSFWKGNIPGSLLYVTYGSAQFSSYSLFNRYLTPFGLEARLH-SL----VVGAFAGITS 126
              F+KG +   +      S QF       R+   F   A  H SL    + G   G T+
Sbjct: 73  PMGFYKGTLTPLVGVGACVSLQFGVNEAMKRFFHTFDEAASQHLSLLQYYICGVAGGFTN 132

Query: 127 SIVSYPFDVLRTRLVANNQMHSMSITREVRD-IWKLEGLPGFFKGSIASMTTITLTASIM 185
           S ++ P + +R RL       + +  +   D I KL       +G   +M   +    + 
Sbjct: 133 SFLASPIEHIRIRLQTQTGSGATAEFKGPIDCIKKLRVNGQLMRGLTPTMLRESHGCGVY 192

Query: 186 FGTYETIRIYCDENEKTTAAHKKWELATLNHSAGTIGGVIAKIITFPLETIRRRMQFMNS 245
           F TYE +  +  ++         W+L     ++GT+       + +PL+ I+  MQ  N 
Sbjct: 193 FLTYEALIGHQVKSGIQRKDIPAWKLCLFGAASGTL----LWTMVYPLDVIKSVMQTDNL 248

Query: 246 KHLEKFSRHSSVYGSYKGYGFARIGLQILKQEGVSSLYRGILVALSKTIPTTFVSFWGYE 305
           K  +             G     +G  I+ ++GVS L++G    + +  P    +F  +E
Sbjct: 249 KTPKN------------GNNILTVGRTIIARQGVSGLFKGFAPTMLRAAPANAATFATFE 296

Query: 306 TAI 308
           TA+
Sbjct: 297 TAM 299

 Score = 59.7 bits (143), Expect = 5e-10,   Method: Compositional matrix adjust.
 Identities = 38/152 (25%), Positives = 70/152 (46%), Gaps = 7/152 (4%)

Query: 91  SAQFSSYSLFNRYLTPFGLEARLHSLVVGAFAGITSSIVSYPFDVLRTRLVANNQMHSMS 150
           + +F +  L +   +P      +  L+ G   GI   +V  PFD  + RL  +    S +
Sbjct: 2   TEEFPTPQLIDDLESPHDNTRVIKDLLAGTAGGIAQVLVGQPFDTTKVRLQTSET--STN 59

Query: 151 ITREVRDIWKLEGLPGFFKGSIASMTTITLTASIMFGTYETIRIYCDENEKTTAAHKKWE 210
             + ++D+ K EG  GF+KG++  +  +    S+ FG  E ++ +    ++  + H    
Sbjct: 60  AVKVIKDLIKNEGPMGFYKGTLTPLVGVGACVSLQFGVNEAMKRFFHTFDEAASQH---- 115

Query: 211 LATLNHS-AGTIGGVIAKIITFPLETIRRRMQ 241
           L+ L +   G  GG     +  P+E IR R+Q
Sbjct: 116 LSLLQYYICGVAGGFTNSFLASPIEHIRIRLQ 147

>Kwal_47.18216
          Length = 333

 Score = 68.6 bits (166), Expect = 5e-13,   Method: Compositional matrix adjust.
 Identities = 79/325 (24%), Positives = 132/325 (40%), Gaps = 57/325 (17%)

Query: 20  LLAGAVSGLLARSITAPMDTIKIRLQL---TPANGLKPFGSQVMEVARSMIKNEGIRSFW 76
           L+AG  +GL       P+DTIK+R+Q+       G +  G   +  AR +   EG  + +
Sbjct: 14  LVAGGTAGLFEALCCHPLDTIKVRMQIYSRAREQGQRARG--FIGTARDISTQEGFLALY 71

Query: 77  KGNIPGSLLYVTYGSAQFSSYSLFNRYLTP--FGLEARLHSLVVGAFAGITSSI-VSYPF 133
           KG     +  +   + +F+SY  F   L     G+ +  ++ V G  AGIT ++ V  P 
Sbjct: 72  KGLGAVVIGIIPKMAIRFTSYEFFRTLLADRQTGVVSTGNTFVAGVGAGITEAVMVVNPM 131

Query: 134 DVLRTRLVANN--------------------------QMHSMSITREVRD-------IWK 160
           +V++ RL A +                             +++ T + R+       I K
Sbjct: 132 EVVKIRLQAQHVRYVPLKAQLAGSVTSSSATFSSATTATENVAATPKYRNAIQAAYVIVK 191

Query: 161 LEGLPGFFKGSIASMTTITLTASIMFGTYETIRIYCDENEKTTAAHKKWELATLNHSAGT 220
            EG    ++G   +           F  Y T++    E  +T      WE + +    G 
Sbjct: 192 EEGPRALYRGVSLTAARQATNQGANFTVYSTLKSRLQEYHQTDML-PSWETSLI----GL 246

Query: 221 IGGVIAKIITFPLETIRRRMQFMNSKHLEKFSRHSSVYGSYKGYGFARIGLQILKQEGVS 280
           I G +      PL+TI+ R+Q    K   K S  S +           IG Q++++EG  
Sbjct: 247 ISGALGPFSNAPLDTIKTRLQ--KDKSTSKDSGWSRILA---------IGRQLIREEGFR 295

Query: 281 SLYRGILVALSKTIPTTFVSFWGYE 305
           +LY+GI   + +  P   V+F  YE
Sbjct: 296 ALYKGITPRVMRVAPGQAVTFTVYE 320

 Score = 55.5 bits (132), Expect = 1e-08,   Method: Compositional matrix adjust.
 Identities = 33/98 (33%), Positives = 50/98 (51%), Gaps = 2/98 (2%)

Query: 16  AWKTLLAGAVSGLLARSITAPMDTIKIRLQLTPANGLKPFGSQVMEVARSMIKNEGIRSF 75
           +W+T L G +SG L     AP+DTIK RLQ   +       S+++ + R +I+ EG R+ 
Sbjct: 238 SWETSLIGLISGALGPFSNAPLDTIKTRLQKDKSTSKDSGWSRILAIGRQLIREEGFRAL 297

Query: 76  WKGNIPGSLLYVTYGSAQFSSYSLFNRYLTPFGLEARL 113
           +KG  P  +      +  F+ Y L  + L   GL A L
Sbjct: 298 YKGITPRVMRVAPGQAVTFTVYELIRKKLE--GLTAPL 333

 Score = 42.0 bits (97), Expect = 3e-04,   Method: Compositional matrix adjust.
 Identities = 51/226 (22%), Positives = 91/226 (40%), Gaps = 50/226 (22%)

Query: 115 SLVVGAFAGITSSIVSYPFDVLRTRLVANNQMHSMSITRE-----------VRDIWKLEG 163
           +LV G  AG+  ++  +P D ++ R+    Q++S +  RE            RDI   EG
Sbjct: 13  NLVAGGTAGLFEALCCHPLDTIKVRM----QIYSRA--REQGQRARGFIGTARDISTQEG 66

Query: 164 LPGFFKGSIASMTTITLTASIMFGTYETIRIYCDENEKTTAAHKKWELATLNHSAGTIGG 223
               +KG  A +  I    +I F +YE  R    + +          ++T N     +G 
Sbjct: 67  FLALYKGLGAVVIGIIPKMAIRFTSYEFFRTLLADRQTGV-------VSTGNTFVAGVGA 119

Query: 224 VI--AKIITFPLETIRRRMQFMNSKHLEKFSRHSSVYGSYKGYGFA-------------- 267
            I  A ++  P+E ++ R+Q   ++H+      + + GS                     
Sbjct: 120 GITEAVMVVNPMEVVKIRLQ---AQHVRYVPLKAQLAGSVTSSSATFSSATTATENVAAT 176

Query: 268 ---RIGLQ----ILKQEGVSSLYRGILVALSKTIPTTFVSFWGYET 306
              R  +Q    I+K+EG  +LYRG+ +  ++       +F  Y T
Sbjct: 177 PKYRNAIQAAYVIVKEEGPRALYRGVSLTAARQATNQGANFTVYST 222

 Score = 41.2 bits (95), Expect = 5e-04,   Method: Compositional matrix adjust.
 Identities = 48/218 (22%), Positives = 82/218 (37%), Gaps = 39/218 (17%)

Query: 14  VAAWKTLLAGAVSGLL-ARSITAPMDTIKIRLQLTPANGLKPFGSQV------------- 59
           V+   T +AG  +G+  A  +  PM+ +KIRLQ      + P  +Q+             
Sbjct: 107 VSTGNTFVAGVGAGITEAVMVVNPMEVVKIRLQAQHVRYV-PLKAQLAGSVTSSSATFSS 165

Query: 60  -----------------MEVARSMIKNEGIRSFWKGNIPGSLLYVTYGSAQFSSYSLFNR 102
                            ++ A  ++K EG R+ ++G    +    T   A F+ YS    
Sbjct: 166 ATTATENVAATPKYRNAIQAAYVIVKEEGPRALYRGVSLTAARQATNQGANFTVYSTLKS 225

Query: 103 YLTPFGLEARLHS---LVVGAFAGITSSIVSYPFDVLRTRLVANNQMHSMS----ITREV 155
            L  +     L S    ++G  +G      + P D ++TRL  +      S    I    
Sbjct: 226 RLQEYHQTDMLPSWETSLIGLISGALGPFSNAPLDTIKTRLQKDKSTSKDSGWSRILAIG 285

Query: 156 RDIWKLEGLPGFFKGSIASMTTITLTASIMFGTYETIR 193
           R + + EG    +KG    +  +    ++ F  YE IR
Sbjct: 286 RQLIREEGFRALYKGITPRVMRVAPGQAVTFTVYELIR 323

 Score = 38.9 bits (89), Expect = 0.004,   Method: Compositional matrix adjust.
 Identities = 28/92 (30%), Positives = 40/92 (43%), Gaps = 10/92 (10%)

Query: 214 LNHSAGTIGGVIAKIITFPLETIRRRMQFMNSKHLEKFSRHSSVYGSYKGYGFARIGLQI 273
           +N  AG   G+   +   PL+TI+ RMQ   S+  E+  R           GF      I
Sbjct: 12  INLVAGGTAGLFEALCCHPLDTIKVRMQIY-SRAREQGQR---------ARGFIGTARDI 61

Query: 274 LKQEGVSSLYRGILVALSKTIPTTFVSFWGYE 305
             QEG  +LY+G+   +   IP   + F  YE
Sbjct: 62  STQEGFLALYKGLGAVVIGIIPKMAIRFTSYE 93

>Kwal_27.12081
          Length = 369

 Score = 68.9 bits (167), Expect = 6e-13,   Method: Compositional matrix adjust.
 Identities = 83/320 (25%), Positives = 136/320 (42%), Gaps = 69/320 (21%)

Query: 33  ITAPMDTIKIRLQL-----TPAN------------GLKPFGSQVMEVARSMIKNEGIRSF 75
           +T P D +K RLQ      T AN            G++ F  +   +  ++ K EG RS 
Sbjct: 69  VTCPFDVVKTRLQSDVFQSTYANLSHNKSSNVVSSGIRHF-RETFGIISNLYKLEGFRSL 127

Query: 76  WKGNIPG--------SLLYVTYGSAQFSSYSLFNRYLTPFGLEARLHSLVVGAFAGITSS 127
           +KG  P         S+ + TYG+ +      FN      G EA    L+  A AG  +S
Sbjct: 128 FKGLGPNLVGVIPARSINFFTYGTTKQIYSRAFNN-----GEEAPWIHLISAATAGWATS 182

Query: 128 IVSYPFDVLRTRLVANNQMHSMSITREVRDIWKL-------EGLPGFFKGSIASMTTITL 180
             + P  +++TRL  +   H    TR+ ++ W         EG  G +KG  AS    ++
Sbjct: 183 TATNPIWLIKTRLQLDKAGH----TRQYKNSWDCLKHIIQKEGFFGLYKGLSASYLG-SV 237

Query: 181 TASIMFGTYETIRI-----------YCDENEKTTAAHKKWELATLNHSAGTIGGVIAKII 229
              + +  YE ++            +  E EK T+   K E    + SAG +   +A I+
Sbjct: 238 EGILQWLLYEQMKQMIKMRSIEKFGHISEGEKNTSEKIK-EWCQRSGSAG-LAKFLASIV 295

Query: 230 TFPLETIRRRMQFMNSKHLEKFSRHSSVYGSYKGY-GFARIGLQILKQEGVSSLYRGILV 288
           T+P E +R R+            R + +      Y G  +    I+K+EG++S+Y G+  
Sbjct: 296 TYPHEVVRTRL------------RQAPLENDKLKYTGLIQSFRVIIKEEGLASMYGGLTP 343

Query: 289 ALSKTIPTTFVSFWGYETAI 308
            L +T+P + + F  +E  I
Sbjct: 344 HLLRTVPNSIIMFGTWELVI 363

>ADL264C [1477] [Homologous to ScYOR100C (CRC1) - SH]
           (241532..242521) [990 bp, 329 aa]
          Length = 329

 Score = 68.6 bits (166), Expect = 6e-13,   Method: Compositional matrix adjust.
 Identities = 72/297 (24%), Positives = 127/297 (42%), Gaps = 36/297 (12%)

Query: 18  KTLLAGAVSGLLARSITAPMDTIKIRLQLTPANGLKPFGSQVMEVARSMIKNEGI---RS 74
           K+L AGAV G+ A     P D +K+R Q   A+G      +++  AR+      +   R 
Sbjct: 49  KSLAAGAVGGVCAVLTGHPFDLLKVRCQSNQASGTVDAVRKILVEARAQSGLSAVNMMRG 108

Query: 75  FWKGNIPGSLLYVTYGSAQFSSYSLFNRYLTPFGLEARLHS---LVVGAFAGITSSIVSY 131
           F+KG IP  L      +  F  Y +  + +T      +L +      G  + I +++V  
Sbjct: 109 FYKGVIPPLLGVTPIFAVSFWGYDVGKKLVTWNDNSGKLTTAQLATAGFISAIPTTLVMA 168

Query: 132 PFDVLRTRLVANNQMHSMSITREVRDIWKLEGLPGFFKGSIASMTTITLTASIMFGTYET 191
           P +  R ++V   Q +  S+    + I    G+   F+GS+A++      +++ F +YE 
Sbjct: 169 PTE--RVKVVLQTQSNH-SLGSAAKHILATGGVRSLFRGSLATLARDGPGSALYFASYEA 225

Query: 192 IRIYCDENEKTTAAHKKWELATLNHS-AGTIGGVIAKIITFPLETIRRRMQFMNSKH--L 248
            + Y +    T       EL+  N   AG + GV   +  FP++TI+  +Q  N++   +
Sbjct: 226 TKAYLNARSGTN------ELSIKNVCLAGGMAGVSMWVGVFPIDTIKTELQSSNTRQTMM 279

Query: 249 EKFSRHSSVYGSYKGYGFARIGLQILKQEGVSSLYRGILVALSKTIPTTFVSFWGYE 305
           E   +  +  G  KG+                  + GI  AL ++ P    +F G E
Sbjct: 280 EATRKIYNTRGGIKGF------------------FPGIGPALLRSFPANAATFLGVE 318

>AEL253W [2253] [Homologous to ScYBR192W (RIM2) - SH]
           complement(164665..165762) [1098 bp, 365 aa]
          Length = 365

 Score = 68.6 bits (166), Expect = 7e-13,   Method: Compositional matrix adjust.
 Identities = 89/347 (25%), Positives = 149/347 (42%), Gaps = 66/347 (19%)

Query: 5   EDSLRKGQNVAAWKTLLAGAVSGLLARSITAPMDTIKIRLQ--------LTPA------- 49
           E+      +VA W   +AG + G+    IT P D +K RLQ         T A       
Sbjct: 38  ENKKENHPHVAPWVHFVAGGIGGMAGAIITCPFDVVKTRLQSDVFHGAYKTQATARTNVV 97

Query: 50  -NGLKPFGSQVMEVARSMIKNEGIRSFWKG---NIPG-----SLLYVTYGSAQFSSYSLF 100
             GL  F  + + + +++   EG RS +KG   N+ G     S+ + TYG  + ++  L 
Sbjct: 98  YQGLMHF-RETVGIIQNVYTQEGFRSLFKGLGPNLVGVIPARSINFFTYGVTKDTASRLL 156

Query: 101 NRYLTPFGLEARLHSLVVGAFAGITSSIVSYPFDVLRTRLVANNQMHSMSITREVRDIWK 160
           N      G EA     + GA AG  +S  + P  +++TRL  +      S  R  ++ W 
Sbjct: 157 ND-----GQEAPWIHFLAGATAGWATSTATNPIWLVKTRLQLDKAADGRS--RRYKNSWD 209

Query: 161 L-------EGLPGFFKGSIASMTTITLTASIMFGTYETIR------------IYCDENEK 201
                   EG+ G +KG  AS    ++ + + +  YE ++               +EN+ 
Sbjct: 210 CLKGVMRNEGILGLYKGLSASYLG-SVESILQWVLYEQMKHIIRQRSIEEFGDISEENKT 268

Query: 202 TTAAHKKWELATLNHSAGTIGGVIAKIITFPLETIRRRMQFMNSKHLEKFSRHSSVYGSY 261
           T    K+W     + SAG    + A I+T+P E +R R++    ++           G  
Sbjct: 269 TYMKVKEW--CQRSGSAGA-AKLFASILTYPHEVVRTRLRQAPKEN-----------GKL 314

Query: 262 KGYGFARIGLQILKQEGVSSLYRGILVALSKTIPTTFVSFWGYETAI 308
           K  G  +    I+K+EG +S+Y G+   L +T+P + + F  +E  I
Sbjct: 315 KYTGLFQSFSLIIKEEGFASMYSGLTPHLMRTVPNSIIMFGTWELVI 361

>YBL030C (PET9) [164] chr2 complement(163006..163962) ADP/ATP
           carrier protein of the mitochondrial carrier family
           (MCF) of membrane transporters [957 bp, 318 aa]
          Length = 318

 Score = 68.2 bits (165), Expect = 8e-13,   Method: Compositional matrix adjust.
 Identities = 63/288 (21%), Positives = 127/288 (44%), Gaps = 47/288 (16%)

Query: 20  LLAGAVSGLLARSITAPMDTIKIRLQ----LTPANGLKPFGSQVMEVARSMIKNEGIRSF 75
            L G VS  +A++  +P++ +K+ +Q    +     L    + +++  +     EG+ SF
Sbjct: 27  FLMGGVSAAVAKTAASPIERVKLLIQNQDEMLKQGTLDRKYAGILDCFKRTATQEGVISF 86

Query: 76  WKGNIPGSLLYVTYGSAQFSSYSLFNRYLTPFGLEAR-------LHSLVVGAFAGITSSI 128
           W+GN    + Y      Q  +++  ++    FG +           +L  G  AG  S +
Sbjct: 87  WRGNTANVIRYF---PTQALNFAFKDKIKAMFGFKKEEGYAKWFAGNLASGGAAGALSLL 143

Query: 129 VSYPFDVLRTRLVANNQMHSMSITREVR---DIWKL----EGLPGFFKGSIASMTTITLT 181
             Y  D  RTRL A+++       R+     D++K     +G+ G ++G + S+  I + 
Sbjct: 144 FVYSLDYARTRLAADSKSSKKGGARQFNGLIDVYKKTLKSDGVAGLYRGFLPSVVGIVVY 203

Query: 182 ASIMFGTYETIRIYCDENEKTTAAHKKWELATLNHSAGTIGGVI---AKIITFPLETIRR 238
             + FG Y++++         T + +   LA+       +G V+   A   ++PL+T+RR
Sbjct: 204 RGLYFGMYDSLKPLL-----LTGSLEGSFLASF-----LLGWVVTTGASTCSYPLDTVRR 253

Query: 239 RMQFMNSKHLEKFSRHSSVYGSYKGYGFARIGLQILKQEGVSSLYRGI 286
           RM   + + +    ++   +   +         +I+  EGV SL++G 
Sbjct: 254 RMMMTSGQAV----KYDGAFDCLR---------KIVAAEGVGSLFKGC 288

 Score = 35.0 bits (79), Expect = 0.060,   Method: Compositional matrix adjust.
 Identities = 41/185 (22%), Positives = 80/185 (43%), Gaps = 24/185 (12%)

Query: 113 LHSLVVGAFAGITSSIVSYPFDVLRTRLVANNQ---MHSMSITRE---VRDIWK----LE 162
           L   ++G  +   +   + P +  R +L+  NQ   +   ++ R+   + D +K     E
Sbjct: 24  LIDFLMGGVSAAVAKTAASPIE--RVKLLIQNQDEMLKQGTLDRKYAGILDCFKRTATQE 81

Query: 163 GLPGFFKGSIASMTTITLTASIMFGTYETIRIYCDENEKTTAAHKKWELATLNHSAGTIG 222
           G+  F++G+ A++     T ++ F   + I+       K    + KW     N ++G   
Sbjct: 82  GVISFWRGNTANVIRYFPTQALNFAFKDKIKAMF--GFKKEEGYAKWFAG--NLASGGAA 137

Query: 223 GVIAKIITFPLETIRRRMQFMNSKHLEKFSRHSSVYGSYKGYGFARIGLQILKQEGVSSL 282
           G ++ +  + L+  R R        L   S+ S   G+ +  G   +  + LK +GV+ L
Sbjct: 138 GALSLLFVYSLDYARTR--------LAADSKSSKKGGARQFNGLIDVYKKTLKSDGVAGL 189

Query: 283 YRGIL 287
           YRG L
Sbjct: 190 YRGFL 194

>Scas_667.22
          Length = 306

 Score = 67.8 bits (164), Expect = 1e-12,   Method: Compositional matrix adjust.
 Identities = 74/309 (23%), Positives = 122/309 (39%), Gaps = 35/309 (11%)

Query: 10  KGQNVAAWKTLLAGAVSGLLARSITAPMDTIKIRLQL--TPANGLKPFGSQVMEVARSMI 67
           K  N    K LLAG   G+    +  P DT K+RLQ   TP        +  MEV R ++
Sbjct: 19  KHDNARVIKDLLAGTAGGIAQVLVGQPFDTTKVRLQTSSTP--------TTAMEVIRKLL 70

Query: 68  KNEGIRSFWKGNIPGSLLYVTYGSAQFSSYSLFNRYLTPFGLEARLHSL------VVGAF 121
           KNEG + F+KG +   +      S QF       R+      ++    L      + G  
Sbjct: 71  KNEGPKGFYKGTLTPLIGVGACVSLQFGVNEAMKRFFHSRNPDSTSQILSLPQYYICGLT 130

Query: 122 AGITSSIVSYPFDVLRTRL-VANNQMHSMSITREVRDIWKLEGLPGFFKGSIASMTTITL 180
            GIT+S ++ P + +R RL        ++     +  I KL    GF +G   +M     
Sbjct: 131 GGITNSFLASPIEHVRIRLQTQTGSGPNVEFKGPLDCIRKLRAQGGFMRGLTPTMLREGH 190

Query: 181 TASIMFGTYET-IRIYCDENEKTTAAHKKWELATLNHSAGTIGGVIAKIITFPLETIRRR 239
                F  YE  +    ++  K T     W+L       G + G    ++ +PL+ I+  
Sbjct: 191 GCGTYFLVYEAMVANEINKGFKRTEV-PAWKLCLF----GALSGTTLWMMVYPLDVIKSV 245

Query: 240 MQFMNSKHLEKFSRHSSVYGSYKGYGFARIGLQILKQEGVSSLYRGILVALSKTIPTTFV 299
           MQ  N K        S  YG+      + +   +  + G+ + ++G    + +  P    
Sbjct: 246 MQTDNLK--------SPKYGN----SISSVAKTLYAKGGLGAFFKGFGPTMLRAAPANGA 293

Query: 300 SFWGYETAI 308
           +F  +E A+
Sbjct: 294 TFATFELAM 302

>Kwal_23.4354
          Length = 343

 Score = 68.2 bits (165), Expect = 1e-12,   Method: Compositional matrix adjust.
 Identities = 83/353 (23%), Positives = 147/353 (41%), Gaps = 75/353 (21%)

Query: 10  KGQNVAAWKTLLAGAVSGLLARSITAPMDTIKIRLQ---LTPANGLKP------------ 54
           K + +   + LL+  V  LL   I  PMD ++IRLQ   + P  G +             
Sbjct: 5   KQKGIGLKERLLSAVVGSLLTSLILTPMDVVRIRLQQQKMLPDCGCETDAGLTSRASSKG 64

Query: 55  --FGSQVMEVARS----------------MIKNEGIRSFWKG-------NIPGSLLY-VT 88
             +     E  R                 + K EG++S W+G         P +++Y + 
Sbjct: 65  VFWQDICFEDVRCKTSPVRYNSTWDAFGKIAKIEGVQSLWRGLSITLLMAAPANMVYFIG 124

Query: 89  YGSAQFSSYSLFNRYLTPFGLEARLHSLVVGAFAGITSSIVSYPFDVLRTRLVA------ 142
           Y S +  S  L ++Y T       L+ L+ GA A + ++    P ++ RTRL +      
Sbjct: 125 YESLRDKS-RLQDKYPT-------LNPLMCGALARVLAATTVAPLELFRTRLQSIPRSSP 176

Query: 143 --NNQMHSMSITREVR-DIWKLEGLPGFFKGSIASMTTITLTASIMFGTYETIR--IYCD 197
                M    + +E R +I K+ G    F+G   ++      +SI +G YE  +  +  D
Sbjct: 177 KSTTAMMIKDLIKESRYEISKV-GYKALFRGLEITLWRDVPFSSIYWGCYEFYKSNVSID 235

Query: 198 -ENEKTTAAHKKWELATLNHSAGTIGGVIAKIITFPLETIRRRMQ--FMNSKHLEKFSRH 254
            E     +++  W     +   G+ GG +A ++T P +  + RMQ  ++NS   +K S++
Sbjct: 236 SEKSIVNSSNSNWNHFVNSFVGGSFGGAVAAVLTHPFDVGKTRMQITYLNSTLEKKPSKN 295

Query: 255 SSVYGSYKGYGFARIGLQILKQEGVSSLYRGILVALSKTIPTTFVSFWGYETA 307
              Y +           Q+ K EG+++LY G++  + K  P+  +    YE  
Sbjct: 296 MFKYLN-----------QMRKSEGLAALYTGLVPRVIKIAPSCAIMISTYEVC 337

 Score = 56.6 bits (135), Expect = 6e-09,   Method: Compositional matrix adjust.
 Identities = 50/220 (22%), Positives = 98/220 (44%), Gaps = 43/220 (19%)

Query: 6   DSLRKGQNVAAWKTLLAGAVSGLLARSITAPMDTIKIRLQLTPANGLKPFGS----QVME 61
           D  R          L+ GA++ +LA +  AP++  + RLQ  P +  K   +     +++
Sbjct: 130 DKSRLQDKYPTLNPLMCGALARVLAATTVAPLELFRTRLQSIPRSSPKSTTAMMIKDLIK 189

Query: 62  VARSMIKNEGIRSFWKG-------NIPGSLLYVTYGSAQF---------------SSYSL 99
            +R  I   G ++ ++G       ++P S +Y  +G  +F               SS S 
Sbjct: 190 ESRYEISKVGYKALFRGLEITLWRDVPFSSIY--WGCYEFYKSNVSIDSEKSIVNSSNSN 247

Query: 100 FNRYLTPFGLEARLHSLVVGAFAGITSSIVSYPFDVLRTRLVAN------NQMHSMSITR 153
           +N ++         +S V G+F G  ++++++PFDV +TR+          +  S ++ +
Sbjct: 248 WNHFV---------NSFVGGSFGGAVAAVLTHPFDVGKTRMQITYLNSTLEKKPSKNMFK 298

Query: 154 EVRDIWKLEGLPGFFKGSIASMTTITLTASIMFGTYETIR 193
            +  + K EGL   + G +  +  I  + +IM  TYE  +
Sbjct: 299 YLNQMRKSEGLAALYTGLVPRVIKIAPSCAIMISTYEVCK 338

 Score = 32.7 bits (73), Expect = 0.36,   Method: Compositional matrix adjust.
 Identities = 21/86 (24%), Positives = 39/86 (45%), Gaps = 2/86 (2%)

Query: 19  TLLAGAVSGLLARSITAPMDTIKIRLQLTPANGL--KPFGSQVMEVARSMIKNEGIRSFW 76
           + + G+  G +A  +T P D  K R+Q+T  N    K     + +    M K+EG+ + +
Sbjct: 254 SFVGGSFGGAVAAVLTHPFDVGKTRMQITYLNSTLEKKPSKNMFKYLNQMRKSEGLAALY 313

Query: 77  KGNIPGSLLYVTYGSAQFSSYSLFNR 102
            G +P  +      +   S+Y +  R
Sbjct: 314 TGLVPRVIKIAPSCAIMISTYEVCKR 339

>CAGL0K08250g complement(820185..821078) highly similar to sp|P23500
           Saccharomyces cerevisiae YKR052c Mitochondrial RNA
           splicing protein, hypothetical start
          Length = 297

 Score = 67.0 bits (162), Expect = 2e-12,   Method: Compositional matrix adjust.
 Identities = 69/300 (23%), Positives = 127/300 (42%), Gaps = 38/300 (12%)

Query: 20  LLAGAVSGLLARSITAPMDTIKIRLQLTPA----NGLKPFGSQVMEVARSMIKNEGIRSF 75
           LLAGA +G++  S+  P+D IK R+Q + +     GL    S++     S+   +G++S 
Sbjct: 20  LLAGAFAGIMEHSVLFPVDAIKTRIQSSSSGAATQGLIKQISKITTAEGSLALWKGVQSV 79

Query: 76  WKGNIPGSLLYVTYGSAQFSSYSLFNRYLTPFGLEARLHSLVVGAFAGITSSIVS----Y 131
             G  P   +Y  + + +FS   L +        +   H  +  A +G+ ++ V+     
Sbjct: 80  ILGAGPAHAVY--FATYEFSKSKLIDPQ------DMHTHQPIKTAISGMAATTVADALMN 131

Query: 132 PFDVLRTRLVANNQMHSMSITREVRDIWKLEGLPGFFKGSIASMTTITLTASIMFGTYET 191
           PFDV++ R+  N +    S+    ++I+  EG   F+     ++      A+  F  YE+
Sbjct: 132 PFDVIKQRMQLNTR---ESVWHVTKNIYHKEGFAAFYYSYPTTLVMNIPFAAFNFAIYES 188

Query: 192 IRIYCDENEKTTAAHKKWELATLNHS-AGTIGGVIAKIITFPLETIRRRMQFMNSKHL-E 249
              + + +          E     H  +G + G     IT PL+ I+  +Q   S+ +  
Sbjct: 189 ATKFMNPSN---------EYNPFIHCISGGLSGATCAAITTPLDCIKTVLQVRGSETVSN 239

Query: 250 KFSRHSSVYGSYKGYGFARIGLQILKQEGVSSLYRGILVALSKTIPTTFVSFWGYETAIH 309
           +  + ++         F R    I K  G     RG+   +   +P T +S+  YE A H
Sbjct: 240 EIMKQANT--------FQRAASAIYKIHGWKGFLRGLKPRVIANMPATAISWTSYECAKH 291

 Score = 53.1 bits (126), Expect = 7e-08,   Method: Compositional matrix adjust.
 Identities = 39/184 (21%), Positives = 78/184 (42%), Gaps = 15/184 (8%)

Query: 18  KTLLAGAVSGLLARSITAPMDTIKIRLQLTPANGLKPFGSQVMEVARSMIKNEGIRSFWK 77
           KT ++G  +  +A ++  P D IK R+QL            V  V +++   EG  +F+ 
Sbjct: 114 KTAISGMAATTVADALMNPFDVIKQRMQLNTRES-------VWHVTKNIYHKEGFAAFYY 166

Query: 78  GNIPGSLLYVTYGSAQFSSYSLFNRYLTPFGLEARLHSLVVGAFAGITSSIVSYPFDVLR 137
                 ++ + + +  F+ Y    +++ P          + G  +G T + ++ P D ++
Sbjct: 167 SYPTTLVMNIPFAAFNFAIYESATKFMNPSNEYNPFIHCISGGLSGATCAAITTPLDCIK 226

Query: 138 TRL-------VANNQM-HSMSITREVRDIWKLEGLPGFFKGSIASMTTITLTASIMFGTY 189
           T L       V+N  M  + +  R    I+K+ G  GF +G    +       +I + +Y
Sbjct: 227 TVLQVRGSETVSNEIMKQANTFQRAASAIYKIHGWKGFLRGLKPRVIANMPATAISWTSY 286

Query: 190 ETIR 193
           E  +
Sbjct: 287 ECAK 290

 Score = 48.5 bits (114), Expect = 3e-06,   Method: Compositional matrix adjust.
 Identities = 47/196 (23%), Positives = 85/196 (43%), Gaps = 26/196 (13%)

Query: 114 HSLVVGAFAGITSSIVSYPFDVLRTRLVANNQ-MHSMSITREVRDIWKLEGLPGFFKGSI 172
           H L+ GAFAGI    V +P D ++TR+ +++    +  + +++  I   EG    +KG  
Sbjct: 18  HQLLAGAFAGIMEHSVLFPVDAIKTRIQSSSSGAATQGLIKQISKITTAEGSLALWKGVQ 77

Query: 173 ASMTTITLTASIMFGTYE-TIRIYCDENEKTTAAHKKWELATLNHSAGTIGGVIAKIITF 231
           + +       ++ F TYE +     D  +  T  H+  + A     +G     +A  +  
Sbjct: 78  SVILGAGPAHAVYFATYEFSKSKLIDPQDMHT--HQPIKTAI----SGMAATTVADALMN 131

Query: 232 PLETIRRRMQFMNSKHLEKFSRHSSVYGSYKGYGFARIGLQILKQEGVSSLYRGILVALS 291
           P + I++RMQ +N++         SV+          +   I  +EG ++ Y      L 
Sbjct: 132 PFDVIKQRMQ-LNTR--------ESVW---------HVTKNIYHKEGFAAFYYSYPTTLV 173

Query: 292 KTIPTTFVSFWGYETA 307
             IP    +F  YE+A
Sbjct: 174 MNIPFAAFNFAIYESA 189

>Kwal_26.7653
          Length = 325

 Score = 66.6 bits (161), Expect = 3e-12,   Method: Compositional matrix adjust.
 Identities = 64/308 (20%), Positives = 137/308 (44%), Gaps = 40/308 (12%)

Query: 12  QNVAAWKTLLAGAVSGLLARSITAPMDTIKIRLQLT---PANGLKPFGSQVMEVARSMIK 68
           Q V+   + +AG ++  +A ++T P++ +K R+QL     A+  + + +  M+  + + K
Sbjct: 20  QKVSKTGSFIAGGMAACIAVTVTNPIELVKTRMQLQGEMSADAQRIYKNP-MQALKVIFK 78

Query: 69  NEGIRSFWKGNIPGSLLYVTYGSAQFSSY----SLFNR----YLTPFGLEARLHSLVVGA 120
           NEGIR   KG     +  +    ++   Y    S+ N+     + P  ++    ++V GA
Sbjct: 79  NEGIRGLQKGLSCAYIYQIGLNGSRLGFYEPIRSVLNKTFYPAMDPHKVQNVAVNVVSGA 138

Query: 121 FAGITSSIVSYPFDVLRTRLVA-------NNQMHSMSITREVRDIWKLEGLPGFFKGSIA 173
            +GI  +I+  P  +++TR+ +         Q H  SI   +  I++ EG  G ++G  A
Sbjct: 139 TSGIIGAIMGSPLFLIKTRMQSYSNAIQIGQQTHYTSIWNGLSSIYRAEGFKGLYRGVDA 198

Query: 174 SMTTITLTASIMFGTYETIRIYCDENEKTTAAHKKWELATLNHSAGTIGGVIAKIITFPL 233
           ++      +S+    Y T + +  +++         E   L+  A T+ G    ++  P 
Sbjct: 199 AILRTGAGSSVQLPIYNTAKHFLLKHDLMK------EGTGLHLVASTVSGFGVGVVMNPW 252

Query: 234 ETIRRRMQFMNSKHLEKFSRHSSVYGSYKGYGFARIGLQILKQEGVSSLYRGILVALSKT 293
           + I  R+          +++  ++Y      G     ++ ++ EG+ +LY+G    + + 
Sbjct: 253 DVILTRV----------YNQKGNLY-----KGPLDCFVKTVRIEGIGALYKGFEAQIFRI 297

Query: 294 IPTTFVSF 301
            P T +  
Sbjct: 298 APHTILCL 305

 Score = 60.1 bits (144), Expect = 4e-10,   Method: Compositional matrix adjust.
 Identities = 53/203 (26%), Positives = 92/203 (45%), Gaps = 18/203 (8%)

Query: 115 SLVVGAFAGITSSIVSYPFDVLRTRLVANNQMHS------MSITREVRDIWKLEGLPGFF 168
           S + G  A   +  V+ P ++++TR+    +M +       +  + ++ I+K EG+ G  
Sbjct: 27  SFIAGGMAACIAVTVTNPIELVKTRMQLQGEMSADAQRIYKNPMQALKVIFKNEGIRGLQ 86

Query: 169 KG-SIASMTTITLTASIMFGTYETIRIYCDENEKTTAAHKKWELATLNHSAGTIGGVIAK 227
           KG S A +  I L  S   G YE IR   ++         K +   +N  +G   G+I  
Sbjct: 87  KGLSCAYIYQIGLNGS-RLGFYEPIRSVLNKTFYPAMDPHKVQNVAVNVVSGATSGIIGA 145

Query: 228 IITFPLETIRRRMQ-FMNSKHLEKFSRHSSVYGSYKGYGFARIGLQILKQEGVSSLYRGI 286
           I+  PL  I+ RMQ + N+  + + + ++S++              I + EG   LYRG+
Sbjct: 146 IMGSPLFLIKTRMQSYSNAIQIGQQTHYTSIWNGLS---------SIYRAEGFKGLYRGV 196

Query: 287 LVALSKTIPTTFVSFWGYETAIH 309
             A+ +T   + V    Y TA H
Sbjct: 197 DAAILRTGAGSSVQLPIYNTAKH 219

>Sklu_2430.10 YKL120W, Contig c2430 18856-19830
          Length = 324

 Score = 66.2 bits (160), Expect = 3e-12,   Method: Compositional matrix adjust.
 Identities = 68/320 (21%), Positives = 136/320 (42%), Gaps = 48/320 (15%)

Query: 4   EEDSLRKGQNVAAWKTLLAGAVSGLLARSITAPMDTIKIRLQLTPANGL-------KPFG 56
           +E      Q V+   + +AG ++  +A ++T P + +K R+QL              PF 
Sbjct: 11  KEHEKSAAQKVSKVGSFIAGGLAACIAVTVTNPFELVKTRMQLQGEMSATNQRIYRNPF- 69

Query: 57  SQVMEVARSMIKNEGIRSFWKGNIPGSLLYVTYGSAQFSSY----SLFNRYLTPFGLEAR 112
            Q + V   + KNEG++   +G +   +  +    ++   Y    ++ N+   P     +
Sbjct: 70  -QALGV---IFKNEGVKGLQRGLVSAYVYQIGLNGSRLGFYEPIRTVLNKTFFPESDPHK 125

Query: 113 LHSLVV----GAFAGITSSIVSYPFDVLRTRLVA-------NNQMHSMSITREVRDIWKL 161
           L ++ V    GA +GI  +IV  P  +++TR+ +         Q H  S++  +  I+K 
Sbjct: 126 LQNVAVNVTAGATSGIIGAIVGSPLFLVKTRMQSYSNAIKIGEQTHYTSMSNGLATIFKK 185

Query: 162 EGLPGFFKGSIASMTTITLTASIMFGTYETIRIYCDENEKTTAAHKKWELATLNHSAGTI 221
           EG+ G F+G  A++      +S+    Y T + +  +N+         E   L+  + T+
Sbjct: 186 EGVLGLFRGVDAAILRTGAGSSVQLPIYNTTKNFLLQNDIMK------EGTALHLLSSTV 239

Query: 222 GGVIAKIITFPLETIRRRMQFMNSKHLEKFSRHSSVYGSYKGYGFARIGLQILKQEGVSS 281
            G+   I+  P + +  R+          +++  + Y      G      + +K EG+ +
Sbjct: 240 TGLGVGIVMNPWDVVLTRV----------YNQKGNTY-----KGPIDCMFKTIKIEGIGA 284

Query: 282 LYRGILVALSKTIPTTFVSF 301
           LY+G    L +  P T +  
Sbjct: 285 LYKGFGAQLFRIAPHTILCL 304

>CAGL0F07711g complement(751794..752900) similar to sp|Q03829
           Saccharomyces cerevisiae YMR166c, hypothetical start
          Length = 368

 Score = 66.2 bits (160), Expect = 4e-12,   Method: Compositional matrix adjust.
 Identities = 65/252 (25%), Positives = 108/252 (42%), Gaps = 19/252 (7%)

Query: 3   KEEDSLRKGQNVAAWKTLLAGAVSGLLARSITAPMDTIKIRLQLTPANGLKPFGSQVMEV 62
            +++     ++   W   LAG V G++  S    +DT+K R Q  P N  K     +++ 
Sbjct: 40  DDQNLFDDYEHSPIWHCFLAGGVGGIIGDSAMHSLDTVKTRQQGAP-NVHK--YKHMLQA 96

Query: 63  ARSMIKNEGIRSFWKGNIPGSLLYVTYGSAQ--FSSYSLFNR-YLTPFGLEARLHSLVVG 119
            R+M   EG R    G    ++L  ++ SA   FS+Y    R  +  + L      L  G
Sbjct: 97  YRTMFIEEGFRRGLYGGYCAAML-GSFPSAAIFFSTYEFTKRTMINDYHLNDTFSHLTAG 155

Query: 120 AFAGITSSIVSYPFDVLRTRLVA---------NNQMHSMSITREVRDIWKLEGLPGFFKG 170
                 SS V  P +VL+TRL           N+  +  S+   +  I++ EG+   F G
Sbjct: 156 FLGDFFSSFVYVPSEVLKTRLQLQGCYNNPHFNSGYNYKSLRNAIATIYRTEGVAALFFG 215

Query: 171 SIASMTTITLTASIMFGTYETIRIYCDENEKTTAAHKKWELATLNH-SAGTIGGVIAKII 229
             A++      +++ F  YE  R +    E       K +L+  N    G   G +A I+
Sbjct: 216 YKATLARDLPFSALQFAFYEKFRQWAFLLEGKDI--YKHDLSISNEIVTGACAGGLAGIL 273

Query: 230 TFPLETIRRRMQ 241
           T PL+ ++ R+Q
Sbjct: 274 TTPLDVVKTRVQ 285

 Score = 48.1 bits (113), Expect = 4e-06,   Method: Compositional matrix adjust.
 Identities = 45/199 (22%), Positives = 82/199 (41%), Gaps = 25/199 (12%)

Query: 114 HSLVVGAFAGITSSIVSYPFDVLRTRLVANNQMHSMS-ITREVRDIWKLEGLP-GFFKGS 171
           H  + G   GI      +  D ++TR      +H    + +  R ++  EG   G + G 
Sbjct: 55  HCFLAGGVGGIIGDSAMHSLDTVKTRQQGAPNVHKYKHMLQAYRTMFIEEGFRRGLYGGY 114

Query: 172 IASMTTITLTASIMFGTYETIR--IYCDENEKTTAAHKKWELATLNHSAGTIGGVIAKII 229
            A+M     +A+I F TYE  +  +  D +   T +H          +AG +G   +  +
Sbjct: 115 CAAMLGSFPSAAIFFSTYEFTKRTMINDYHLNDTFSHL---------TAGFLGDFFSSFV 165

Query: 230 TFPLETIRRRMQFMNSKHLEKFSRHSSVYGSYKGYGFARIG---LQILKQEGVSSLYRGI 286
             P E ++ R+Q     +   F+          GY +  +      I + EGV++L+ G 
Sbjct: 166 YVPSEVLKTRLQLQGCYNNPHFN---------SGYNYKSLRNAIATIYRTEGVAALFFGY 216

Query: 287 LVALSKTIPTTFVSFWGYE 305
              L++ +P + + F  YE
Sbjct: 217 KATLARDLPFSALQFAFYE 235

>CAGL0L02079g 243467..244360 highly similar to sp|P38152
           Saccharomyces cerevisiae YBR291c CTP1 citrate transport
           protein, hypothetical start
          Length = 297

 Score = 65.9 bits (159), Expect = 4e-12,   Method: Compositional matrix adjust.
 Identities = 72/311 (23%), Positives = 132/311 (42%), Gaps = 31/311 (9%)

Query: 9   RKGQNVAAWKTLLAGAVSGLLARSITAPMDTIKIRLQLTPANGLKPFGSQVMEVARSMIK 68
           +  + V   K+ +AGA++G +  SIT P +  K RLQL   +        V+    +  K
Sbjct: 3   KDSKKVDPTKSFVAGALAGAVEASITYPFEFAKTRLQLIDKSSKASRNPLVL--IYNTAK 60

Query: 69  NEGIRSFWKGNIPGSLLYVTYGSA-QFSSYSLFNRYLTP--FGLEARLHSLVVGAFAGIT 125
            +G+ + + G  P  ++  T  +A +F  Y      L     G  +    ++ G  AG+ 
Sbjct: 61  TQGVGAIYVG-CPAFIVGNTAKAATRFLGYDTIRNLLKDKKTGELSGPRGVLAGLGAGLL 119

Query: 126 SSIVSY-PFDVLRTRLVANNQM-------HSMSITREVRDIWKLEGLPGFFKGSIASMTT 177
            S+V+  PF+ ++T L+ + Q        +  S+ R    + K EG  G + G +     
Sbjct: 120 ESVVAVTPFEAIKTVLIDDKQSVRPKYQNNGRSMARNYISLVKDEGFRGLYGGVLPVSMR 179

Query: 178 ITLTASIMFGTYETIRIYCDENEKTTAAHKKWELATLNHSAGTIGGVIAKIITFPLETIR 237
                ++  G Y  I++     + T A   K   + L    G   GV+    T P++T++
Sbjct: 180 QAANQAVRLGCYNKIKVLV--QDYTGAPKDKPLTSGLTFIVGAFSGVVTVYATMPIDTVK 237

Query: 238 RRMQFMNSKHLEKFSRHSSVYGSYKGYGFARIGLQILKQEGVSSLYRGILVALSKTIPTT 297
            RMQ + +      S++SS    +           I K+EG+ + ++G    L + I + 
Sbjct: 238 TRMQSLTA------SKYSSTLNCFT---------TIYKEEGLKTFWKGATPRLGRLILSG 282

Query: 298 FVSFWGYETAI 308
            + F  YE  +
Sbjct: 283 GIVFTIYENVL 293

 Score = 60.5 bits (145), Expect = 2e-10,   Method: Compositional matrix adjust.
 Identities = 48/198 (24%), Positives = 92/198 (46%), Gaps = 12/198 (6%)

Query: 9   RKGQNVAAWKTLLAGAVSGLLARSITA-PMDTIKIRLQLTPANGLKP-FGSQVMEVAR-- 64
           +K   ++  + +LAG  +GLL   +   P + IK  L +     ++P + +    +AR  
Sbjct: 99  KKTGELSGPRGVLAGLGAGLLESVVAVTPFEAIKTVL-IDDKQSVRPKYQNNGRSMARNY 157

Query: 65  -SMIKNEGIRSFWKGNIPGSLLYVTYGSAQFSSYSLFNRYLTPFGLEARLHSL------V 117
            S++K+EG R  + G +P S+      + +   Y+     +  +    +   L      +
Sbjct: 158 ISLVKDEGFRGLYGGVLPVSMRQAANQAVRLGCYNKIKVLVQDYTGAPKDKPLTSGLTFI 217

Query: 118 VGAFAGITSSIVSYPFDVLRTRLVANNQMHSMSITREVRDIWKLEGLPGFFKGSIASMTT 177
           VGAF+G+ +   + P D ++TR+ +       S       I+K EGL  F+KG+   +  
Sbjct: 218 VGAFSGVVTVYATMPIDTVKTRMQSLTASKYSSTLNCFTTIYKEEGLKTFWKGATPRLGR 277

Query: 178 ITLTASIMFGTYETIRIY 195
           + L+  I+F  YE + +Y
Sbjct: 278 LILSGGIVFTIYENVLLY 295

>CAGL0K02365g 212702..215461 highly similar to tr|Q12482
           Saccharomyces cerevisiae YPR021c, start by similarity
          Length = 919

 Score = 66.6 bits (161), Expect = 5e-12,   Method: Compositional matrix adjust.
 Identities = 73/294 (24%), Positives = 128/294 (43%), Gaps = 33/294 (11%)

Query: 23  GAVSGLLARSITAPMDTIKIRLQLTPANGLKPFGSQVMEVARSMIKNEGIRSFWKGNIPG 82
           G+V+G +  +I  P+D +K R+Q      L  + + + +    ++  EGIR  + G  P 
Sbjct: 550 GSVAGCIGATIVYPIDFVKTRMQ--AQRSLSQYKNSI-DCFLKILSREGIRGVYSGLGPQ 606

Query: 83  SLLYVTYGSAQFSSYS-LFNRYLTPFGLEARLHSLVVGAFAGITSSIVSYPFDVLRTRL- 140
            +      + + +    + N+     G    L  ++ GA AG    I + P ++++ RL 
Sbjct: 607 LIGVAPEKAIKLTVNDYMRNKLKDKNGKLGLLSEIISGASAGACQVIFTNPLEIVKIRLQ 666

Query: 141 -----VANNQMHSMSITREVRDIWKLEGLPGFFKGSIASMTTITLTASIMFGTYETIR-- 193
                VA N  ++     +   I K  GLPG +KG+ A +      ++I F TY  ++  
Sbjct: 667 VKGEYVAENAENAKLTALQ---IIKRLGLPGLYKGAAACLLRDVPFSAIYFPTYAHLKRD 723

Query: 194 -IYCDENEKTTAAH-KKWELATLNHSAGTIGGVIAKIITFPLETIRRRMQFMNSKHLEKF 251
               D N+K   +    WEL     SAG + G+ A  +T P + I+ R+Q ++ K  E  
Sbjct: 724 LFNFDPNDKNKRSRLNTWELL----SAGALAGMPAAYLTTPFDVIKTRLQ-IDPKKGETI 778

Query: 252 SRHSSVYGSYKGYGFARIGLQILKQEGVSSLYRGILVALSKTIPTTFVSFWGYE 305
                    YKG   A     IL++E   S ++G    + ++ P    +   YE
Sbjct: 779 ---------YKGIIHA--ARTILREESFKSFFKGGAARVLRSSPQFGFTLAAYE 821

 Score = 57.4 bits (137), Expect = 7e-09,   Method: Compositional matrix adjust.
 Identities = 53/186 (28%), Positives = 84/186 (45%), Gaps = 30/186 (16%)

Query: 20  LLAGAVSGLLARSITAPMDTIKIRLQLTPANGLKPFGSQVMEVARS-------MIKNEGI 72
           +++GA +G      T P++ +KIRLQ+         G  V E A +       +IK  G+
Sbjct: 641 IISGASAGACQVIFTNPLEIVKIRLQVK--------GEYVAENAENAKLTALQIIKRLGL 692

Query: 73  RSFWKGNIPGSLLYVTYGSAQFSSYSLFNRYLTPF-----GLEARLHS---LVVGAFAGI 124
              +KG     L  V + +  F +Y+   R L  F        +RL++   L  GA AG+
Sbjct: 693 PGLYKGAAACLLRDVPFSAIYFPTYAHLKRDLFNFDPNDKNKRSRLNTWELLSAGALAGM 752

Query: 125 TSSIVSYPFDVLRTRLVANNQMHSM---SITREVRDIWKLEGLPGFFKGSIASMTTITLT 181
            ++ ++ PFDV++TRL  + +        I    R I + E    FFKG  A +    L 
Sbjct: 753 PAAYLTTPFDVIKTRLQIDPKKGETIYKGIIHAARTILREESFKSFFKGGAARV----LR 808

Query: 182 ASIMFG 187
           +S  FG
Sbjct: 809 SSPQFG 814

 Score = 56.6 bits (135), Expect = 9e-09,   Method: Compositional matrix adjust.
 Identities = 52/199 (26%), Positives = 86/199 (43%), Gaps = 33/199 (16%)

Query: 2   FKEEDSLRKGQNVAAWKTLLAGAVSGLLARSITAPMDTIKIRLQLTPANGLKPFGSQVME 61
           F   D  ++ + +  W+ L AGA++G+ A  +T P D IK RLQ+ P  G   +   ++ 
Sbjct: 727 FDPNDKNKRSR-LNTWELLSAGALAGMPAAYLTTPFDVIKTRLQIDPKKGETIYKG-IIH 784

Query: 62  VARSMIKNEGIRSFWKGNIPGSLLYVTYGSAQF----SSYSLFNRYLTPFGLEARLHSLV 117
            AR++++ E  +SF+KG        V   S QF    ++Y LF+     F L       V
Sbjct: 785 AARTILREESFKSFFKGGAAR----VLRSSPQFGFTLAAYELFH---NIFPLPNDKDKFV 837

Query: 118 VGAFAGITSSIVSYPFDVLRTRLVANN----QMHSMSITREVRDIWKLEGLPGFFKGSIA 173
           +               D  R +++ NN     +    +TR V + +    L  ++K    
Sbjct: 838 ISE-------------DDRRAKILNNNARGPNIDKRELTRIVENPYSDSYLNYYYKSCQV 884

Query: 174 SMTTITLT---ASIMFGTY 189
           + T I L    A   +GTY
Sbjct: 885 AKTFIELDNNFAKFDYGTY 903

 Score = 46.2 bits (108), Expect = 2e-05,   Method: Compositional matrix adjust.
 Identities = 48/200 (24%), Positives = 83/200 (41%), Gaps = 34/200 (17%)

Query: 113 LHSLVVGAFAGITSSIVSYPFDVLRTRLVANNQMHSMSITREVRD----IWKLEGLPGFF 168
           L++  +G+ AG   + + YP D ++TR+ A     S+S  +   D    I   EG+ G +
Sbjct: 544 LYNFSLGSVAGCIGATIVYPIDFVKTRMQA---QRSLSQYKNSIDCFLKILSREGIRGVY 600

Query: 169 KGSIASMTTITLTASIMFGTYETIRIYCDENEKTTAAHKKWELATLNH-SAGTIGGVIAK 227
            G    +  +    +I     + +R             K  +L  L+   +G   G    
Sbjct: 601 SGLGPQLIGVAPEKAIKLTVNDYMR--------NKLKDKNGKLGLLSEIISGASAGACQV 652

Query: 228 IITFPLETIRRRMQFMNSKHLEKFSRHSSVYGSY--KGYGFARI-GLQILKQEGVSSLYR 284
           I T PLE ++ R+Q               V G Y  +    A++  LQI+K+ G+  LY+
Sbjct: 653 IFTNPLEIVKIRLQ---------------VKGEYVAENAENAKLTALQIIKRLGLPGLYK 697

Query: 285 GILVALSKTIPTTFVSFWGY 304
           G    L + +P + + F  Y
Sbjct: 698 GAAACLLRDVPFSAIYFPTY 717

>KLLA0F03212g 302915..303832 highly similar to sp|P33303
           Saccharomyces cerevisiae YJR095w ACR1 succinate-fumarate
           transporter, start by similarity
          Length = 305

 Score = 65.5 bits (158), Expect = 5e-12,   Method: Compositional matrix adjust.
 Identities = 80/315 (25%), Positives = 138/315 (43%), Gaps = 40/315 (12%)

Query: 7   SLRKGQNVAAWKTLLAGAVSGLLARSITAPMDTIKIRLQL---TPANGLKPFGSQVMEVA 63
           S +K  N A    L+AG  +GL+      P+DTIK+R+Q+      +G+K  G   ++  
Sbjct: 3   SKQKSSNPAV--NLIAGGGAGLMEGLCCHPLDTIKVRMQIYKNAVGSGVKAPG--FIKTG 58

Query: 64  RSMIKNEGIRSFWKGNIPGSLLYVTYGSA-QFSSYSLFNRYLTP--FGLEARLHSLVVGA 120
             + +NEG  +F+KG +   ++ +T   A +FSSY  +   L     G  +  ++ + G 
Sbjct: 59  GEIYRNEGFLAFYKG-LGAVVIGITPKMAIRFSSYEFYRTLLADKETGKVSTGNTFIAGV 117

Query: 121 FAGITSSIVSYPFDVL-RTRLVAN--NQMHSM----SITREVRDIWKLEGLPGFFKGSIA 173
            AGIT ++V      + + RL A   N +       +  +    I K EG    ++G   
Sbjct: 118 GAGITEAVVVVNPMEVVKIRLQAQHLNPVEGAPKYKNAVQACYTIVKEEGFSALYRGVSL 177

Query: 174 SMTTITLTASIMFGTYETIRIYCD--ENEKTTAAHKKWELATLNHSAGTIGGVIAKIITF 231
           +           F  Y  ++ +     N++   +   WE + +    G I G I      
Sbjct: 178 TAARQATNQGANFTVYSKLKEFLQGYHNQEMLPS---WETSLI----GLISGAIGPFSNA 230

Query: 232 PLETIRRRMQFMNS-KHLEKFSRHSSVYGSYKGYGFARIGLQILKQEGVSSLYRGILVAL 290
           PL+TI+ R+Q   S K++    R               IG Q++++EG  +LY+GI   +
Sbjct: 231 PLDTIKTRLQKDKSTKNMSGLKR------------ITIIGKQLIQEEGFRALYKGITPRV 278

Query: 291 SKTIPTTFVSFWGYE 305
            +  P   V+F  YE
Sbjct: 279 MRVAPGQAVTFTAYE 293

 Score = 48.5 bits (114), Expect = 2e-06,   Method: Compositional matrix adjust.
 Identities = 29/100 (29%), Positives = 51/100 (51%), Gaps = 8/100 (8%)

Query: 14  VAAWKTLLAGAVSGLLARSITAPMDTIKIRLQLTPA----NGLKPFGSQVMEVARSMIKN 69
           + +W+T L G +SG +     AP+DTIK RLQ   +    +GLK    ++  + + +I+ 
Sbjct: 209 LPSWETSLIGLISGAIGPFSNAPLDTIKTRLQKDKSTKNMSGLK----RITIIGKQLIQE 264

Query: 70  EGIRSFWKGNIPGSLLYVTYGSAQFSSYSLFNRYLTPFGL 109
           EG R+ +KG  P  +      +  F++Y    + L   G+
Sbjct: 265 EGFRALYKGITPRVMRVAPGQAVTFTAYEFIRKELEKTGV 304

 Score = 40.4 bits (93), Expect = 0.001,   Method: Compositional matrix adjust.
 Identities = 27/102 (26%), Positives = 45/102 (44%), Gaps = 10/102 (9%)

Query: 204 AAHKKWELATLNHSAGTIGGVIAKIITFPLETIRRRMQFMNSKHLEKFSRHSSVYGSYKG 263
           A+ +K     +N  AG   G++  +   PL+TI+ RMQ             ++V    K 
Sbjct: 2   ASKQKSSNPAVNLIAGGGAGLMEGLCCHPLDTIKVRMQIY----------KNAVGSGVKA 51

Query: 264 YGFARIGLQILKQEGVSSLYRGILVALSKTIPTTFVSFWGYE 305
            GF + G +I + EG  + Y+G+   +    P   + F  YE
Sbjct: 52  PGFIKTGGEIYRNEGFLAFYKGLGAVVIGITPKMAIRFSSYE 93

>Sklu_1149.2 YBR291C, Contig c1149 2019-2909 reverse complement
          Length = 296

 Score = 65.5 bits (158), Expect = 5e-12,   Method: Compositional matrix adjust.
 Identities = 65/311 (20%), Positives = 128/311 (41%), Gaps = 29/311 (9%)

Query: 8   LRKGQNVAAWKTLLAGAVSGLLARSITAPMDTIKIRLQLTPANGLKPFGSQVMEVARSMI 67
           + + + V   K+ +AG ++G +  S+T P +  K RLQL   +         + +  +  
Sbjct: 1   MSQSKQVDPSKSFIAGCLAGAVEASVTYPFEFAKTRLQLL--DKASKASRNPLVLIYNTA 58

Query: 68  KNEGIRSFWKGNIPGSLLYVTYGSAQFSSYSLFNRYL--TPFGLEARLHSLVVGAFAGIT 125
           K +GI S + G     +        +F  +      L     G  +    ++ G  AG+ 
Sbjct: 59  KTQGIGSVYVGCPAFIVGNTAKAGVRFLGFDTIKNLLRDPKTGELSGPRGVIAGLGAGLL 118

Query: 126 SSIVSY-PFDVLRTRLVANNQM-------HSMSITREVRDIWKLEGLPGFFKGSIASMTT 177
            S+V+  PF+ ++T L+ + Q        +   + R    + + +GL G ++G +     
Sbjct: 119 ESVVAVTPFEAIKTALIDDKQSATPKYHNNGKGMLRNYTALVRKQGLSGLYRGVLPVSMR 178

Query: 178 ITLTASIMFGTYETIRIYCDENEKTTAAHKKWELATLNHSAGTIGGVIAKIITFPLETIR 237
                ++  G Y  I++     + T A   K   + L    G   G++    T P++T++
Sbjct: 179 QAANQAVRLGCYNKIKVMV--QDYTNAPKDKPLSSGLTFVVGAFSGIVTVYTTMPIDTVK 236

Query: 238 RRMQFMNSKHLEKFSRHSSVYGSYKGYGFARIGLQILKQEGVSSLYRGILVALSKTIPTT 297
            RMQ ++SK      R+SS    +           I K+EG+ + ++G    L +   + 
Sbjct: 237 TRMQSLDSK------RYSSTINCFT---------TIFKEEGLKAFWKGATPRLGRLFLSG 281

Query: 298 FVSFWGYETAI 308
            + F  YE  +
Sbjct: 282 GIVFTVYEKVL 292

 Score = 43.5 bits (101), Expect = 9e-05,   Method: Compositional matrix adjust.
 Identities = 23/81 (28%), Positives = 43/81 (53%), Gaps = 4/81 (4%)

Query: 1   MFKEEDSLRKGQNVAAWKTLLAGAVSGLLARSITAPMDTIKIRLQLTPANGLKPFGSQVM 60
           M ++  +  K + +++  T + GA SG++    T P+DT+K R+Q   +       S  +
Sbjct: 196 MVQDYTNAPKDKPLSSGLTFVVGAFSGIVTVYTTMPIDTVKTRMQSLDSKRY----SSTI 251

Query: 61  EVARSMIKNEGIRSFWKGNIP 81
               ++ K EG+++FWKG  P
Sbjct: 252 NCFTTIFKEEGLKAFWKGATP 272

>Kwal_23.2913
          Length = 320

 Score = 65.5 bits (158), Expect = 6e-12,   Method: Compositional matrix adjust.
 Identities = 72/308 (23%), Positives = 138/308 (44%), Gaps = 44/308 (14%)

Query: 16  AWKTLLAGAVSGLLARSITAPMDTIKIRLQLTPANGLKPFGSQVMEVARSM---IKNEGI 72
           ++++L AG V G+ A     P D +K+R Q   A+G     S+V+  A+S    +    I
Sbjct: 28  SFESLAAGGVGGVCAVLTGHPFDLLKVRCQSNQASGTLDAISRVLHEAKSKSGPLPLNQI 87

Query: 73  RSFWKGNIPGSLLYVTYGSAQFSSYSLFNRYLT----PF----GLEARLHSL------VV 118
           + F++G IP  L      +  F  Y +  R +T    P     G  ++L  L      + 
Sbjct: 88  KGFYRGVIPPLLGVTPIFAVSFWGYDVGKRLVTWGSNPVTDIAGSSSKLTPLTTSQLALA 147

Query: 119 GAFAGITSSIVSYPFDVLRTRLVANNQMHSMSITREVRDIWKLEGLPGFFKGSIASMTTI 178
           G F+ I +++++ P +  R ++V      S S     R + +  G+   F+G++A++   
Sbjct: 148 GFFSAIPTTLITAPTE--RVKVVLQTS-ESGSFLGAARTLIREGGVRSLFQGTLATLARD 204

Query: 179 TLTASIMFGTYETIRIYCDENEKTTAAHKKWELATLNHS-AGTIGGVIAKIITFPLETIR 237
              +++ F +YE  + +   N+ T A      L+ ++   AG + G+   I  FP++TI+
Sbjct: 205 GPGSALYFASYEVSKRFLSRNQDTDA------LSVVSICVAGGVAGMSMWIGVFPIDTIK 258

Query: 238 RRMQFMNSKHLEKFSRHSSVYGSYKGYGFARIGLQILKQEGVSSLYRGILVALSKTIPTT 297
            ++Q          SR  S+  + +         +I  + G+   + G+  AL ++ P  
Sbjct: 259 TKLQ--------SSSRSQSMVQAAR---------EIYTRAGLRGFFPGLGPALMRSFPAN 301

Query: 298 FVSFWGYE 305
             +F G E
Sbjct: 302 AATFLGVE 309

 Score = 54.3 bits (129), Expect = 3e-08,   Method: Compositional matrix adjust.
 Identities = 53/212 (25%), Positives = 94/212 (44%), Gaps = 31/212 (14%)

Query: 109 LEARLHSLVVGAFAGITSSIVSYPFDVLRTRLVANNQMHSM-SITREVRDIWKLEG-LP- 165
           L     SL  G   G+ + +  +PFD+L+ R  +N    ++ +I+R + +     G LP 
Sbjct: 25  LRDSFESLAAGGVGGVCAVLTGHPFDLLKVRCQSNQASGTLDAISRVLHEAKSKSGPLPL 84

Query: 166 ----GFFKGSIASMTTITLTASIMFGTYETIR--IYCDENEKTTAAHKKWELATLNHS-- 217
               GF++G I  +  +T   ++ F  Y+  +  +    N  T  A    +L  L  S  
Sbjct: 85  NQIKGFYRGVIPPLLGVTPIFAVSFWGYDVGKRLVTWGSNPVTDIAGSSSKLTPLTTSQL 144

Query: 218 --AGTIGGVIAKIITFPLETIRRRMQFMNSKHLEKFSRHSSVYGSYKGYGFARIGLQILK 275
             AG    +   +IT P E ++  +Q             +S  GS+   G AR    +++
Sbjct: 145 ALAGFFSAIPTTLITAPTERVKVVLQ-------------TSESGSF--LGAART---LIR 186

Query: 276 QEGVSSLYRGILVALSKTIPTTFVSFWGYETA 307
           + GV SL++G L  L++  P + + F  YE +
Sbjct: 187 EGGVRSLFQGTLATLARDGPGSALYFASYEVS 218

>YIL134W (FLX1) [2542] chr9 (97395..98330) Protein involved in
           transport of FAD from cytosol into the mitochondrial
           matrix, member of mitochondrial carrier (MCF) family of
           membrane transporters [936 bp, 311 aa]
          Length = 311

 Score = 64.7 bits (156), Expect = 1e-11,   Method: Compositional matrix adjust.
 Identities = 76/323 (23%), Positives = 148/323 (45%), Gaps = 49/323 (15%)

Query: 17  WKTLLAGAVSGLLARSITA----PMDTIKIRLQLTPANGLK----PFGSQVMEVARSM-- 66
           W  L    +SGL A S+T     P+D +K+RLQL+  +  K    PF   + E+ RS   
Sbjct: 6   WTPLQKEVISGLSAGSVTTLVVHPLDLLKVRLQLSATSAQKAHYGPF-MVIKEIIRSSAN 64

Query: 67  ----IKNEGIR----SFWKGNIPGSLLYVTYGSAQFSSYSLFNR----YLTPFGLEARLH 114
               + NE  R    + +   I   + +  YG  +   Y    +     L   G + +++
Sbjct: 65  SGRSVTNELYRGLSINLFGNAIAWGVYFGLYGVTKELIYKSVAKPGETQLKGVGNDHKMN 124

Query: 115 SLV---VGAFAGITSSIVSYPFDVLRTRLVANN---QMHSMSITREVRDIWKLEGLPGFF 168
           SL+    GA +G+ ++I++ P  V++TR+++ +   Q    S+   V+ + + +G  G +
Sbjct: 125 SLIYLSAGASSGLMTAILTNPIWVIKTRIMSTSKGAQGAYTSMYNGVQQLLRTDGFQGLW 184

Query: 169 KGSIASMTTITLTASIMFGTYETI--RIYCDENEKTTAAHKKWELATLNHSAGTIGGVIA 226
           KG + ++  ++   ++ F  Y+T+  R    + E     H    L T+  +  ++G +++
Sbjct: 185 KGLVPALFGVS-QGALYFAVYDTLKQRKLRRKRENGLDIHLT-NLETIEIT--SLGKMVS 240

Query: 227 KIITFPLETIRRRMQFMNSKHLEKFSRHSSVYGSYKGYGFARIGLQILKQEGVSSLYRGI 286
             + +P + ++  +Q   +   +KF              F  I L I+  +G   LY+G+
Sbjct: 241 VTLVYPFQLLKSNLQSFRANE-QKFRL------------FPLIKL-IIANDGFVGLYKGL 286

Query: 287 LVALSKTIPTTFVSFWGYETAIH 309
              L + IP+T ++F  YE   H
Sbjct: 287 SANLVRAIPSTCITFCVYENLKH 309

>Kwal_27.12599
          Length = 304

 Score = 64.7 bits (156), Expect = 1e-11,   Method: Compositional matrix adjust.
 Identities = 68/302 (22%), Positives = 117/302 (38%), Gaps = 36/302 (11%)

Query: 18  KTLLAGAVSGLLARSITAPMDTIKIRLQL--TPANGLKPFGSQVMEVARSMIKNEGIRSF 75
           K LLAG   G+    +  P DT K+RLQ   TP        +  +EV + ++KNEG+R F
Sbjct: 26  KDLLAGTAGGMAQVLVGQPFDTTKVRLQTSTTP--------TTAVEVVKKLVKNEGLRGF 77

Query: 76  WKGNIPGSLLYVTYGSAQFSSYSLFNRYLTPFGLEARLHSL-------VVGAFAGITSSI 128
           +KG +   +      S QF       R+    G  A  H         + G   G+ +S 
Sbjct: 78  YKGTLTPLVGVGACVSCQFGVNEAMKRFFR--GSSADPHKTLTLPQYYICGFVGGVANSF 135

Query: 129 VSYPFDVLRTRLVANNQMHSMSITREVRD-IWKLEGLPGFFKGSIASMTTITLTASIMFG 187
           ++ P + +R RL       +++  +   D I KL       +G   ++       +  F 
Sbjct: 136 LASPIEHVRIRLQTQTASGTVAEFKGPLDCINKLRANGALMRGLSPTILREAQGCATYFL 195

Query: 188 TYETIRIYCDENEKTTAAHKKWELATLNHSAGTIGGVIAKIITFPLETIRRRMQFMNSKH 247
           TYE +           +    W+L       G + GV   +  +PL+ I+  MQ  N K+
Sbjct: 196 TYEALVANQIGKGIARSDVPAWKLCLF----GAVSGVTLWLTVYPLDVIKSLMQTDNLKN 251

Query: 248 LEKFSRHSSVYGSYKGYGFARIGLQILKQEGVSSLYRGILVALSKTIPTTFVSFWGYETA 307
                         +G    ++   +  + G  S ++G    + +  P    +F  +E A
Sbjct: 252 ------------PVRGKNIIQVARLVNAKYGWKSFFKGFGPTMLRAAPANGATFATFELA 299

Query: 308 IH 309
           + 
Sbjct: 300 MR 301

 Score = 46.6 bits (109), Expect = 1e-05,   Method: Compositional matrix adjust.
 Identities = 33/93 (35%), Positives = 47/93 (50%), Gaps = 3/93 (3%)

Query: 13  NVAAWKTLLAGAVSGLLARSITAPMDTIKIRLQLTPANGLKPF-GSQVMEVARSMIKNEG 71
           +V AWK  L GAVSG+       P+D IK  +Q    N   P  G  +++VAR +    G
Sbjct: 213 DVPAWKLCLFGAVSGVTLWLTVYPLDVIKSLMQTD--NLKNPVRGKNIIQVARLVNAKYG 270

Query: 72  IRSFWKGNIPGSLLYVTYGSAQFSSYSLFNRYL 104
            +SF+KG  P  L       A F+++ L  R+L
Sbjct: 271 WKSFFKGFGPTMLRAAPANGATFATFELAMRFL 303

>AER366W [2867] [Homologous to ScYIL134W (FLX1) - SH]
           complement(1314627..1315508) [882 bp, 293 aa]
          Length = 293

 Score = 64.3 bits (155), Expect = 1e-11,   Method: Compositional matrix adjust.
 Identities = 53/180 (29%), Positives = 88/180 (48%), Gaps = 12/180 (6%)

Query: 20  LLAGAVSGLLARSITAPMDTIKIRLQLTPANGLKPFGSQVMEVARSMIKNEGIRSFWKGN 79
           +LA   SG+    +T P+  IK R+  T   G  P+ S    V + + + EG+ +FW+G 
Sbjct: 117 MLAAGSSGIATAVLTNPIWVIKTRIMATSRAG--PYKSTFDGVYK-LYQTEGVLAFWRGV 173

Query: 80  IPGSLLYVTYGSAQFSSYSLFNRYLTPFGLEARLHSLVVGAFAGIT--SSIVS----YPF 133
           +P SLL V+ G+  F+ Y     +      +     L V    GIT  S ++S    YPF
Sbjct: 174 VP-SLLGVSQGAIYFALYDTLKFHYLHSSTDKAERRLSVSEIIGITCISKMISVTSVYPF 232

Query: 134 DVLRTRLVANNQMHSMSITREVRDIWKLEGLPGFFKGSIASMTTITLTASIMFGTYETIR 193
            +L+++L   +      IT+ V+ ++  EG+ GF++G  A++        I F  YE I+
Sbjct: 233 QLLKSKL--QDFGAPSGITQLVQTVYSREGIRGFYRGLSANLLRAVPATCITFFVYENIK 290

 Score = 52.0 bits (123), Expect = 2e-07,   Method: Compositional matrix adjust.
 Identities = 44/204 (21%), Positives = 97/204 (47%), Gaps = 34/204 (16%)

Query: 109 LEARLHSLVVGAFAGITSSIVSYPFDVLRTRLVANNQMHSMSITRE-VRDIWKLEGLPGF 167
           L A  + L  G+ +GI +++++ P  V++TR++A ++      T + V  +++ EG+  F
Sbjct: 111 LPAHAYMLAAGS-SGIATAVLTNPIWVIKTRIMATSRAGPYKSTFDGVYKLYQTEGVLAF 169

Query: 168 FKGSIASMTTITLTASIMFGTYETIRIYCDENEKTTAAHKKWELATLNHSAGTIGGV--I 225
           ++G + S+  ++   +I F  Y+T++ +          H   + A    S   I G+  I
Sbjct: 170 WRGVVPSLLGVS-QGAIYFALYDTLKFH--------YLHSSTDKAERRLSVSEIIGITCI 220

Query: 226 AKIIT----FPLETIRRRMQFMNSKHLEKFSRHSSVYGSYKGYGFARIGLQILKQEGVSS 281
           +K+I+    +P + ++ ++Q   +                   G  ++   +  +EG+  
Sbjct: 221 SKMISVTSVYPFQLLKSKLQDFGAPS-----------------GITQLVQTVYSREGIRG 263

Query: 282 LYRGILVALSKTIPTTFVSFWGYE 305
            YRG+   L + +P T ++F+ YE
Sbjct: 264 FYRGLSANLLRAVPATCITFFVYE 287

>CAGL0K12210g 1193771..1194706 similar to sp|P38087 Saccharomyces
           cerevisiae YBR104w YMC2 or sp|P32331 Saccharomyces
           cerevisiae YPR058w YMC1, start by similarity
          Length = 311

 Score = 64.3 bits (155), Expect = 1e-11,   Method: Compositional matrix adjust.
 Identities = 66/300 (22%), Positives = 124/300 (41%), Gaps = 40/300 (13%)

Query: 18  KTLLAGAVSGLLARSITAPMDTIKIRLQLTPANGLKPFGSQVMEVARSMIKNEGIRSFWK 77
           K + AG + G+    +  P DT K+RLQ +           V+EV +++++NEG  +F+K
Sbjct: 28  KDIFAGTMGGVAQVLVGQPFDTTKVRLQTSKTK------IGVIEVVQNLLRNEGALAFYK 81

Query: 78  GNIPGSLLYVTYGSAQFSSYSLFNRYLTPFGLE---------ARLHS-LVVGAFAGITSS 127
           G +   L      S QF       R+   +  +           LH   + G   G+ +S
Sbjct: 82  GMLTPLLGVGICVSVQFGVNESMKRFFAAYNADRVDPQKHVPLPLHQYYLCGLTGGVVNS 141

Query: 128 IVSYPFDVLRTRL-VANNQMHSMSITREVRDIWKLEGLPGFFKGSIASMTTITLTASIMF 186
            ++ P + +R RL    +Q +          I KL       +G + +M          F
Sbjct: 142 FLAAPIEHVRIRLQTQTSQGNERQFKGPFDCIKKLAKAKALMRGLLPTMIRAGHGLGTYF 201

Query: 187 GTYETIRIYCDENEKTTAAHK--KWELATLNHSAGTIGGVIAKIITFPLETIRRRMQFMN 244
             YE + +   E EK T  ++   W+L +     G + G I  +  +P++ ++  +Q   
Sbjct: 202 AAYEALVV--KEFEKGTPRNQIPAWKLCSF----GALSGTILWLTVYPVDVVKSVLQ--- 252

Query: 245 SKHLEKFSRHSSVYGSYKGYGFARIGLQILKQEGVSSLYRGILVALSKTIP---TTFVSF 301
           +  +E     +S+  + +          + KQ G+ + ++G +  + +  P    TFVSF
Sbjct: 253 TDSIENPKYKNSIIKATRA---------LYKQHGIPAFFKGFVPTMIRAAPANAATFVSF 303

 Score = 57.4 bits (137), Expect = 3e-09,   Method: Compositional matrix adjust.
 Identities = 40/167 (23%), Positives = 72/167 (43%), Gaps = 11/167 (6%)

Query: 91  SAQFSSYSLFNRY-----LTPFGLEARLHSLVVGAFAGITSSIVSYPFDVLRTRLVANNQ 145
           S +F +  L N        TP+G   +   +  G   G+   +V  PFD  + RL  +  
Sbjct: 2   SEEFPTPQLLNELEDVPPPTPYGRVVK--DIFAGTMGGVAQVLVGQPFDTTKVRLQTSKT 59

Query: 146 MHSMSITREVRDIWKLEGLPGFFKGSIASMTTITLTASIMFGTYETI-RIYCDENEKTTA 204
              + +   V+++ + EG   F+KG +  +  + +  S+ FG  E++ R +   N     
Sbjct: 60  --KIGVIEVVQNLLRNEGALAFYKGMLTPLLGVGICVSVQFGVNESMKRFFAAYNADRVD 117

Query: 205 AHKKWELATLNHS-AGTIGGVIAKIITFPLETIRRRMQFMNSKHLEK 250
             K   L    +   G  GGV+   +  P+E +R R+Q   S+  E+
Sbjct: 118 PQKHVPLPLHQYYLCGLTGGVVNSFLAAPIEHVRIRLQTQTSQGNER 164

 Score = 46.2 bits (108), Expect = 1e-05,   Method: Compositional matrix adjust.
 Identities = 45/188 (23%), Positives = 89/188 (47%), Gaps = 23/188 (12%)

Query: 21  LAGAVSGLLARSITAPMDTIKIRLQLTPANGLK-----PFGSQVMEVARSMIKNEGIRSF 75
           L G   G++   + AP++ ++IRLQ   + G +     PF   + ++A++       ++ 
Sbjct: 131 LCGLTGGVVNSFLAAPIEHVRIRLQTQTSQGNERQFKGPFDC-IKKLAKA-------KAL 182

Query: 76  WKGNIPGSLLYVTYG-SAQFSSY-SLFNRYL---TPFGLEARLHSLVVGAFAGITSSIVS 130
            +G +P +++   +G    F++Y +L  +     TP            GA +G    +  
Sbjct: 183 MRGLLP-TMIRAGHGLGTYFAAYEALVVKEFEKGTPRNQIPAWKLCSFGALSGTILWLTV 241

Query: 131 YPFDVLRTRLVAN---NQMHSMSITREVRDIWKLEGLPGFFKGSIASMTTITLTASIMFG 187
           YP DV+++ L  +   N  +  SI +  R ++K  G+P FFKG + +M       +  F 
Sbjct: 242 YPVDVVKSVLQTDSIENPKYKNSIIKATRALYKQHGIPAFFKGFVPTMIRAAPANAATFV 301

Query: 188 TYE-TIRI 194
           ++E T+R+
Sbjct: 302 SFEMTMRV 309

 Score = 43.9 bits (102), Expect = 8e-05,   Method: Compositional matrix adjust.
 Identities = 26/92 (28%), Positives = 45/92 (48%), Gaps = 1/92 (1%)

Query: 13  NVAAWKTLLAGAVSGLLARSITAPMDTIKIRLQLTPANGLKPFGSQVMEVARSMIKNEGI 72
            + AWK    GA+SG +      P+D +K  LQ       K + + +++  R++ K  GI
Sbjct: 220 QIPAWKLCSFGALSGTILWLTVYPVDVVKSVLQTDSIENPK-YKNSIIKATRALYKQHGI 278

Query: 73  RSFWKGNIPGSLLYVTYGSAQFSSYSLFNRYL 104
            +F+KG +P  +      +A F S+ +  R L
Sbjct: 279 PAFFKGFVPTMIRAAPANAATFVSFEMTMRVL 310

>YPR021C (AGC1) [5455] chr16 complement(600644..603352) Member of
           the mitochondrial carrier family (MCF) of membrane
           transporters [2709 bp, 902 aa]
          Length = 902

 Score = 65.5 bits (158), Expect = 1e-11,   Method: Compositional matrix adjust.
 Identities = 75/296 (25%), Positives = 124/296 (41%), Gaps = 37/296 (12%)

Query: 23  GAVSGLLARSITAPMDTIKIRLQLTPANGLKPFGSQVMEVARSMIKNEGIRSFWKGNIPG 82
           G+++G +  ++  P+D IK R+Q      L  + + + +    +I  EGI+  + G  P 
Sbjct: 537 GSIAGCIGATVVYPIDFIKTRMQ--AQRSLAQYKNSI-DCLLKIISREGIKGLYSGLGP- 592

Query: 83  SLLYVTYGSAQFSSYSLF--NRYLTPFGLEARLHSLVVGAFAGITSSIVSYPFDVLRTRL 140
            L+ V    A   + + F  NR     G  +    ++ GA AG    I + P ++++ RL
Sbjct: 593 QLIGVAPEKAIKLTVNDFMRNRLTDKNGKLSLFPEIISGASAGACQVIFTNPLEIVKIRL 652

Query: 141 VANNQMHSMSITREVRD-------IWKLEGLPGFFKGSIASMTTITLTASIMFGTYETIR 193
               Q+ S  +   ++        I K  GL G + G  A +      ++I F TY  ++
Sbjct: 653 ----QVQSDYVGENIQQANETATQIVKKLGLRGLYNGVAACLMRDVPFSAIYFPTYAHLK 708

Query: 194 ---IYCDENEKTTAAH-KKWELATLNHSAGTIGGVIAKIITFPLETIRRRMQFMNSKHLE 249
                 D N+KT     K WEL T    AG I G+ A  +T P + I+ R+Q    K   
Sbjct: 709 KDLFDFDPNDKTKRNRLKTWELLT----AGAIAGMPAAFLTTPFDVIKTRLQIDPRK--- 761

Query: 250 KFSRHSSVYGSYKGYGFARIGLQILKQEGVSSLYRGILVALSKTIPTTFVSFWGYE 305
                    G  K  G       ILK+E   S ++G    + ++ P    +   YE
Sbjct: 762 ---------GETKYNGIFHAIRTILKEESFRSFFKGGGARVLRSSPQFGFTLAAYE 808

 Score = 60.5 bits (145), Expect = 6e-10,   Method: Compositional matrix adjust.
 Identities = 51/189 (26%), Positives = 88/189 (46%), Gaps = 16/189 (8%)

Query: 10  KGQNVAAWKTLLAGAVSGLLARSITAPMDTIKIRLQLTPANGLKPFGSQVMEVARSMIKN 69
           K   ++ +  +++GA +G      T P++ +KIRLQ+  ++ +     Q  E A  ++K 
Sbjct: 618 KNGKLSLFPEIISGASAGACQVIFTNPLEIVKIRLQVQ-SDYVGENIQQANETATQIVKK 676

Query: 70  EGIRSFWKGNIPGSLLYVTYGSAQFSSYSLFNRYLTPFGLEA-----RLHS---LVVGAF 121
            G+R  + G     +  V + +  F +Y+   + L  F         RL +   L  GA 
Sbjct: 677 LGLRGLYNGVAACLMRDVPFSAIYFPTYAHLKKDLFDFDPNDKTKRNRLKTWELLTAGAI 736

Query: 122 AGITSSIVSYPFDVLRTRLVAN---NQMHSMSITREVRDIWKLEGLPGFFKGSIASMTTI 178
           AG+ ++ ++ PFDV++TRL  +    +     I   +R I K E    FFKG  A +   
Sbjct: 737 AGMPAAFLTTPFDVIKTRLQIDPRKGETKYNGIFHAIRTILKEESFRSFFKGGGARV--- 793

Query: 179 TLTASIMFG 187
            L +S  FG
Sbjct: 794 -LRSSPQFG 801

 Score = 56.6 bits (135), Expect = 1e-08,   Method: Compositional matrix adjust.
 Identities = 27/77 (35%), Positives = 43/77 (55%), Gaps = 2/77 (2%)

Query: 2   FKEEDSLRKGQNVAAWKTLLAGAVSGLLARSITAPMDTIKIRLQLTPANGLKPFGSQVME 61
           F   D  ++ + +  W+ L AGA++G+ A  +T P D IK RLQ+ P  G   +   +  
Sbjct: 714 FDPNDKTKRNR-LKTWELLTAGAIAGMPAAFLTTPFDVIKTRLQIDPRKGETKYNG-IFH 771

Query: 62  VARSMIKNEGIRSFWKG 78
             R+++K E  RSF+KG
Sbjct: 772 AIRTILKEESFRSFFKG 788

 Score = 46.6 bits (109), Expect = 2e-05,   Method: Compositional matrix adjust.
 Identities = 49/209 (23%), Positives = 85/209 (40%), Gaps = 30/209 (14%)

Query: 101 NRYLTPFGLEARLHSLVVGAFAGITSSIVSYPFDVLRTRLVANNQM--HSMSITREVRDI 158
           N Y  P  +   L++  +G+ AG   + V YP D ++TR+ A   +  +  SI   ++ I
Sbjct: 521 NYYFYP--IFDSLYNFSLGSIAGCIGATVVYPIDFIKTRMQAQRSLAQYKNSIDCLLKII 578

Query: 159 WKLEGLPGFFKGSIASMTTITLTASIMFGTYETIRIYCDENEKTTAAHKKWELATLNHSA 218
            + EG+ G + G    +  +    +I     + +R       + T  + K  L      +
Sbjct: 579 SR-EGIKGLYSGLGPQLIGVAPEKAIKLTVNDFMR------NRLTDKNGKLSLFP-EIIS 630

Query: 219 GTIGGVIAKIITFPLETIRRRMQFMNSKHLEKFSRHSSVYGSYKGYGFAR---IGLQILK 275
           G   G    I T PLE ++ R+Q               V   Y G    +      QI+K
Sbjct: 631 GASAGACQVIFTNPLEIVKIRLQ---------------VQSDYVGENIQQANETATQIVK 675

Query: 276 QEGVSSLYRGILVALSKTIPTTFVSFWGY 304
           + G+  LY G+   L + +P + + F  Y
Sbjct: 676 KLGLRGLYNGVAACLMRDVPFSAIYFPTY 704

>ADL049W [1692] [Homologous to ScYPR021C - SH]
           complement(598135..600873) [2739 bp, 912 aa]
          Length = 912

 Score = 65.5 bits (158), Expect = 1e-11,   Method: Compositional matrix adjust.
 Identities = 56/205 (27%), Positives = 99/205 (48%), Gaps = 16/205 (7%)

Query: 2   FKEEDSLRKGQNVAAWKTLLAGAVSGLLARSITAPMDTIKIRLQLTPANGLKPFGSQVME 61
           F  +DS ++ + +  W+ L++G ++G+ A  +T P D IK RLQ+ P  G   +   + +
Sbjct: 707 FDPKDSDKRNK-LNTWQLLVSGGLAGMPAAFLTTPFDVIKTRLQIDPKKGESVYNG-IWD 764

Query: 62  VARSMIKNEGIRSFWKGNIPGSLLYVTYGSAQF----SSYSLF-NRYLTPFGLEARLHSL 116
            AR+++K EGI+SF+KG  P  +L     S QF    ++Y +F N +  P   ++  H  
Sbjct: 765 AARTILKEEGIKSFFKGG-PARVL---RSSPQFGFTLAAYEIFHNLFPAPRYDDSTTHRP 820

Query: 117 V---VGAFAGITSSIVSYPFDVLRTRLVANNQMHSMSITREVRDIWKLEGLPGFFKGSIA 173
               VGA A I  ++ ++  D L    V NN+  S      + D +    L  ++K    
Sbjct: 821 TREPVGALAPINKTVSAFFPDQLEPH-VGNNKWASRLYGPNI-DPYSSSFLNYYYKSCQV 878

Query: 174 SMTTITLTASIMFGTYETIRIYCDE 198
           +   + L  +     + T + + DE
Sbjct: 879 AKAFMDLDYNFAHFDFNTYQQFHDE 903

 Score = 57.4 bits (137), Expect = 6e-09,   Method: Compositional matrix adjust.
 Identities = 68/304 (22%), Positives = 134/304 (44%), Gaps = 54/304 (17%)

Query: 23  GAVSGLLARSITAPMDTIKIRLQLTPANGLKPFG--SQVMEVARSMIKNEGIRSFWKGNI 80
           G+V+G +   +  P+D +K R+Q       + F      ++    ++  EG+R  + G  
Sbjct: 531 GSVAGCIGAMVVYPIDMVKTRMQ-----AQRDFSKYKNSIDCLLKILSKEGVRGLYSGLG 585

Query: 81  PGSLLYVTYGSAQFSSYSL-FNRYL--TPFGLEARLH---SLVVGAFAGITSSIVSYPFD 134
           P  +     G A   +  L  N ++  T  G + +L     ++ GA AG    + + P +
Sbjct: 586 PQLI-----GVAPEKAIKLTVNDHMRATLAGRDGKLSLPCEIISGATAGACQVVFTNPLE 640

Query: 135 VLRTRL---------VANNQMHSMSITREVRDIWKLEGLPGFFKGSIASMTTITLTASIM 185
           +++ RL          A N ++++S+ + +       GL G ++G+ A +      ++I 
Sbjct: 641 IVKIRLQVKSDYVADAARNSVNAISVIKNL-------GLIGLYRGAGACLLRDIPFSAIY 693

Query: 186 FGTYETIR--IYCDENEKTTAAHK--KWELATLNHSAGTIGGVIAKIITFPLETIRRRMQ 241
           F TY  I+  ++  + + +   +K   W+L      +G + G+ A  +T P + I+ R+Q
Sbjct: 694 FPTYAHIKSNVFNFDPKDSDKRNKLNTWQLLV----SGGLAGMPAAFLTTPFDVIKTRLQ 749

Query: 242 FMNSKHLEKFSRHSSVYGSYKGYGFARIGLQILKQEGVSSLYRGILVALSKTIPTTFVSF 301
            ++ K  E      SVY      G       ILK+EG+ S ++G    + ++ P    + 
Sbjct: 750 -IDPKKGE------SVYN-----GIWDAARTILKEEGIKSFFKGGPARVLRSSPQFGFTL 797

Query: 302 WGYE 305
             YE
Sbjct: 798 AAYE 801

 Score = 56.2 bits (134), Expect = 1e-08,   Method: Compositional matrix adjust.
 Identities = 52/185 (28%), Positives = 86/185 (46%), Gaps = 29/185 (15%)

Query: 20  LLAGAVSGLLARSITAPMDTIKIRLQLTPANGLKPFGSQVMEVAR------SMIKNEGIR 73
           +++GA +G      T P++ +KIRLQ+            V + AR      S+IKN G+ 
Sbjct: 622 IISGATAGACQVVFTNPLEIVKIRLQVK--------SDYVADAARNSVNAISVIKNLGLI 673

Query: 74  SFWKGNIPGSLLYVTYGSAQFSSY-----SLFNRYLTPFGLEARLHS---LVVGAFAGIT 125
             ++G     L  + + +  F +Y     ++FN          +L++   LV G  AG+ 
Sbjct: 674 GLYRGAGACLLRDIPFSAIYFPTYAHIKSNVFNFDPKDSDKRNKLNTWQLLVSGGLAGMP 733

Query: 126 SSIVSYPFDVLRTRLVANNQMHS---MSITREVRDIWKLEGLPGFFKGSIASMTTITLTA 182
           ++ ++ PFDV++TRL  + +        I    R I K EG+  FFKG  A +    L +
Sbjct: 734 AAFLTTPFDVIKTRLQIDPKKGESVYNGIWDAARTILKEEGIKSFFKGGPARV----LRS 789

Query: 183 SIMFG 187
           S  FG
Sbjct: 790 SPQFG 794

 Score = 46.2 bits (108), Expect = 3e-05,   Method: Compositional matrix adjust.
 Identities = 43/195 (22%), Positives = 88/195 (45%), Gaps = 25/195 (12%)

Query: 113 LHSLVVGAFAGITSSIVSYPFDVLRTRLVANNQM--HSMSITREVRDIWKLEGLPGFFKG 170
           +++  +G+ AG   ++V YP D+++TR+ A      +  SI   ++ I   EG+ G + G
Sbjct: 525 IYNFTLGSVAGCIGAMVVYPIDMVKTRMQAQRDFSKYKNSIDCLLK-ILSKEGVRGLYSG 583

Query: 171 SIASMTTITLTASIMFGTYETIRIYCDENEKTTAAHKKWELA-TLNHSAGTIGGVIAKII 229
               +  +           + I++  +++ + T A +  +L+      +G   G    + 
Sbjct: 584 LGPQLIGV--------APEKAIKLTVNDHMRATLAGRDGKLSLPCEIISGATAGACQVVF 635

Query: 230 TFPLETIRRRMQFMNSKHLEKFSRHSSVYGSYKGYGFARIGLQILKQEGVSSLYRGILVA 289
           T PLE ++ R+Q + S ++   +R+S               + ++K  G+  LYRG    
Sbjct: 636 TNPLEIVKIRLQ-VKSDYVADAARNSVN------------AISVIKNLGLIGLYRGAGAC 682

Query: 290 LSKTIPTTFVSFWGY 304
           L + IP + + F  Y
Sbjct: 683 LLRDIPFSAIYFPTY 697

>YMR056C (AAC1) [4016] chr13 complement(387314..388243) ADP/ATP
           carrier protein of the mitochondrial carrier family
           (MCF) of membrane transporters [930 bp, 309 aa]
          Length = 309

 Score = 64.3 bits (155), Expect = 2e-11,   Method: Compositional matrix adjust.
 Identities = 71/287 (24%), Positives = 124/287 (43%), Gaps = 44/287 (15%)

Query: 20  LLAGAVSGLLARSITAPMDTIKIRLQ----LTPANGLKPFGSQVMEVARSMIKNEGIRSF 75
            L G VS  +A++  AP++ +K+ +Q    +     L      +++  +    +EGI SF
Sbjct: 17  FLMGGVSAAIAKTGAAPIERVKLLMQNQEEMLKQGSLDTRYKGILDCFKRTATHEGIVSF 76

Query: 76  WKGNIPGSLLYVTYGSAQFSSYSLFNRYLTPFGLEARLHS------LVVGAFAGITSSIV 129
           W+GN    L Y    +  F+        L+ +  E   ++      L  G  AG  S + 
Sbjct: 77  WRGNTANVLRYFPTQALNFAFKDKIKSLLS-YDRERDGYAKWFAGNLFSGGAAGGLSLLF 135

Query: 130 SYPFDVLRTRLVANNQMHSMSITREVR---DIWK----LEGLPGFFKGSIASMTTITLTA 182
            Y  D  RTRL A+ +    +  R+     D++K     +GL G ++G + S+  I +  
Sbjct: 136 VYSLDYARTRLAADARGSKSTSQRQFNGLLDVYKKTLKTDGLLGLYRGFVPSVLGIIVYR 195

Query: 183 SIMFGTYETIRIYCDENEKTTAAHKKWELATLNHSAGTIGGVI---AKIITFPLETIRRR 239
            + FG Y++ +         T A +   +A+       +G VI   A   ++PL+T+RRR
Sbjct: 196 GLYFGLYDSFKPVL-----LTGALEGSFVASF-----LLGWVITMGASTASYPLDTVRRR 245

Query: 240 MQFMNSKHLEKFSRHSSVYGSYKGYGFARIGLQILKQEGVSSLYRGI 286
           M  M S    K+             G      +I+++EG  SL++G 
Sbjct: 246 M-MMTSGQTIKYD------------GALDCLRKIVQKEGAYSLFKGC 279

>CAGL0G01166g complement(111298..112185) highly similar to tr|Q06143
           Saccharomyces cerevisiae YLR348c DIC1, hypothetical
           start
          Length = 295

 Score = 63.5 bits (153), Expect = 2e-11,   Method: Compositional matrix adjust.
 Identities = 68/304 (22%), Positives = 127/304 (41%), Gaps = 56/304 (18%)

Query: 23  GAVSGLLARSITAPMDTIKIRLQLTPANGLKPFGSQVMEVARSMIKNEGIRSFWKGNIPG 82
           G  +G+ A   T P+D  K+RLQ  P    KP    ++++ RS++KNEGI   + G    
Sbjct: 13  GGAAGIFAVMNTHPLDLTKVRLQAAPIP--KP---TIVQMLRSILKNEGIVGLYAGLSAS 67

Query: 83  SLLYVTYGSAQFSSYSLFNRYLTPFGLEARL-----HSLVVGAFAGITSSIVSYPFDVLR 137
            L   TY +A+F  Y     ++ P      +      S+V GA  G+  +      D++ 
Sbjct: 68  LLRQCTYTTARFGMYDALKEHVIPRDKLTNMWYLLGASMVSGALGGLAGNFA----DLIN 123

Query: 138 TRLVANNQMHSMSITREVRD-------IWKLEGL---------PGFFKGSIASMTTITLT 181
            R+  N+    +   R  ++       I+K EG          P   +G +  MT   + 
Sbjct: 124 IRM-QNDSALPLDKRRNYKNAIDGMVKIYKAEGAKSLFLTGWKPNMVRGVL--MTASQVV 180

Query: 182 ASIMFGTYETIRIYCDENEKTTAAHKKWELATLNHSAGTIGGVIAKIITFPLETIRRRMQ 241
              MF  +   +   D  + +T           + ++  + G +A  +  P + I+  + 
Sbjct: 181 TYDMFKNFLVTKYNMDPKKNST-----------HLTSSLLAGFVATTVCSPADVIKTIV- 228

Query: 242 FMNSKHLEKFSRHSSVYGSYKGYGFARIGLQILKQEGVSSLYRGILVALSKTIPTTFVSF 301
            MN+ H +    H S +         +I ++ + +EG S ++RG + + ++  P T + F
Sbjct: 229 -MNA-HKKPGHNHDSSF---------KILMEAINKEGPSFMFRGWVPSFTRLAPFTMLIF 277

Query: 302 WGYE 305
           +  E
Sbjct: 278 FAME 281

>Sklu_1926.2 YPR058W, Contig c1926 347-1264 reverse complement
          Length = 305

 Score = 63.5 bits (153), Expect = 3e-11,   Method: Compositional matrix adjust.
 Identities = 70/307 (22%), Positives = 119/307 (38%), Gaps = 44/307 (14%)

Query: 17  WKTLLAGAVSGLLARSITAPMDTIKIRLQLTPANGLKPFGSQVMEVARSMIKNEGIRSFW 76
           +K LLAG   G+    I  P DT K+RLQ +         +  ++V + ++KNEG R F+
Sbjct: 24  FKDLLAGTAGGVSQVLIGQPFDTTKVRLQTSSVP------TTALDVVKKLVKNEGFRGFY 77

Query: 77  KGNIPGSLLYVTYGSAQFSSYSLFNRYL-------TPFGLEARLHSLVVGAFAGITSSIV 129
           KG +   +      S QF       R+         P      L   + G   G  +S +
Sbjct: 78  KGTLTPLVGVGACVSVQFGVNEAMKRFFHSRNGNSGPNETLGLLQYYLCGFAGGTANSFL 137

Query: 130 SYPFDVLRTRLV------ANNQMHSMSITREVRDIWKLEGLPGFFKGSIASMTTITLTAS 183
           + P + +R RL       A  Q H       +  I KL       +G   +M   +    
Sbjct: 138 ASPIEHVRIRLQTQTGTGAAAQFHG-----PLDCIKKLTANNSLMRGLTPTMLRESHGCG 192

Query: 184 IMFGTYETIRIYCDENEKTTAAHK--KWELATLNHSAGTIGGVIAKIITFPLETIRRRMQ 241
           + F TYE   +  +E  K  +  +   W+L     ++GT       ++ +PL+ I+  MQ
Sbjct: 193 VYFLTYEA--LIANELHKGVSRSEIPTWKLCLFGATSGT----TLWLMIYPLDVIKSVMQ 246

Query: 242 FMNSKHLEKFSRHSSVYGSYKGYGFARIGLQILKQEGVSSLYRGILVALSKTIPTTFVSF 301
                         S+    +G    ++   I    G+SS ++G    + +  P    +F
Sbjct: 247 ------------TDSLLQPKQGKNMLQVAKTIYSTRGLSSFFKGFGPTMLRAAPANGATF 294

Query: 302 WGYETAI 308
             +E A+
Sbjct: 295 ATFELAM 301

 Score = 42.7 bits (99), Expect = 2e-04,   Method: Compositional matrix adjust.
 Identities = 32/103 (31%), Positives = 49/103 (47%), Gaps = 6/103 (5%)

Query: 6   DSLRKG---QNVAAWKTLLAGAVSGLLARSITAPMDTIKIRLQLTPANGLKP-FGSQVME 61
           + L KG     +  WK  L GA SG     +  P+D IK  +Q      L+P  G  +++
Sbjct: 204 NELHKGVSRSEIPTWKLCLFGATSGTTLWLMIYPLDVIKSVMQTDSL--LQPKQGKNMLQ 261

Query: 62  VARSMIKNEGIRSFWKGNIPGSLLYVTYGSAQFSSYSLFNRYL 104
           VA+++    G+ SF+KG  P  L       A F+++ L  R L
Sbjct: 262 VAKTIYSTRGLSSFFKGFGPTMLRAAPANGATFATFELAMRVL 304

>Scas_645.9
          Length = 391

 Score = 63.5 bits (153), Expect = 3e-11,   Method: Compositional matrix adjust.
 Identities = 53/198 (26%), Positives = 97/198 (48%), Gaps = 30/198 (15%)

Query: 20  LLAGAVSGLLARSITAPMDTIKIRLQLTPANGLKPFGSQVM------EVARSMIKNEGIR 73
           L+ GA++ +LA S  AP++ +K +LQ  P    K   S +M      E  + M  +    
Sbjct: 189 LMCGAIARILAASTVAPLELLKTKLQSIPRVS-KSTTSWMMVKELLKETRQEMRISGASN 247

Query: 74  SFWKG-------NIPGSLLYVTYGSAQFSSYSLF-NRYLTPFGLEARLHSLVVGAFAGIT 125
           + +KG       ++P S +Y  +GS +F    L+ +   +   L   ++S + G+ +G  
Sbjct: 248 ALFKGLEITLWRDVPFSAIY--WGSYEFCKTHLWMDTSKSHSNLTFFINSFIGGSISGTI 305

Query: 126 SSIVSYPFDVLRTR----LVANNQM---------HSMSITREVRDIWKLEGLPGFFKGSI 172
           +++V++PFDV +TR     + NN            + ++ + +R+IWKLEG    + G +
Sbjct: 306 AALVTHPFDVGKTRWQISFMGNNDKSVVKSPDIEQTKNMFKFLRNIWKLEGWGALYTGLV 365

Query: 173 ASMTTITLTASIMFGTYE 190
             M  I  + +IM  +YE
Sbjct: 366 PRMVKIAPSCAIMISSYE 383

 Score = 54.7 bits (130), Expect = 3e-08,   Method: Compositional matrix adjust.
 Identities = 59/260 (22%), Positives = 110/260 (42%), Gaps = 23/260 (8%)

Query: 60  MEVARSMIKNEGIRSFWKGNIPGSLLYVTYGSAQFSSYSLFNRYLTPFGLEA-RLHSLVV 118
           +E    + K EGI + W+G     L+ +      F+ Y    R  +P    +   + L+ 
Sbjct: 133 LEAFNKIWKLEGITTLWRGISINLLMAIPANIVYFTGYEYL-RDNSPLATSSPTFNPLMC 191

Query: 119 GAFAGITSSIVSYPFDVLRTRLVA--------NNQMHSMSITREVRDIWKLEGLP-GFFK 169
           GA A I ++    P ++L+T+L +         + M    + +E R   ++ G     FK
Sbjct: 192 GAIARILAASTVAPLELLKTKLQSIPRVSKSTTSWMMVKELLKETRQEMRISGASNALFK 251

Query: 170 GSIASMTTITLTASIMFGTYETIRIYCDEN--EKTTAAHKKWELATLNHSAGTIGGVIAK 227
           G   ++      ++I +G+YE    +C  +    T+ +H        +   G+I G IA 
Sbjct: 252 GLEITLWRDVPFSAIYWGSYE----FCKTHLWMDTSKSHSNLTFFINSFIGGSISGTIAA 307

Query: 228 IITFPLETIRRRMQ--FMNSKHLEKFSRHSSVYGSYKGYGFARIGLQILKQEGVSSLYRG 285
           ++T P +  + R Q  FM +   +   +   +  +   + F R    I K EG  +LY G
Sbjct: 308 LVTHPFDVGKTRWQISFMGNND-KSVVKSPDIEQTKNMFKFLR---NIWKLEGWGALYTG 363

Query: 286 ILVALSKTIPTTFVSFWGYE 305
           ++  + K  P+  +    YE
Sbjct: 364 LVPRMVKIAPSCAIMISSYE 383

>Scas_702.10
          Length = 302

 Score = 63.2 bits (152), Expect = 4e-11,   Method: Compositional matrix adjust.
 Identities = 70/300 (23%), Positives = 123/300 (41%), Gaps = 51/300 (17%)

Query: 23  GAVSGLLARSITAPMDTIKIRLQLTPANGLKPFGSQVMEVARSMIKNEGIRSFWKGNIPG 82
           G  +G+ A  +T P+D  K+RLQ  P    KP   +++    ++++NE +   + G    
Sbjct: 16  GGAAGIFACVMTHPLDLAKVRLQAAPLP--KPTLGRMLT---TILRNENVMGLYSGLSAA 70

Query: 83  SLLYVTYGSAQFSSYSLFNRYLTPFG-LEARLHSLVVGAFAGITSSIVSYPFDVLRTRLV 141
            L   TY + +F +Y L    L P G +   ++ L    F+G    +V    DV+  R+ 
Sbjct: 71  VLRQCTYTTVRFGAYDLMKENLIPQGHINDMVYLLPCSMFSGAIGGLVGNFADVVNIRM- 129

Query: 142 ANNQMHSMSITREVRD-------IWKLEG---------LPGFFKGSIASMTTITLTASIM 185
            N+      + R  R+       I+  EG          P   +G +  MT   +    +
Sbjct: 130 QNDSALKPELRRNYRNAIDGVYKIYMHEGGIKTLLTGWKPNMVRGVL--MTASQVVTYDV 187

Query: 186 FGTYETIRIYCDENEKTTAAHKKWELATLNHSAGTIGGVIAKIITFPLETIRRRMQFMNS 245
           F  Y   ++  D  + +T           + SA  + G++A  I  P + I+ R+  MN+
Sbjct: 188 FKNYLVTKLSFDPKKNST-----------HLSASLLAGLVATTICSPADVIKTRI--MNA 234

Query: 246 KHLEKFSRHSSVYGSYKGYGFARIGLQILKQEGVSSLYRGILVALSKTIPTTFVSFWGYE 305
              E  S               +I    +K+EG S ++RG L   ++  P T + F+  E
Sbjct: 235 HKTESESA-------------IKILTSAIKKEGPSFMFRGWLPIFTRLGPFTMLIFFAIE 281

 Score = 46.2 bits (108), Expect = 1e-05,   Method: Compositional matrix adjust.
 Identities = 43/183 (23%), Positives = 84/183 (45%), Gaps = 14/183 (7%)

Query: 19  TLLAGAVSGLLARSITAPMDTIKIRLQLTPANGLKP-----FGSQVMEVARSMIKNEGIR 73
           ++ +GA+ GL+        D + IR+Q   A  LKP     + + +  V +  +   GI+
Sbjct: 108 SMFSGAIGGLVGNF----ADVVNIRMQNDSA--LKPELRRNYRNAIDGVYKIYMHEGGIK 161

Query: 74  SFWKGNIPGSLLYVTYGSAQFSSYSLFNRYL-TPFGLEARLHS--LVVGAFAGITSSIVS 130
           +   G  P  +  V   ++Q  +Y +F  YL T    + + +S  L     AG+ ++ + 
Sbjct: 162 TLLTGWKPNMVRGVLMTASQVVTYDVFKNYLVTKLSFDPKKNSTHLSASLLAGLVATTIC 221

Query: 131 YPFDVLRTRLVANNQMHSMSITREVRDIWKLEGLPGFFKGSIASMTTITLTASIMFGTYE 190
            P DV++TR++  ++  S S  + +    K EG    F+G +   T +     ++F   E
Sbjct: 222 SPADVIKTRIMNAHKTESESAIKILTSAIKKEGPSFMFRGWLPIFTRLGPFTMLIFFAIE 281

Query: 191 TIR 193
            ++
Sbjct: 282 QLK 284

>KLLA0E12353g complement(1092303..1093220)
           gi|1351895|sp|P49382|ADT_KLULA Kluyveromyces lactis ADP,
           ATP carrier protein (ADP/ATP translocase) (Adenine
           nucleotide translocator) (ANT), start by similarity
          Length = 305

 Score = 62.8 bits (151), Expect = 4e-11,   Method: Compositional matrix adjust.
 Identities = 61/291 (20%), Positives = 125/291 (42%), Gaps = 53/291 (18%)

Query: 20  LLAGAVSGLLARSITAPMDTIKIRLQ----LTPANGLKPFGSQVMEVARSMIKNEGIRSF 75
            L G VS  ++++  AP++ +K+ +Q    +     L    + ++E  +    +EG+ SF
Sbjct: 14  FLMGGVSAAVSKTAAAPIERVKLLIQNQDEMIKQGSLDRRYTGIVECFKRTAADEGVASF 73

Query: 76  WKGNIPGSLLYVTYGSAQFSSYSLFNRYLTPFGLEARLHSLVVGAFAG---------ITS 126
           W+GN    + Y      Q  +++  ++    FG +          FAG           S
Sbjct: 74  WRGNTANVIRYF---PTQALNFAFKDKIKAMFGFKK--EEGYAKWFAGNLASGGLAGGLS 128

Query: 127 SIVSYPFDVLRTRLVANNQMHSMSITREVR---DIWKL----EGLPGFFKGSIASMTTIT 179
            +  Y  D  RTRL A+++       R+     D++K     +G+ G ++G + S+  I 
Sbjct: 129 LLFVYSLDYARTRLAADSKSAKKGGERQFNGLVDVYKKTLASDGVAGLYRGFLPSVVGIV 188

Query: 180 LTASIMFGTYETIRIY----CDENEKTTAAHKKWELATLNHSAGTIGGVIAKIITFPLET 235
           +   + FG Y++++        EN    +    W + T   +A           ++PL+T
Sbjct: 189 VYRGLYFGLYDSLKPLLLTGSLENSFLASFLLGWAVTTGASTA-----------SYPLDT 237

Query: 236 IRRRMQFMNSKHLEKFSRHSSVYGSYKGYGFARIGLQILKQEGVSSLYRGI 286
           +RRRM   + + +    ++   + +++         +I+  EG+ SL++G 
Sbjct: 238 VRRRMMMTSGQAV----KYDGAFDAFR---------KIVAAEGIKSLFKGC 275

>Scas_718.5
          Length = 324

 Score = 62.4 bits (150), Expect = 6e-11,   Method: Compositional matrix adjust.
 Identities = 68/299 (22%), Positives = 129/299 (43%), Gaps = 38/299 (12%)

Query: 18  KTLLAGAVSGLLARSITAPMDTIKIRLQLTPANGLKPFGSQVMEVARSMIKNEGIRSFWK 77
           K +LAG   G+    +  P DT K+R+Q +     K  G+  +++ R ++KNEG+ +F+K
Sbjct: 41  KDILAGTCGGISQVIVGQPFDTTKVRMQTSA----KSVGA--LDIIRKLVKNEGVWAFYK 94

Query: 78  GN-IP----GSLLYVTYGSAQFSSYSLFNRYLTPFGLEARLHSLVVGAF------AGITS 126
           G+ IP    G+ + V +G  + +    F  + T  G + R  +L +G +       G+ +
Sbjct: 95  GSLIPIVGVGACVSVQFGVNE-AMKRFFREWNTSRGTQHRDGTLQLGQYYICGLTGGVVN 153

Query: 127 SIVSYPFDVLRTRL-VANNQMHSMSITREVRDIWKLEGLPGFFKGSIASMTTITLTASIM 185
           S ++ P + +R RL       +       +  I KL       +G    M          
Sbjct: 154 SFLASPIEHVRIRLQTQTGNGNEREFKGPLDCIRKLVKEKSLMRGLRPMMLRAGHGLGCY 213

Query: 186 FGTYETIRIYCDENEKTTAAHKKWELATLNHSAGTIGGVIAKIITFPLETIRRRMQFMNS 245
           F TYE +     +  K  +    W+L     S G++ GV+  +  +PL+ ++  +Q    
Sbjct: 214 FLTYEALIANEIKKGKDRSEIASWKLC----SYGSLSGVVLWLAIYPLDVVKSMIQ---- 265

Query: 246 KHLEKFSRHSSVYGSYKGYGFARIGLQILKQEGVSSLYRGILVALSKTIPT---TFVSF 301
                  R+     S K      +   + +++G+S+ ++G    + +  P    TFV+F
Sbjct: 266 ---TDTLRNPRFKNSMK-----NVINHLYREQGISAFFKGFAPTMLRAAPVNGATFVTF 316

 Score = 56.6 bits (135), Expect = 5e-09,   Method: Compositional matrix adjust.
 Identities = 36/131 (27%), Positives = 60/131 (45%), Gaps = 4/131 (3%)

Query: 113 LHSLVVGAFAGITSSIVSYPFDVLRTRLVANNQMHSMSITREVRDIWKLEGLPGFFKGSI 172
           L  ++ G   GI+  IV  PFD  + R+       S+     +R + K EG+  F+KGS+
Sbjct: 40  LKDILAGTCGGISQVIVGQPFDTTKVRM--QTSAKSVGALDIIRKLVKNEGVWAFYKGSL 97

Query: 173 ASMTTITLTASIMFGTYETIRIYCDE-NEKTTAAHKKWELATLNHS-AGTIGGVIAKIIT 230
             +  +    S+ FG  E ++ +  E N      H+   L    +   G  GGV+   + 
Sbjct: 98  IPIVGVGACVSVQFGVNEAMKRFFREWNTSRGTQHRDGTLQLGQYYICGLTGGVVNSFLA 157

Query: 231 FPLETIRRRMQ 241
            P+E +R R+Q
Sbjct: 158 SPIEHVRIRLQ 168

 Score = 40.0 bits (92), Expect = 0.001,   Method: Compositional matrix adjust.
 Identities = 26/102 (25%), Positives = 50/102 (49%), Gaps = 4/102 (3%)

Query: 6   DSLRKGQN---VAAWKTLLAGAVSGLLARSITAPMDTIKIRLQLTPANGLKPFGSQVMEV 62
           + ++KG++   +A+WK    G++SG++      P+D +K  +Q       + F + +  V
Sbjct: 223 NEIKKGKDRSEIASWKLCSYGSLSGVVLWLAIYPLDVVKSMIQTDTLRNPR-FKNSMKNV 281

Query: 63  ARSMIKNEGIRSFWKGNIPGSLLYVTYGSAQFSSYSLFNRYL 104
              + + +GI +F+KG  P  L       A F ++ L  R L
Sbjct: 282 INHLYREQGISAFFKGFAPTMLRAAPVNGATFVTFELVMRLL 323

 Score = 39.3 bits (90), Expect = 0.003,   Method: Compositional matrix adjust.
 Identities = 37/180 (20%), Positives = 76/180 (42%), Gaps = 12/180 (6%)

Query: 21  LAGAVSGLLARSITAPMDTIKIRLQLTPANGLKPFGSQVMEVARSMIKNEGIRSFWKGNI 80
           + G   G++   + +P++ ++IRLQ    NG +      ++  R ++K    +S  +G  
Sbjct: 144 ICGLTGGVVNSFLASPIEHVRIRLQTQTGNGNEREFKGPLDCIRKLVKE---KSLMRGLR 200

Query: 81  PGSLLYVTYG-SAQFSSYSLFNRYLTPFGLE----ARLHSLVVGAFAGITSSIVSYPFDV 135
           P  +L   +G    F +Y          G +    A       G+ +G+   +  YP DV
Sbjct: 201 P-MMLRAGHGLGCYFLTYEALIANEIKKGKDRSEIASWKLCSYGSLSGVVLWLAIYPLDV 259

Query: 136 LRTRLVAN---NQMHSMSITREVRDIWKLEGLPGFFKGSIASMTTITLTASIMFGTYETI 192
           +++ +  +   N     S+   +  +++ +G+  FFKG   +M          F T+E +
Sbjct: 260 VKSMIQTDTLRNPRFKNSMKNVINHLYREQGISAFFKGFAPTMLRAAPVNGATFVTFELV 319

>Kwal_23.4731
          Length = 314

 Score = 62.0 bits (149), Expect = 7e-11,   Method: Compositional matrix adjust.
 Identities = 73/313 (23%), Positives = 139/313 (44%), Gaps = 36/313 (11%)

Query: 18  KTLLAGAVSGLLARSITAPMDTIKIRLQL----TPANGLKPFGSQVME--VARSMIKNEG 71
           + ++AG  +G L    T P+D +K+RLQL    T ++G K     ++    A S +  E 
Sbjct: 15  REIIAGLAAGTLTTIATHPLDLVKLRLQLLVNTTHSHGYKEVIKTIIRDSKADSNVFREA 74

Query: 72  IRSFWKGNIPGSLLYVTYGSAQFSSYSLFNRY-----LTP----FGLEARLHS---LVVG 119
            R      I  S+ +  Y      +  +  RY      TP    F  +  +     L   
Sbjct: 75  YRGLGVNLIGNSIAWGLYFGLYRFTKDMVYRYGVAQMKTPTQSSFQKDKAMGPSLYLASA 134

Query: 120 AFAGITSSIVSYPFDVLRTRLVANNQMHS---MSITREVRDIWKLEGLPGFFKGSIASMT 176
           A +G+ ++I++ P  V++TR+++ +   S    +    +R ++  EG  GF++G + S+ 
Sbjct: 135 ALSGLGTAILTNPIWVIKTRIMSTSSQASERYKTTWDGIRKVYAHEGFSGFWRGLVPSLF 194

Query: 177 TITLTASIMFGTYETIRIYCDENEKTTAAHKKWELATLNHSAGTIGGVIAKIITFPLETI 236
            +    +I F  Y+++R         T   K   L   N +  ++  +++    +P + +
Sbjct: 195 GVA-QGAIYFTIYDSLRHQYFARRGITEDEKMGNLE--NIAITSVSKMLSVTAVYPFQLL 251

Query: 237 RRRMQFMNSKHLEKFSRHSSVYGSYKGYGFARIGLQILKQEGVSSLYRGILVALSKTIPT 296
           +  +Q   +  +EK  R S        Y F  +   I ++EG+  LY+G+   L + IP+
Sbjct: 252 KSNLQSFAA--VEK--RDS--------YRFWNLVKSIHQKEGLQGLYKGLSANLLRAIPS 299

Query: 297 TFVSFWGYETAIH 309
           T ++F  YE   H
Sbjct: 300 TCITFCIYENLRH 312

>Scas_662.12
          Length = 308

 Score = 62.0 bits (149), Expect = 7e-11,   Method: Compositional matrix adjust.
 Identities = 66/317 (20%), Positives = 136/317 (42%), Gaps = 50/317 (15%)

Query: 18  KTLLAGAVSGLLARSITAPMDTIKIRLQLTPANGLKPFGSQVMEVARSMIKNEG------ 71
           K +++G  +G L   I  P+D IK+RLQL      +        +   +I N        
Sbjct: 9   KEIISGLSAGSLTTLIVHPLDLIKVRLQLLATTTTQQHQKGYTYLINELINNSKKMGSQG 68

Query: 72  -----IRSFWKG---NIPG-----SLLYVTYGSAQ---FSSYSLFNRYLTPFGLEARLHS 115
                I+  ++G   N+ G     SL +  Y S +   F +  L N   T F        
Sbjct: 69  PIYNLIKESYRGLPINLLGNAVAWSLYFTIYNSTKDYMFQNNYLHNNNTTIF-------- 120

Query: 116 LVVGAFAGITSSIVSYPFDVLRTRLVANNQMHS---MSITREVRDIWKLEGLPGFFKGSI 172
           L  G  +GI++++++ P  V++TR+++ ++ H     SI    + +   EG    + G +
Sbjct: 121 LTSGLISGISTTLLTNPLWVIKTRIMSTSRHHKDSYKSIRHGFKSLLTKEGPKAIWMGLL 180

Query: 173 ASMTTITLTASIMFGTYETIRIYCDEN---EKTTAAHKKWELATLNHSAGTIGGVIAKII 229
            S+  ++   +I F  Y+ ++++ + N    K   A+   ++  +     ++  +++ + 
Sbjct: 181 PSLLGVS-QGAIYFMIYDNLKLHFNVNLNKSKKDNANANLKIVLI----SSLSKMLSVMS 235

Query: 230 TFPLETIRRRMQFMNSKHLEKFSRHSSVYGSYKGYGFARIGLQILKQEGVSSLYRGILVA 289
            +P + ++  +Q           R  +       Y F  +  +I +  G+  LY+G+   
Sbjct: 236 VYPFQLLKSNLQTF---------RSVTNNIPQNDYHFITLIRKIYRDNGIKGLYKGLSAN 286

Query: 290 LSKTIPTTFVSFWGYET 306
           L + IP+T ++F  YE 
Sbjct: 287 LLRAIPSTCITFCIYEN 303

 Score = 55.1 bits (131), Expect = 2e-08,   Method: Compositional matrix adjust.
 Identities = 48/190 (25%), Positives = 88/190 (46%), Gaps = 21/190 (11%)

Query: 20  LLAGAVSGLLARSITAPMDTIKIRLQLTPANGLKPFGSQVMEVARSMIKNEGIRSFWKGN 79
           L +G +SG+    +T P+  IK R+  T  +    + S +    +S++  EG ++ W G 
Sbjct: 121 LTSGLISGISTTLLTNPLWVIKTRIMSTSRHHKDSYKS-IRHGFKSLLTKEGPKAIWMGL 179

Query: 80  IPGSLLYVTYGSAQFSSYS----LFNRYLTPF---GLEARLHSLVVGAFAGITSSIVSYP 132
           +P SLL V+ G+  F  Y      FN  L         A L  +++ + + + S +  YP
Sbjct: 180 LP-SLLGVSQGAIYFMIYDNLKLHFNVNLNKSKKDNANANLKIVLISSLSKMLSVMSVYP 238

Query: 133 FDVLRTRL---------VANNQMHSMSITREVRDIWKLEGLPGFFKGSIASMTTITLTAS 183
           F +L++ L         +  N  H +++   +R I++  G+ G +KG  A++     +  
Sbjct: 239 FQLLKSNLQTFRSVTNNIPQNDYHFITL---IRKIYRDNGIKGLYKGLSANLLRAIPSTC 295

Query: 184 IMFGTYETIR 193
           I F  YE  +
Sbjct: 296 ITFCIYENFK 305

>YLR348C (DIC1) [3731] chr12 complement(826976..827872)
           Mitochondrial dicarboxylate transport protein, member of
           the mitochondrial carrier family (MCF) of membrane
           transporters [897 bp, 298 aa]
          Length = 298

 Score = 61.6 bits (148), Expect = 1e-10,   Method: Compositional matrix adjust.
 Identities = 65/292 (22%), Positives = 119/292 (40%), Gaps = 36/292 (12%)

Query: 23  GAVSGLLARSITAPMDTIKIRLQLTPANGLKPFGSQVMEVARSMIKNEGIRSFWKGNIPG 82
           G  +G+ A  +T P+D  K+RLQ  P    KP   +++E   S++ NEG+   + G    
Sbjct: 20  GGAAGIFATMVTHPLDLAKVRLQAAPMP--KPTLFRMLE---SILANEGVVGLYSGLSAA 74

Query: 83  SLLYVTYGSAQFSSYSLFNRYLTP--------FGLEARLHSLVVGAFAGITSSIVSYPFD 134
            L   TY + +F +Y L    + P        + L   + S  +G  AG  + +V+    
Sbjct: 75  VLRQCTYTTVRFGAYDLLKENVIPREQLTNMAYLLPCSMFSGAIGGLAGNFADVVNIRMQ 134

Query: 135 VLRTRLVANNQMHSMSITREVRDIWKLE-GLPGFFKGSIASMTTITLTASIMFGTYETIR 193
              + L A  + +  +    V  I++ E GL   F G   +M    L  +    TY+  +
Sbjct: 135 N-DSALEAAKRRNYKNAIDGVYKIYRYEGGLKTLFTGWKPNMVRGILMTASQVVTYDVFK 193

Query: 194 IYCDENEKTTAAHKKWELATLNHSAGTIGGVIAKIITFPLETIRRRMQFMNSKHLEKFSR 253
            Y        A+     L     +A  + G++A  +  P + ++ R+   +  H      
Sbjct: 194 NYLVTKLDFDASKNYTHL-----TASLLAGLVATTVCSPADVMKTRIMNGSGDHQPAL-- 246

Query: 254 HSSVYGSYKGYGFARIGLQILKQEGVSSLYRGILVALSKTIPTTFVSFWGYE 305
                         +I    +++EG S ++RG L + ++  P T + F+  E
Sbjct: 247 --------------KILADAVRKEGPSFMFRGWLPSFTRLGPFTMLIFFAIE 284

>Sklu_2359.6 YPR021C, Contig c2359 14617-17325
          Length = 902

 Score = 62.4 bits (150), Expect = 1e-10,   Method: Compositional matrix adjust.
 Identities = 52/191 (27%), Positives = 86/191 (45%), Gaps = 17/191 (8%)

Query: 8   LRKGQNVAAWKTLLAGAVSGLLARSITAPMDTIKIRLQLTPANGLKPFGSQVMEVARSMI 67
           + K  N+  +  +L+GA +G      T P++ +KIRLQ+          SQV   A  +I
Sbjct: 604 MDKHANLKWYFEILSGACAGACQVVFTNPLEVVKIRLQVRSEYAGDVLKSQV--TALGVI 661

Query: 68  KNEGIRSFWKGNIPGSLLYVTYGSAQFSSYSLFNRYLTPFGLEARLHS--------LVVG 119
           K  GI+  +KG     +  V + +  F +Y+   + +  +  + +           LV G
Sbjct: 662 KQLGIKGLYKGIAACLMRDVPFSAIYFPTYAHLKKDVFKYDPKDKKQRNKLKTWELLVAG 721

Query: 120 AFAGITSSIVSYPFDVLRTRLVAN---NQMHSMSITREVRDIWKLEGLPGFFKGSIASMT 176
             AG+ ++ ++ PFDV++TRL  +    +     I    R I K E    FFKG  A + 
Sbjct: 722 GLAGMPAAYLTTPFDVIKTRLQIDPRKGETRYEGIFHAARTILKEESFKSFFKGGSARV- 780

Query: 177 TITLTASIMFG 187
              L +S  FG
Sbjct: 781 ---LRSSPQFG 788

 Score = 56.6 bits (135), Expect = 1e-08,   Method: Compositional matrix adjust.
 Identities = 65/295 (22%), Positives = 122/295 (41%), Gaps = 36/295 (12%)

Query: 23  GAVSGLLARSITAPMDTIKIRLQLTPANGLKPFGSQVMEVARSMIKNEGIRSFWKGNIPG 82
           G+++G +  ++  P+D +K R+Q         + + +   A+ +   EGIR  + G  P 
Sbjct: 525 GSIAGCIGATVVYPIDLVKTRMQ--AQRSFSQYKNSIDCFAK-IFSREGIRGIYSGLGPQ 581

Query: 83  SLLYVTYGSAQFSSYSL-FNRYLTPFGLEARLH-----SLVVGAFAGITSSIVSYPFDVL 136
            +     G A   +  L  N Y+    ++   +      ++ GA AG    + + P +V+
Sbjct: 582 LI-----GVAPEKAIKLTVNDYMRGRLMDKHANLKWYFEILSGACAGACQVVFTNPLEVV 636

Query: 137 RTRLVANNQMHSMSITREVRD--IWKLEGLPGFFKGSIASMTTITLTASIMFGTYETIR- 193
           + RL   ++     +  +V    + K  G+ G +KG  A +      ++I F TY  ++ 
Sbjct: 637 KIRLQVRSEYAGDVLKSQVTALGVIKQLGIKGLYKGIAACLMRDVPFSAIYFPTYAHLKK 696

Query: 194 ---IYCDENEKTTAAHKKWELATLNHSAGTIGGVIAKIITFPLETIRRRMQFMNSKHLEK 250
               Y  +++K     K WEL      AG + G+ A  +T P + I+ R+Q    K    
Sbjct: 697 DVFKYDPKDKKQRNKLKTWELLV----AGGLAGMPAAYLTTPFDVIKTRLQIDPRK---- 748

Query: 251 FSRHSSVYGSYKGYGFARIGLQILKQEGVSSLYRGILVALSKTIPTTFVSFWGYE 305
                   G  +  G       ILK+E   S ++G    + ++ P    +   YE
Sbjct: 749 --------GETRYEGIFHAARTILKEESFKSFFKGGSARVLRSSPQFGFTLAAYE 795

 Score = 56.6 bits (135), Expect = 1e-08,   Method: Compositional matrix adjust.
 Identities = 28/79 (35%), Positives = 47/79 (59%), Gaps = 2/79 (2%)

Query: 1   MFKEEDSLRKGQN-VAAWKTLLAGAVSGLLARSITAPMDTIKIRLQLTPANGLKPFGSQV 59
           +FK +   +K +N +  W+ L+AG ++G+ A  +T P D IK RLQ+ P  G   +   +
Sbjct: 698 VFKYDPKDKKQRNKLKTWELLVAGGLAGMPAAYLTTPFDVIKTRLQIDPRKGETRYEG-I 756

Query: 60  MEVARSMIKNEGIRSFWKG 78
              AR+++K E  +SF+KG
Sbjct: 757 FHAARTILKEESFKSFFKG 775

 Score = 53.1 bits (126), Expect = 1e-07,   Method: Compositional matrix adjust.
 Identities = 48/198 (24%), Positives = 80/198 (40%), Gaps = 31/198 (15%)

Query: 113 LHSLVVGAFAGITSSIVSYPFDVLRTRLVANNQMHSMSITREVRD----IWKLEGLPGFF 168
           +++  +G+ AG   + V YP D+++TR+ A     S S  +   D    I+  EG+ G +
Sbjct: 519 IYNFTLGSIAGCIGATVVYPIDLVKTRMQA---QRSFSQYKNSIDCFAKIFSREGIRGIY 575

Query: 169 KGSIASMTTITLTASIMFGTYETIRIYCDENEKTTAAHKKWELATLNHSAGTIGGVIAKI 228
            G    +  +    +I      T+  Y         A+ KW    L   +G   G    +
Sbjct: 576 SGLGPQLIGVAPEKAIKL----TVNDYMRGRLMDKHANLKWYFEIL---SGACAGACQVV 628

Query: 229 ITFPLETIRRRMQFMNSKHLEKFSRHSSVYGSYKGYGFAR--IGLQILKQEGVSSLYRGI 286
            T PLE ++ R+Q               V   Y G         L ++KQ G+  LY+GI
Sbjct: 629 FTNPLEVVKIRLQ---------------VRSEYAGDVLKSQVTALGVIKQLGIKGLYKGI 673

Query: 287 LVALSKTIPTTFVSFWGY 304
              L + +P + + F  Y
Sbjct: 674 AACLMRDVPFSAIYFPTY 691

>CAGL0D01606g complement(169066..169983) highly similar to sp|P32331
           Saccharomyces cerevisiae YPR058w YMC1 or sp|P38087
           Saccharomyces cerevisiae YBR104w YMC2, start by
           similarity
          Length = 305

 Score = 61.2 bits (147), Expect = 1e-10,   Method: Compositional matrix adjust.
 Identities = 65/298 (21%), Positives = 119/298 (39%), Gaps = 30/298 (10%)

Query: 18  KTLLAGAVSGLLARSITAPMDTIKIRLQLTPANGLKPFGSQVMEVARSMIKNEGIRSFWK 77
           K LLAG   G+    I  P DT K+RLQ +         +   EV ++++KNEG + F+K
Sbjct: 27  KDLLAGTAGGIAQVLIGQPFDTTKVRLQTSKVP------TSAAEVVKNLLKNEGPKGFYK 80

Query: 78  GNIPGSLLYVTYGSAQFSSYSLFNRYLTPFGLEARL-----HSLVVGAFAGITSSIVSYP 132
           G +   +      S QF       R+     ++           + G   G+T+S ++ P
Sbjct: 81  GTLTPLVGVGACVSIQFGVNEAMKRFFHARNVDHNATLSLSQYYLCGLTGGMTNSFLASP 140

Query: 133 FDVLRTRLVANNQMHSMSITREVRD-IWKLEGLPGFFKGSIASMTTITLTASIMFGTYET 191
            + +R RL       + +  +   D I KL    G  +G I +M          F  YE 
Sbjct: 141 IEHVRIRLQTQTGSGAQAEFKGPIDCIKKLRSQKGLMRGLIPTMLREGHGCGTYFLVYEA 200

Query: 192 -IRIYCDENEKTTAAHKKWELATLNHSAGTIGGVIAKIITFPLETIRRRMQFMNSKHLEK 250
            +    ++  K T     W+L       G + G    ++ +P++ ++  MQ   + +L K
Sbjct: 201 LVSKQINQGLKRTEI-PPWKLCLY----GALSGTALWLMVYPIDVVKSVMQ---TDNLNK 252

Query: 251 FSRHSSVYGSYKGYGFARIGLQILKQEGVSSLYRGILVALSKTIPTTFVSFWGYETAI 308
                       G    ++   +  +EG+ + ++G    + +  P    +F  +E A+
Sbjct: 253 ---------PQNGKNMIQVARNLYAREGLKAFFKGFGPTMLRAAPANGGTFATFELAM 301

 Score = 45.8 bits (107), Expect = 2e-05,   Method: Compositional matrix adjust.
 Identities = 29/92 (31%), Positives = 47/92 (51%), Gaps = 3/92 (3%)

Query: 14  VAAWKTLLAGAVSGLLARSITAPMDTIKIRLQLTPANGLKP-FGSQVMEVARSMIKNEGI 72
           +  WK  L GA+SG     +  P+D +K  +Q    N  KP  G  +++VAR++   EG+
Sbjct: 215 IPPWKLCLYGALSGTALWLMVYPIDVVKSVMQTDNLN--KPQNGKNMIQVARNLYAREGL 272

Query: 73  RSFWKGNIPGSLLYVTYGSAQFSSYSLFNRYL 104
           ++F+KG  P  L         F+++ L  R L
Sbjct: 273 KAFFKGFGPTMLRAAPANGGTFATFELAMRLL 304

>Kwal_47.17321
          Length = 881

 Score = 62.4 bits (150), Expect = 1e-10,   Method: Compositional matrix adjust.
 Identities = 51/179 (28%), Positives = 86/179 (48%), Gaps = 17/179 (9%)

Query: 20  LLAGAVSGLLARSITAPMDTIKIRLQLTPANGLKPFGSQVMEVARSMIKNEGIRSFWKGN 79
           +++GA +G      T P++ +KIRLQ+          SQ+   A  ++K+ G+R  +KG 
Sbjct: 598 IISGAAAGACQVIFTNPLEIVKIRLQVRSEYADSLPKSQL--TALGVVKSLGLRGLYKGL 655

Query: 80  IPGSLLYVTYGSAQFSSYSLFNRYLTPFGLE-----ARLHS---LVVGAFAGITSSIVSY 131
           +   +  V + +  F +Y+   R +  +  +     ARLH+   L  G  AG+ ++ ++ 
Sbjct: 656 VACLMRDVPFSAIYFPTYAHLKRDIFNYDPQDKNKRARLHTWELLTAGGLAGMPAAYLTT 715

Query: 132 PFDVLRTRLVAN---NQMHSMSITREVRDIWKLEGLPGFFKGSIASMTTITLTASIMFG 187
           PFDV++TRL  +    +     I    R I K E    FFKG  A +    L +S  FG
Sbjct: 716 PFDVIKTRLQIDPRKGETRYTGILHAARTILKEERFKSFFKGGGARV----LRSSPQFG 770

 Score = 57.8 bits (138), Expect = 5e-09,   Method: Compositional matrix adjust.
 Identities = 65/286 (22%), Positives = 118/286 (41%), Gaps = 50/286 (17%)

Query: 19  TLLAGAVSGLLARSITAPMDTIKIRLQLTPANGLKPFGSQVMEVARSMIKNEGIRSFWKG 78
             L G+V+G +  +   P+D +K R+Q         + + + +    +   EGIR  + G
Sbjct: 503 NFLLGSVAGCIGATAVYPIDLVKTRMQ--AQRNFSQYKNSI-DCFVKIFSREGIRGIYSG 559

Query: 79  NIPGSLLYVTYGSAQFSSYSL-FNRYLTPFGLEA--RLH---SLVVGAFAGITSSIVSYP 132
             P  +     G A   +  L  N Y+    ++   RL     ++ GA AG    I + P
Sbjct: 560 LGPQLV-----GVAPEKAIKLTVNDYVRKLLMDENNRLTLPLEIISGAAAGACQVIFTNP 614

Query: 133 FDVLRTRL---------VANNQMHSMSITREVRDIWKLEGLPGFFKGSIASMTTITLTAS 183
            ++++ RL         +  +Q+ ++ + + +       GL G +KG +A +      ++
Sbjct: 615 LEIVKIRLQVRSEYADSLPKSQLTALGVVKSL-------GLRGLYKGLVACLMRDVPFSA 667

Query: 184 IMFGTYETIR----IYCDENEKTTAAHKKWELATLNHSAGTIGGVIAKIITFPLETIRRR 239
           I F TY  ++     Y  +++   A    WEL T    AG + G+ A  +T P + I+ R
Sbjct: 668 IYFPTYAHLKRDIFNYDPQDKNKRARLHTWELLT----AGGLAGMPAAYLTTPFDVIKTR 723

Query: 240 MQFMNSKHLEKFSRHSSVYGSYKGYGFARIGLQILKQEGVSSLYRG 285
           +Q    K            G  +  G       ILK+E   S ++G
Sbjct: 724 LQIDPRK------------GETRYTGILHAARTILKEERFKSFFKG 757

 Score = 53.1 bits (126), Expect = 1e-07,   Method: Compositional matrix adjust.
 Identities = 46/201 (22%), Positives = 89/201 (44%), Gaps = 25/201 (12%)

Query: 107 FGLEARLHSLVVGAFAGITSSIVSYPFDVLRTRLVA--NNQMHSMSITREVRDIWKLEGL 164
           F +   +++ ++G+ AG   +   YP D+++TR+ A  N   +  SI   V+ I+  EG+
Sbjct: 495 FPIFDSIYNFLLGSVAGCIGATAVYPIDLVKTRMQAQRNFSQYKNSIDCFVK-IFSREGI 553

Query: 165 PGFFKGSIASMTTITLTASIMFGTYETIR-IYCDENEKTTAAHKKWELATLNHSAGTIGG 223
            G + G    +  +    +I     + +R +  DEN + T          L   +G   G
Sbjct: 554 RGIYSGLGPQLVGVAPEKAIKLTVNDYVRKLLMDENNRLTLP--------LEIISGAAAG 605

Query: 224 VIAKIITFPLETIRRRMQFMNSKHLEKFSRHSSVYGSYKGYGFARIGLQILKQEGVSSLY 283
               I T PLE ++ R+Q + S++ +   +                 L ++K  G+  LY
Sbjct: 606 ACQVIFTNPLEIVKIRLQ-VRSEYADSLPKSQLT------------ALGVVKSLGLRGLY 652

Query: 284 RGILVALSKTIPTTFVSFWGY 304
           +G++  L + +P + + F  Y
Sbjct: 653 KGLVACLMRDVPFSAIYFPTY 673

 Score = 52.8 bits (125), Expect = 2e-07,   Method: Compositional matrix adjust.
 Identities = 24/62 (38%), Positives = 39/62 (62%), Gaps = 1/62 (1%)

Query: 17  WKTLLAGAVSGLLARSITAPMDTIKIRLQLTPANGLKPFGSQVMEVARSMIKNEGIRSFW 76
           W+ L AG ++G+ A  +T P D IK RLQ+ P  G   + + ++  AR+++K E  +SF+
Sbjct: 697 WELLTAGGLAGMPAAYLTTPFDVIKTRLQIDPRKGETRY-TGILHAARTILKEERFKSFF 755

Query: 77  KG 78
           KG
Sbjct: 756 KG 757

>KLLA0E09680g complement(860245..861168) similar to ca|CA5146|CaYMC2
           Candida albicans Carnitine/acylcarnitine translocase (by
           homology), start by similarity
          Length = 307

 Score = 61.2 bits (147), Expect = 2e-10,   Method: Compositional matrix adjust.
 Identities = 63/288 (21%), Positives = 126/288 (43%), Gaps = 39/288 (13%)

Query: 20  LLAGAVSGLLARSITAPMDTIKIRLQLTPANGLKPFGSQVMEVARSMIKNEGIRSFWKGN 79
            +AG  SG+   ++  P DTIK+RLQ T  N  +  G   ++      +N+GIR F+ G 
Sbjct: 27  FVAGVFSGVAKNAVGHPFDTIKVRLQ-TSQNETRFKGP--LDCVYKTFRNQGIRGFYLGF 83

Query: 80  IPGSLLYVTYGSAQFSSYS----LFNRYLTPFGLEARLHSLVV-GAFAGITSSIVSYPFD 134
            P  + ++   S           L ++Y+ P   +  L   ++ G  AG + S ++ P +
Sbjct: 84  TPPLVGWILMDSVMLGCLHNYRMLMHKYVYPNDEKLPLSGCIISGVLAGWSVSFIAPPIE 143

Query: 135 VLRTRLVANNQMHSMSITRE------VRDIWKLEGLPGFFKGSIASMTTITLTASIMFGT 188
           + + +L      +  + TR       ++ I+  +G+ G +KG I+++   T      +G+
Sbjct: 144 LAKAKLQVQ---YDKTTTRYKGPLDVIKKIYSAQGIRGLYKGLISTLIFRTHFV-YWWGS 199

Query: 189 YETIRIYCDENEKTTAAHKKWELATLNHSAGTIGGVIAKIITFPLETIRRRMQFMNSKHL 248
           YE +  +  EN K +        A +N  AG          T     + +++   N K+ 
Sbjct: 200 YELLTRWFRENTKMSE-------AAINFWAGGFSASFGFWTTAYPSDVVKQVVLCNDKYD 252

Query: 249 EKFSRHSSVYGSYKGYGFARIGLQ-ILKQEGVSSLYRGILVALSKTIP 295
                     GS+K +   R  ++ I + +G++  ++G + +  ++ P
Sbjct: 253 ----------GSFKSW---RTAVKDIYQSKGINGFFKGFVPSFLRSFP 287

 Score = 52.8 bits (125), Expect = 9e-08,   Method: Compositional matrix adjust.
 Identities = 49/205 (23%), Positives = 84/205 (40%), Gaps = 35/205 (17%)

Query: 111 ARLHSLVVGAFAGITSSIVSYPFDVLRTRL-VANNQMHSMSITREVRDIWKLEGLPGFFK 169
           +R+   V G F+G+  + V +PFD ++ RL  + N+         V   ++ +G+ GF+ 
Sbjct: 22  SRIMGFVAGVFSGVAKNAVGHPFDTIKVRLQTSQNETRFKGPLDCVYKTFRNQGIRGFYL 81

Query: 170 GSIASMTTITLTASIMFGTYETIRI----YCDENEKTTAAHKKWELATLNHSAGTIGGVI 225
           G    +    L  S+M G     R+    Y   N++            L  S   I GV+
Sbjct: 82  GFTPPLVGWILMDSVMLGCLHNYRMLMHKYVYPNDE-----------KLPLSGCIISGVL 130

Query: 226 A----KIITFPLETIRRRMQFMNSKHLEKFSRHSSVYGSYKGYGFARIGLQILKQEGVSS 281
           A      I  P+E  + ++Q    K   ++             G   +  +I   +G+  
Sbjct: 131 AGWSVSFIAPPIELAKAKLQVQYDKTTTRYK------------GPLDVIKKIYSAQGIRG 178

Query: 282 LYRGILVALSKTIPTTFVSFWG-YE 305
           LY+G++  L     T FV +WG YE
Sbjct: 179 LYKGLISTL--IFRTHFVYWWGSYE 201

>Scas_489.4
          Length = 297

 Score = 60.5 bits (145), Expect = 2e-10,   Method: Compositional matrix adjust.
 Identities = 44/189 (23%), Positives = 88/189 (46%), Gaps = 12/189 (6%)

Query: 18  KTLLAGAVSGLLARSITA-PMDTIKIRLQLTPANGLKP----FGSQVMEVARSMIKNEGI 72
           + ++AG  +GLL   +   P + IK  L +     LKP     G  ++    S+++++GI
Sbjct: 108 RGVVAGLGAGLLESVVAVTPFEAIKTAL-IDDKQALKPKYQNNGRGMLRNYGSLVRDQGI 166

Query: 73  RSFWKGNIPGSLLYVTYGSAQFSSYSLFNRYLTPFGLEARLHSL------VVGAFAGITS 126
              ++G +P S+      + +   Y+     +  +    +   L      +VGAF+G+ +
Sbjct: 167 MGLYRGVLPVSMRQAANQAVRLGCYNKIKTMVQDYTNAPKDRPLSSGLTFIVGAFSGVVT 226

Query: 127 SIVSYPFDVLRTRLVANNQMHSMSITREVRDIWKLEGLPGFFKGSIASMTTITLTASIMF 186
              + P D ++TR+ + +     S       I+K EGL  F+KG+   +  + L+  I+F
Sbjct: 227 VYTTMPIDTVKTRMQSLDATKYTSTVNCFAKIFKEEGLKTFWKGATPRLGRLILSGGIVF 286

Query: 187 GTYETIRIY 195
             YE + ++
Sbjct: 287 TIYENVLVF 295

 Score = 58.2 bits (139), Expect = 2e-09,   Method: Compositional matrix adjust.
 Identities = 67/307 (21%), Positives = 131/307 (42%), Gaps = 33/307 (10%)

Query: 14  VAAWKTLLAGAVSGLLARSITAPMDTIKIRLQLTPANGLKPFGSQVMEVARSMIKNEGIR 73
           V    + +AGA++G +  SIT P +  K RLQL            V+    +  K +G  
Sbjct: 8   VDPLHSFIAGALAGAIEASITYPFEFAKTRLQLIDKTSTASRNPLVL--IYNTAKTQGTG 65

Query: 74  SFWKGNIPGSLLYVTYGSA-QFSSYSLFNRYL-TPF-GLEARLHSLVVGAFAGITSSIVS 130
           + + G  P  ++  T  +  +F  +      L  P  G  +    +V G  AG+  S+V+
Sbjct: 66  AIYVG-CPAFIVGNTAKAGIRFLGFDTIKNMLRDPVTGELSGPRGVVAGLGAGLLESVVA 124

Query: 131 Y-PFDVLRTRLVANNQM-------HSMSITREVRDIWKLEGLPGFFKGSIASMTTITLTA 182
             PF+ ++T L+ + Q        +   + R    + + +G+ G ++G +          
Sbjct: 125 VTPFEAIKTALIDDKQALKPKYQNNGRGMLRNYGSLVRDQGIMGLYRGVLPVSMRQAANQ 184

Query: 183 SIMFGTYETIRIYCDENEKTTAAHKKWELAT-LNHSAGTIGGVIAKIITFPLETIRRRMQ 241
           ++  G Y  I+    +    T A K   L++ L    G   GV+    T P++T++ RMQ
Sbjct: 185 AVRLGCYNKIKTMVQD---YTNAPKDRPLSSGLTFIVGAFSGVVTVYTTMPIDTVKTRMQ 241

Query: 242 FMNSKHLEKFSRHSSVYGSYKGYGFARIGLQILKQEGVSSLYRGILVALSKTIPTTFVSF 301
            +++      ++++S    +          +I K+EG+ + ++G    L + I +  + F
Sbjct: 242 SLDA------TKYTSTVNCFA---------KIFKEEGLKTFWKGATPRLGRLILSGGIVF 286

Query: 302 WGYETAI 308
             YE  +
Sbjct: 287 TIYENVL 293

 Score = 43.9 bits (102), Expect = 8e-05,   Method: Compositional matrix adjust.
 Identities = 26/81 (32%), Positives = 45/81 (55%), Gaps = 4/81 (4%)

Query: 1   MFKEEDSLRKGQNVAAWKTLLAGAVSGLLARSITAPMDTIKIRLQLTPANGLKPFGSQVM 60
           M ++  +  K + +++  T + GA SG++    T P+DT+K R+Q   A     + S V 
Sbjct: 197 MVQDYTNAPKDRPLSSGLTFIVGAFSGVVTVYTTMPIDTVKTRMQSLDAT---KYTSTVN 253

Query: 61  EVARSMIKNEGIRSFWKGNIP 81
             A+ + K EG+++FWKG  P
Sbjct: 254 CFAK-IFKEEGLKTFWKGATP 273

>KLLA0E13453g complement(1184806..1187526) similar to sgd|S0006225
           Saccharomyces cerevisiae YPR021c, start by similarity
          Length = 906

 Score = 61.6 bits (148), Expect = 2e-10,   Method: Compositional matrix adjust.
 Identities = 65/277 (23%), Positives = 116/277 (41%), Gaps = 40/277 (14%)

Query: 23  GAVSGLLARSITAPMDTIKIRLQLTPANGLKPFGSQVMEVARSMIKNEGIRSFWKGNIPG 82
           G+++G +  ++  P+D +K R+Q    N ++   S  ++    + + +GIR  + G  P 
Sbjct: 511 GSIAGCIGATVVYPIDLVKTRMQ-AQRNSVQYKNS--IDCVVKIFQTKGIRGLYSGLGPQ 567

Query: 83  SLLYVTYGSAQFSSYSLFNRYLTPFGLEAR----LHSLVVGAFAGITSSIVSYPFDVLRT 138
            +      + + +      +Y   F  ++R       ++ GA AG    + + P ++++ 
Sbjct: 568 LIGVAPEKAIKLTVNDFMRQY---FMNKSRTIKWYQEILSGATAGACQVVFTNPLEIVKI 624

Query: 139 RLVANNQMHSMSITREVRD------IWKLEGLPGFFKGSIASMTTITLTASIMFGTYETI 192
           RL    QM S  +    R       I +  GL G +KG+ A +      ++I F TY  +
Sbjct: 625 RL----QMRSDYVGENARPQLGAVGIIRQLGLRGLYKGAAACLLRDVPFSAIYFPTYAHL 680

Query: 193 R---IYCDENEKTTAAH-KKWELATLNHSAGTIGGVIAKIITFPLETIRRRMQFMNSKHL 248
           +      D N+K      K WEL      AG I G+ A  +T P + I+ R+Q    K  
Sbjct: 681 KKDVFNFDPNDKNKRNKLKTWELLL----AGGIAGMPAAYLTTPFDVIKTRLQIDPRK-- 734

Query: 249 EKFSRHSSVYGSYKGYGFARIGLQILKQEGVSSLYRG 285
                     G     G       ILK+E + S ++G
Sbjct: 735 ----------GETTYTGVIHAARTILKEESIKSFFKG 761

 Score = 59.7 bits (143), Expect = 9e-10,   Method: Compositional matrix adjust.
 Identities = 51/197 (25%), Positives = 88/197 (44%), Gaps = 29/197 (14%)

Query: 8   LRKGQNVAAWKTLLAGAVSGLLARSITAPMDTIKIRLQLTPANGLKPFGSQVMEVARS-- 65
           + K + +  ++ +L+GA +G      T P++ +KIRLQ+            V E AR   
Sbjct: 590 MNKSRTIKWYQEILSGATAGACQVVFTNPLEIVKIRLQMR--------SDYVGENARPQL 641

Query: 66  ----MIKNEGIRSFWKGNIPGSLLYVTYGSAQFSSYSLFNRYLTPFGLEARLHS------ 115
               +I+  G+R  +KG     L  V + +  F +Y+   + +  F    +         
Sbjct: 642 GAVGIIRQLGLRGLYKGAAACLLRDVPFSAIYFPTYAHLKKDVFNFDPNDKNKRNKLKTW 701

Query: 116 --LVVGAFAGITSSIVSYPFDVLRTRLVANNQMHSMSIT---REVRDIWKLEGLPGFFKG 170
             L+ G  AG+ ++ ++ PFDV++TRL  + +    + T      R I K E +  FFKG
Sbjct: 702 ELLLAGGIAGMPAAYLTTPFDVIKTRLQIDPRKGETTYTGVIHAARTILKEESIKSFFKG 761

Query: 171 SIASMTTITLTASIMFG 187
             A +    L +S  FG
Sbjct: 762 GPARV----LRSSPQFG 774

 Score = 56.6 bits (135), Expect = 1e-08,   Method: Compositional matrix adjust.
 Identities = 48/195 (24%), Positives = 91/195 (46%), Gaps = 25/195 (12%)

Query: 113 LHSLVVGAFAGITSSIVSYPFDVLRTRLVA--NNQMHSMSITREVRDIWKLEGLPGFFKG 170
           +H+  +G+ AG   + V YP D+++TR+ A  N+  +  SI   V+ I++ +G+ G + G
Sbjct: 505 IHNFTLGSIAGCIGATVVYPIDLVKTRMQAQRNSVQYKNSIDCVVK-IFQTKGIRGLYSG 563

Query: 171 SIASMTTITLTASIMFGTYETIRIYCDENEKTTAAHKKWELATLNHSAGTIGGVIAKIIT 230
               +  +    +I     + +R Y     +T     KW    L   +G   G    + T
Sbjct: 564 LGPQLIGVAPEKAIKLTVNDFMRQYFMNKSRTI----KWYQEIL---SGATAGACQVVFT 616

Query: 231 FPLETIRRRMQFMNSKHLEKFSRHSSVYGSYKGYGFARIG-LQILKQEGVSSLYRGILVA 289
            PLE ++ R+Q M S ++ + +R              ++G + I++Q G+  LY+G    
Sbjct: 617 NPLEIVKIRLQ-MRSDYVGENAR-------------PQLGAVGIIRQLGLRGLYKGAAAC 662

Query: 290 LSKTIPTTFVSFWGY 304
           L + +P + + F  Y
Sbjct: 663 LLRDVPFSAIYFPTY 677

>YBR104W (YMC2) [293] chr2 (449624..450613) Member of the
           mitochondrial carrier (MCF) family of membrane
           transporters [990 bp, 329 aa]
          Length = 329

 Score = 60.5 bits (145), Expect = 3e-10,   Method: Compositional matrix adjust.
 Identities = 68/314 (21%), Positives = 121/314 (38%), Gaps = 47/314 (14%)

Query: 18  KTLLAGAVSGLLARSITAPMDTIKIRLQLTPANGLKPFGSQVMEVARSMIKNEGIRSFWK 77
           K + AG + G+    +  P DT K+RLQ           +  +EV R+++KNEG+ +F+K
Sbjct: 36  KDIFAGTIGGIAQVLVGQPFDTTKVRLQTATTR------TTTLEVLRNLVKNEGVFAFYK 89

Query: 78  GNIPGSLLYVTYGSAQFSSYSLFNRYLTPFGLE------------ARLHSL------VVG 119
           G +   L      S QF       R+   +               +R ++L      V G
Sbjct: 90  GALTPLLGVGICVSVQFGVNEAMKRFFQNYNASKNPNMSSQDVDLSRSNTLPLSQYYVCG 149

Query: 120 AFAGITSSIVSYPFDVLRTRLVANNQMHSMSITREVRDIW----KLEGLPGFFKGSIASM 175
              G+ +S ++ P + +R RL       S    RE +  W    KL+   G  +G   +M
Sbjct: 150 LTGGVVNSFLASPIEQIRIRL---QTQTSNGGDREFKGPWDCIKKLKAQGGLMRGLFPTM 206

Query: 176 TTITLTASIMFGTYETIRIYCDENEKTTAAHKKWELATLNHSAGTIGGVIAKIITFPLET 235
                     F  YE +         T      W+L       G   G +  +  +PL+ 
Sbjct: 207 IRAGHGLGTYFLVYEALVAREIGTGLTRNEIPPWKLCLF----GAFSGTMLWLTVYPLDV 262

Query: 236 IRRRMQFMNSKHLEKFSRHSSVYGSYKGYGFARIGLQILKQEGVSSLYRGILVALSKTIP 295
           ++  +Q   +  L K    +S+  SY       +   I  +EG+ + ++G    + ++ P
Sbjct: 263 VKSIIQ---NDDLRKPKYKNSI--SY-------VAKTIYAKEGIRAFFKGFGPTMVRSAP 310

Query: 296 TTFVSFWGYETAIH 309
               +F  +E  + 
Sbjct: 311 VNGATFLTFELVMR 324

 Score = 42.4 bits (98), Expect = 3e-04,   Method: Compositional matrix adjust.
 Identities = 27/91 (29%), Positives = 44/91 (48%), Gaps = 1/91 (1%)

Query: 14  VAAWKTLLAGAVSGLLARSITAPMDTIKIRLQLTPANGLKPFGSQVMEVARSMIKNEGIR 73
           +  WK  L GA SG +      P+D +K  +Q       K + + +  VA+++   EGIR
Sbjct: 237 IPPWKLCLFGAFSGTMLWLTVYPLDVVKSIIQNDDLRKPK-YKNSISYVAKTIYAKEGIR 295

Query: 74  SFWKGNIPGSLLYVTYGSAQFSSYSLFNRYL 104
           +F+KG  P  +       A F ++ L  R+L
Sbjct: 296 AFFKGFGPTMVRSAPVNGATFLTFELVMRFL 326

 Score = 39.7 bits (91), Expect = 0.002,   Method: Compositional matrix adjust.
 Identities = 46/217 (21%), Positives = 93/217 (42%), Gaps = 34/217 (15%)

Query: 1   MFKEEDSLRKGQNVAAWKTLLAGAVSGLLARSITAPMDTIKIRLQLTPANG--------- 51
           M  ++  L +   +   +  + G   G++   + +P++ I+IRLQ   +NG         
Sbjct: 127 MSSQDVDLSRSNTLPLSQYYVCGLTGGVVNSFLASPIEQIRIRLQTQTSNGGDREFKGPW 186

Query: 52  -----LKPFGSQVMEVARSMIK-NEGIRSFWKGNIPGSLLYVTYGSAQFSSYSLFNRYLT 105
                LK  G  +  +  +MI+   G+ +++       L+Y    + +  +  L    + 
Sbjct: 187 DCIKKLKAQGGLMRGLFPTMIRAGHGLGTYF-------LVYEALVAREIGT-GLTRNEIP 238

Query: 106 PFGLEARLHSLVVGAFAGITSSIVSYPFDVLRTRLVANNQM----HSMSITREVRDIWKL 161
           P+ L       + GAF+G    +  YP DV+++ ++ N+ +    +  SI+   + I+  
Sbjct: 239 PWKL------CLFGAFSGTMLWLTVYPLDVVKS-IIQNDDLRKPKYKNSISYVAKTIYAK 291

Query: 162 EGLPGFFKGSIASMTTITLTASIMFGTYETIRIYCDE 198
           EG+  FFKG   +M          F T+E +  +  E
Sbjct: 292 EGIRAFFKGFGPTMVRSAPVNGATFLTFELVMRFLGE 328

>Scas_558.2
          Length = 289

 Score = 60.1 bits (144), Expect = 3e-10,   Method: Compositional matrix adjust.
 Identities = 51/202 (25%), Positives = 85/202 (42%), Gaps = 17/202 (8%)

Query: 9   RKGQNVAAWKTLLAGAVSGLLARSITAPMDTIKIRLQLTPANGLKPFGSQVMEVARSMIK 68
           R   +V     ++A ++  L A  +  P + IK R Q+   N          +  R+++K
Sbjct: 92  RSPHSVDTIVHMIASSMGELAACLVRVPAEVIKQRTQVHSTN-------SSWQTFRTILK 144

Query: 69  NEG----IRSFWKGNIPGSLLYVTYGSAQFSSYSLFNR----YLTPFGLEARLHSLVVGA 120
           NE     IR+ ++G     +  + +   QF  Y    +    Y    G        + G+
Sbjct: 145 NENQEGIIRNLYRGWSTTIMREIPFTCIQFPLYEFMKKEWALYDNEVGHLKPWKGAICGS 204

Query: 121 FAGITSSIVSYPFDVLRTRLVANNQMHSMSITREVRDIWKLEGLPGFFKGSIASMTTITL 180
            AG  ++  + P D L+TRL+ N    S+ I   +R+I+K EG   FF G       I+ 
Sbjct: 205 IAGGIAAATTTPLDFLKTRLMLNKD--SIPIKSLIRNIYKEEGFKIFFSGIYPRTMWISA 262

Query: 181 TASIMFGTYETIRIYCDENEKT 202
             +I  G YET+       E+T
Sbjct: 263 GGAIFLGVYETMHFMLQSLEET 284

 Score = 54.7 bits (130), Expect = 2e-08,   Method: Compositional matrix adjust.
 Identities = 50/203 (24%), Positives = 93/203 (45%), Gaps = 33/203 (16%)

Query: 109 LEARLHSLVVGAFAGITSSIVSYPFDVLRTRLVANNQMHSMSITREVRDIWKLEGLPGFF 168
           L A + SL+ GA AG ++ +V +P D L+TRL A                ++  G  G +
Sbjct: 3   LTAFVMSLLSGAAAGTSTDLVFFPIDTLKTRLQAKG------------GFFQNGGYHGIY 50

Query: 169 KGSIASMTTITLTASIMFGTYETIRI----YCDENEKTTAAHKKWELATLNHS-AGTIGG 223
           +G  +++     +AS+ F TY+++++    + +    ++       + T+ H  A ++G 
Sbjct: 51  RGLGSAVVASAPSASLFFVTYDSMKVRVRPHVERVINSSGTRSPHSVDTIVHMIASSMGE 110

Query: 224 VIAKIITFPLETIRRRMQFMNSKHLEKFSRHSSVYGSYKGYGFARIGLQILKQEG-VSSL 282
           + A ++  P E I++R Q               V+ +   +   R  L+   QEG + +L
Sbjct: 111 LAACLVRVPAEVIKQRTQ---------------VHSTNSSWQTFRTILKNENQEGIIRNL 155

Query: 283 YRGILVALSKTIPTTFVSFWGYE 305
           YRG    + + IP T + F  YE
Sbjct: 156 YRGWSTTIMREIPFTCIQFPLYE 178

 Score = 44.7 bits (104), Expect = 4e-05,   Method: Compositional matrix adjust.
 Identities = 59/242 (24%), Positives = 99/242 (40%), Gaps = 46/242 (19%)

Query: 19  TLLAGAVSGLLARSITAPMDTIKIRLQLTPANGLKPFGSQVMEVARSMIKNEGIRSFWKG 78
           +LL+GA +G     +  P+DT+K RLQ   A G                +N G    ++G
Sbjct: 9   SLLSGAAAGTSTDLVFFPIDTLKTRLQ---AKG-------------GFFQNGGYHGIYRG 52

Query: 79  -------NIP-GSLLYVTYGSAQFSSYSLFNRYL------TPFGLEARLHSLVVGAFAGI 124
                  + P  SL +VTY S +        R +      +P  ++  +H ++  +   +
Sbjct: 53  LGSAVVASAPSASLFFVTYDSMKVRVRPHVERVINSSGTRSPHSVDTIVH-MIASSMGEL 111

Query: 125 TSSIVSYPFDVLRTRLVANNQMHSMSIT-REVRDIWKLEGLPGFFKG-----SIASMTTI 178
            + +V  P +V++ R     Q+HS + + +  R I K E   G  +      S   M  I
Sbjct: 112 AACLVRVPAEVIKQR----TQVHSTNSSWQTFRTILKNENQEGIIRNLYRGWSTTIMREI 167

Query: 179 TLTASIMFGTYETIRIYCDENEKTTAAHKKWELATLNHSAGTIGGVIAKIITFPLETIRR 238
             T  I F  YE ++      +      K W+ A      G+I G IA   T PL+ ++ 
Sbjct: 168 PFTC-IQFPLYEFMKKEWALYDNEVGHLKPWKGAI----CGSIAGGIAAATTTPLDFLKT 222

Query: 239 RM 240
           R+
Sbjct: 223 RL 224

>KLLA0F17864g complement(1634241..1635164) similar to sp|P32331
           Saccharomyces cerevisiae YPR058w YMC1 mitochondrial
           carrier protein (MCF), start by similarity
          Length = 307

 Score = 60.1 bits (144), Expect = 3e-10,   Method: Compositional matrix adjust.
 Identities = 51/203 (25%), Positives = 87/203 (42%), Gaps = 20/203 (9%)

Query: 108 GLEARLHSLVVGAFAGITSSIVSYPFDVLRTRL--VANNQMHSMSITREVRDIWKLEGLP 165
           G    L  +  G   G+   +V  PFD+++ RL  +  N     +IT    D+ K EG  
Sbjct: 20  GFRKTLKDVFSGTVGGVAQVLVGQPFDIIKVRLQTMPGNATAWEAIT----DLVKYEGFM 75

Query: 166 GFFKGSIASMTTITLTASIMFGTYETIRIYCDENEKTTAAHKKWELATLNHSAGTIGGVI 225
           GF+KG++A +  +    S  FG  E ++ Y  +  ++   +         ++ G + G  
Sbjct: 76  GFYKGTMAPLVGVGACVSCQFGINEAMKRYFRDLNRSRGIYDNTLSLGQYYTCGFVSGSA 135

Query: 226 AKIITFPLETIRRRMQFMNSKHLEKFSRHSSVYGSYKGYGFARIGLQILKQEGVSSLYRG 285
             ++  P+E +R R+Q +  + L      S++  + K          +LKQ    SL RG
Sbjct: 136 NALLATPIEHVRIRLQ-LQKEALANAEYKSTLDCTEK----------LLKQ---GSLMRG 181

Query: 286 ILVALSKTIPTTFVSFWGYETAI 308
               L +T     + F  YET I
Sbjct: 182 FTATLMRTSHGFGIYFLTYETLI 204

 Score = 53.9 bits (128), Expect = 4e-08,   Method: Compositional matrix adjust.
 Identities = 59/301 (19%), Positives = 112/301 (37%), Gaps = 31/301 (10%)

Query: 18  KTLLAGAVSGLLARSITAPMDTIKIRLQLTPANGLKPFGSQVMEVARSMIKNEGIRSFWK 77
           K + +G V G+    +  P D IK+RLQ  P N      +   E    ++K EG   F+K
Sbjct: 26  KDVFSGTVGGVAQVLVGQPFDIIKVRLQTMPGN------ATAWEAITDLVKYEGFMGFYK 79

Query: 78  GNIPGSLLYVTYGSAQFSSYSLFNRYLTPF----GLEARLHSL----VVGAFAGITSSIV 129
           G +   +      S QF       RY        G+     SL      G  +G  ++++
Sbjct: 80  GTMAPLVGVGACVSCQFGINEAMKRYFRDLNRSRGIYDNTLSLGQYYTCGFVSGSANALL 139

Query: 130 SYPFDVLRTRLVANNQMHSMSITREVRDI-WKLEGLPGFFKGSIASMTTITLTASIMFGT 188
           + P + +R RL    +  + +  +   D   KL       +G  A++   +    I F T
Sbjct: 140 ATPIEHVRIRLQLQKEALANAEYKSTLDCTEKLLKQGSLMRGFTATLMRTSHGFGIYFLT 199

Query: 189 YETIRIYCDENEKTTAAHKKWELATLNHSAGTIGGVIAKIITFPLETIRRRMQFMNSKHL 248
           YET+      +         W+        G + G     +T+P + ++  MQ       
Sbjct: 200 YETLIASQLAHGFRREDISAWKACMF----GALSGAFFWAMTYPFDVVKSVMQ------- 248

Query: 249 EKFSRHSSVYGSYKGYGFARIGLQILKQEGVSSLYRGILVALSKTIPTTFVSFWGYETAI 308
                   +     G    ++   I ++ G+ +  +G +  + +++P    +F  +E  +
Sbjct: 249 -----ADKLVNPAYGTNVVQVAKNIYRERGLRAFTKGFMPTMLRSLPVNGATFAAFEVTM 303

Query: 309 H 309
            
Sbjct: 304 Q 304

 Score = 53.5 bits (127), Expect = 6e-08,   Method: Compositional matrix adjust.
 Identities = 27/92 (29%), Positives = 54/92 (58%), Gaps = 9/92 (9%)

Query: 12  QNVAAWKTLLAGAVSGLLARSITAPMDTIKIRLQ----LTPANGLKPFGSQVMEVARSMI 67
           ++++AWK  + GA+SG    ++T P D +K  +Q    + PA     +G+ V++VA+++ 
Sbjct: 215 EDISAWKACMFGALSGAFFWAMTYPFDVVKSVMQADKLVNPA-----YGTNVVQVAKNIY 269

Query: 68  KNEGIRSFWKGNIPGSLLYVTYGSAQFSSYSL 99
           +  G+R+F KG +P  L  +    A F+++ +
Sbjct: 270 RERGLRAFTKGFMPTMLRSLPVNGATFAAFEV 301

>YPL134C (ODC1) [5311] chr16 complement(298570..299502)
           2-Oxodicarboxylate transporter, has specificity for
           2-oxoadipate and 2-oxoglutarate, member of the
           mitochondrial carrier (MCF) family of membrane
           transporters [933 bp, 310 aa]
          Length = 310

 Score = 60.1 bits (144), Expect = 4e-10,   Method: Compositional matrix adjust.
 Identities = 67/289 (23%), Positives = 117/289 (40%), Gaps = 35/289 (12%)

Query: 22  AGAVSGLLARSITAPMDTIKIRLQLTPANGLKPFG----------SQVMEVARSMIKNEG 71
           AGA++G+    +  P+D +K R+QL       P            + VM+    ++K EG
Sbjct: 17  AGAIAGVSELLVMYPLDVVKTRMQLQVTTKGHPAVVAAKAAVDHYTGVMDCLTKIVKKEG 76

Query: 72  IRSFWKGNIPGSLLYVTYGSAQFSSYSLFNRYL-----TPFGLEARLHSLVVGAFAGITS 126
               +KG     L+     + +FS    F  +      TP G   +  ++  GA AG   
Sbjct: 77  FSHLYKGITSPILMEAPKRAIKFSGNDTFQTFYKKIFPTPNGEMTQKIAIYSGASAGAVE 136

Query: 127 SIVSYPFDVLRTRLVANNQMHSMSITREVRDIWKLEGLPGFFKGSIASMTTITLTASIMF 186
           + V  PF++++ RL   N      I      + K  G+   F G  A++    L  +  F
Sbjct: 137 AFVVAPFELVKIRLQDVNSQFKTPIEVVKNSVVK-GGVLSLFNGLEATIWRHVLWNAGYF 195

Query: 187 GTYETIRIYCDENEKTTAAHKKWELATLNHSAGTIGGVIAKIITFPLETIRRRMQFMNSK 246
           G    IR      +   AA    E    +  AG IGG +  ++  P + ++ R+Q  +S 
Sbjct: 196 GIIFQIR------KLLPAAKTSTEKTRNDLIAGAIGGTVGCLLNTPFDVVKSRIQ-RSSG 248

Query: 247 HLEKFSRHSSVYGSYKGYGFARIGLQILKQEGVSSLYRGILVALSKTIP 295
            L K++           +    + L + ++EG  +LY+G    + +  P
Sbjct: 249 PLRKYN-----------WSLPSV-LLVYREEGFKALYKGFAPKVMRLAP 285

 Score = 42.0 bits (97), Expect = 3e-04,   Method: Compositional matrix adjust.
 Identities = 37/163 (22%), Positives = 66/163 (40%), Gaps = 23/163 (14%)

Query: 98  SLFNRYLTPFGLEARLHSLVVGAFAGITSSIVSYPFDVLRTRL--------------VAN 143
           S+ NR L PF     ++    GA AG++  +V YP DV++TR+                 
Sbjct: 3   SIDNRPL-PF-----IYQFTAGAIAGVSELLVMYPLDVVKTRMQLQVTTKGHPAVVAAKA 56

Query: 144 NQMHSMSITREVRDIWKLEGLPGFFKGSIASMTTITLTASIMFGTYETIRIYCDENEKTT 203
              H   +   +  I K EG    +KG  + +       +I F   +T + +  +   T 
Sbjct: 57  AVDHYTGVMDCLTKIVKKEGFSHLYKGITSPILMEAPKRAIKFSGNDTFQTFYKKIFPTP 116

Query: 204 AAHKKWELATLNHSAGTIGGVIAKIITFPLETIRRRMQFMNSK 246
                 ++A     +G   G +   +  P E ++ R+Q +NS+
Sbjct: 117 NGEMTQKIAIY---SGASAGAVEAFVVAPFELVKIRLQDVNSQ 156

 Score = 40.4 bits (93), Expect = 0.001,   Method: Compositional matrix adjust.
 Identities = 38/158 (24%), Positives = 75/158 (47%), Gaps = 15/158 (9%)

Query: 20  LLAGAVSGLLARSITAPMDTIKIRLQLTPANGLKPFGSQVMEVARSMIKNEGIRSFWKGN 79
           + +GA +G +   + AP + +KIRLQ   +    P     +EV ++ +   G+ S + G 
Sbjct: 126 IYSGASAGAVEAFVVAPFELVKIRLQDVNSQFKTP-----IEVVKNSVVKGGVLSLFNGL 180

Query: 80  IPGSLLYVTYGSAQFSSYSLFN-RYLTPFG---LEARLHSLVVGAFAGITSSIVSYPFDV 135
                 +V + +  F    +F  R L P      E   + L+ GA  G    +++ PFDV
Sbjct: 181 EATIWRHVLWNAGYFGI--IFQIRKLLPAAKTSTEKTRNDLIAGAIGGTVGCLLNTPFDV 238

Query: 136 LRTRLVANN---QMHSMSITREVRDIWKLEGLPGFFKG 170
           +++R+  ++   + ++ S+   V  +++ EG    +KG
Sbjct: 239 VKSRIQRSSGPLRKYNWSLP-SVLLVYREEGFKALYKG 275

 Score = 38.9 bits (89), Expect = 0.004,   Method: Compositional matrix adjust.
 Identities = 26/91 (28%), Positives = 43/91 (47%), Gaps = 3/91 (3%)

Query: 217 SAGTIGGVIAKIITFPLETIRRRMQF-MNSKHLEKFSRHSSVYGSYKGYGFARIGLQILK 275
           +AG I GV   ++ +PL+ ++ RMQ  + +K         +    Y G        +I+K
Sbjct: 16  TAGAIAGVSELLVMYPLDVVKTRMQLQVTTKGHPAVVAAKAAVDHYTG--VMDCLTKIVK 73

Query: 276 QEGVSSLYRGILVALSKTIPTTFVSFWGYET 306
           +EG S LY+GI   +    P   + F G +T
Sbjct: 74  KEGFSHLYKGITSPILMEAPKRAIKFSGNDT 104

>KLLA0E02750g 260854..261768 similar to ca|CA6127|IPF149 Candida
           albicans peroxisomal membrane protein (by homology),
           start by similarity
          Length = 304

 Score = 59.7 bits (143), Expect = 4e-10,   Method: Compositional matrix adjust.
 Identities = 70/284 (24%), Positives = 116/284 (40%), Gaps = 39/284 (13%)

Query: 21  LAGAVSGLLARSITAPMDTIKIRLQLTPANGLKPFGSQVMEVARSMIKNEGIRSFWKGNI 80
           +AG++ G  + ++T P+ TI   LQ T  N  +P     +E  + +    GI  ++ G  
Sbjct: 16  IAGSLGGAASIAVTYPLVTITTNLQ-TKENEARP----KLETIKEIYNKNGIIGYFLG-- 68

Query: 81  PGSLLYVTYGSA--QFSSYSLFN------RYLTPFGLEARLHSLVVGAFAGITSSIVSYP 132
              L    YG A   F  Y  +       R LT     +   S++    AG  +++ S P
Sbjct: 69  ---LESAVYGMATTNFVYYYFYEWCAKTARTLTTKQYLSTWESILASTIAGSMTAVASNP 125

Query: 133 FDVLRTRLVANNQMHSMSITREVRDIWKLEGLPGFFKGSIASMTTITLTASIMFGTYETI 192
             V  TR+      HS    R V DI K +G      G   ++  ++    I +  YE +
Sbjct: 126 IWVANTRMTVAKSNHST--LRTVIDIVKTDGPLTLLNGLKPALVLVS-NPIIQYTVYEQL 182

Query: 193 RIYCDENEKTTAAHKKWELATLNHSAGTIGGVIAKIITFPLETIRRRMQFMNSKHLEKFS 252
           +      ++       W         G IG + A   T+P  T++ RM  M +    + S
Sbjct: 183 KNLVLRLQRKKVLSPSWAFL-----LGAIGKLAATGTTYPYITLKTRMHLMQNDPKHQKS 237

Query: 253 RHSSVYGSYKGYGFARIGLQILKQEGVSSLYRGILVALSKTIPT 296
             S +             ++I+K++GVS LY G+ V L ++I T
Sbjct: 238 MWSLI-------------VEIVKKDGVSGLYNGVAVKLVQSIMT 268

>KLLA0E18810g 1663220..1664353 some similarities with sp|P38152
           Saccharomyces cerevisiae YBR291c CTP1 citrate transport
           protein, mitochondrial (MCF), hypothetical start
          Length = 377

 Score = 59.7 bits (143), Expect = 7e-10,   Method: Compositional matrix adjust.
 Identities = 66/306 (21%), Positives = 125/306 (40%), Gaps = 31/306 (10%)

Query: 14  VAAWKTLLAGAVSGLLARSITAPMDTIKIRLQLTPANGLKPFGSQVMEVARSMIKNEGIR 73
           V  + + LAG+++G +  SIT P +  K RLQL   +         + +  +  KN GI 
Sbjct: 88  VDPFHSFLAGSIAGAIEASITYPFEFAKTRLQLV--DKASKASRNPLVLIYNTGKNYGIS 145

Query: 74  SFWKGNIPGSLLYVTYGSA-QFSSYSLFNRYL--TPFGLEARLHSLVVGAFAGITSSIVS 130
           S + G  P  ++  T  +  +F  +      L     G  +    +V G  AG+  S+V+
Sbjct: 146 SIYVG-CPAFIVGNTAKAGIRFLGFDTIKNLLRDKKTGELSGFRGVVAGLGAGLLESVVA 204

Query: 131 Y-PFDVLRTRLVANNQM-------HSMSITREVRDIWKLEGLPGFFKGSIASMTTITLTA 182
             PF+ ++T L+ + Q        +   +      +   +G  G ++G +          
Sbjct: 205 VTPFEAIKTALIDDKQAAVPKYQNNGKGMVSNYAKLLSDQGFSGLYRGVLPVSMRQAANQ 264

Query: 183 SIMFGTYETIRIYCDENEKTTAAHKKWELATLNHSAGTIGGVIAKIITFPLETIRRRMQF 242
           ++  G Y  I+      + T     K   + L    G   G++    T P++T++ RMQ 
Sbjct: 265 AVRLGCYNKIKTLV--QDYTNVPKDKPLSSGLTFIVGAFSGIVTVYTTMPIDTVKTRMQS 322

Query: 243 MNSKHLEKFSRHSSVYGSYKGYGFARIGLQILKQEGVSSLYRGILVALSKTIPTTFVSFW 302
           +N+       ++SS    +           I K+EG+ + ++G    L + I +  + F 
Sbjct: 323 LNA------GQYSSTINCFA---------TIFKEEGLKTFWKGATPRLGRLILSGGIVFT 367

Query: 303 GYETAI 308
            YE  +
Sbjct: 368 IYEKVL 373

 Score = 53.5 bits (127), Expect = 6e-08,   Method: Compositional matrix adjust.
 Identities = 46/195 (23%), Positives = 88/195 (45%), Gaps = 12/195 (6%)

Query: 9   RKGQNVAAWKTLLAGAVSGLLARSITA-PMDTIKIRLQLTPANGLKPF---GSQVMEVAR 64
           +K   ++ ++ ++AG  +GLL   +   P + IK  L       +  +   G  ++    
Sbjct: 179 KKTGELSGFRGVVAGLGAGLLESVVAVTPFEAIKTALIDDKQAAVPKYQNNGKGMVSNYA 238

Query: 65  SMIKNEGIRSFWKGNIPGSLLYVTYGSAQFSSY----SLFNRYLTPFGLEARLHS---LV 117
            ++ ++G    ++G +P S+      + +   Y    +L   Y T    +  L S    +
Sbjct: 239 KLLSDQGFSGLYRGVLPVSMRQAANQAVRLGCYNKIKTLVQDY-TNVPKDKPLSSGLTFI 297

Query: 118 VGAFAGITSSIVSYPFDVLRTRLVANNQMHSMSITREVRDIWKLEGLPGFFKGSIASMTT 177
           VGAF+GI +   + P D ++TR+ + N     S       I+K EGL  F+KG+   +  
Sbjct: 298 VGAFSGIVTVYTTMPIDTVKTRMQSLNAGQYSSTINCFATIFKEEGLKTFWKGATPRLGR 357

Query: 178 ITLTASIMFGTYETI 192
           + L+  I+F  YE +
Sbjct: 358 LILSGGIVFTIYEKV 372

 Score = 45.4 bits (106), Expect = 2e-05,   Method: Compositional matrix adjust.
 Identities = 23/81 (28%), Positives = 44/81 (54%), Gaps = 4/81 (4%)

Query: 1   MFKEEDSLRKGQNVAAWKTLLAGAVSGLLARSITAPMDTIKIRLQLTPANGLKPFGSQVM 60
           + ++  ++ K + +++  T + GA SG++    T P+DT+K R+Q   A       S  +
Sbjct: 277 LVQDYTNVPKDKPLSSGLTFIVGAFSGIVTVYTTMPIDTVKTRMQSLNAGQY----SSTI 332

Query: 61  EVARSMIKNEGIRSFWKGNIP 81
               ++ K EG+++FWKG  P
Sbjct: 333 NCFATIFKEEGLKTFWKGATP 353

>KLLA0B12826g 1121106..1122065 similar to sp|P32332 Saccharomyces
           cerevisiae YKL120w PMT, start by similarity
          Length = 319

 Score = 59.3 bits (142), Expect = 7e-10,   Method: Compositional matrix adjust.
 Identities = 62/319 (19%), Positives = 132/319 (41%), Gaps = 42/319 (13%)

Query: 3   KEEDSLRK--GQNVAAWKTLLAGAVSGLLARSITAPMDTIKIRLQLT---PANGLKPFGS 57
           +EE   +K     V+ + + +AG ++  +A ++T P D +K R+QL     AN  K + +
Sbjct: 5   QEEKHNQKTAAHKVSKFGSFVAGGLAACIAVTVTNPFDCVKTRMQLQGELHANAAKVYTN 64

Query: 58  QVMEVARSMIKNEGIRSFWKGNIPGSLLYVTYGSAQFSSYS----LFNRYLTPFGLEARL 113
            +      + KNEGI    KG     L  +    ++   Y     + N    P     ++
Sbjct: 65  PIQAFG-VIFKNEGIAGLQKGLASAYLYQIALNGSRLGFYEPIRGILNNVFYPNVESHKV 123

Query: 114 H----SLVVGAFAGITSSIVSYPFDVLRTRLVA-------NNQMHSMSITREVRDIWKLE 162
                ++  GA +G+  + +  P  +++TR+ +         Q H  S    +  I++ E
Sbjct: 124 QHIGINVAAGATSGVVGAFIGSPLFLVKTRMQSYSNAIHIGQQTHYTSAFNGLATIFRSE 183

Query: 163 GLPGFFKGSIASMTTITLTASIMFGTYETIRIYCDENEKTTAAHKKWELATLNHSAGTIG 222
           G+ G F+G  A+M    + +++    Y   + +  +++          L++      TI 
Sbjct: 184 GIKGLFRGVDAAMLRTGIGSAVQLPIYNICKNFLLKHDLMNDGTGLHLLSS------TIA 237

Query: 223 GVIAKIITFPLETIRRRMQFMNSKHLEKFSRHSSVYGSYKGYGFARIGLQILKQEGVSSL 282
           G    +   P + +  R+          +++  ++Y      G     ++ ++ EG+S+L
Sbjct: 238 GFGVGVAMNPWDVVLTRV----------YNQKGNLYS-----GPIDCFIKTVRNEGLSAL 282

Query: 283 YRGILVALSKTIPTTFVSF 301
           Y+G    + +  P T +  
Sbjct: 283 YKGFGAQILRIGPHTVLCL 301

>Scas_715.45
          Length = 305

 Score = 58.9 bits (141), Expect = 8e-10,   Method: Compositional matrix adjust.
 Identities = 47/185 (25%), Positives = 86/185 (46%), Gaps = 14/185 (7%)

Query: 20  LLAGAVSGLLARSITAPMDTIKIRLQLTPANGLKPFGSQVMEVARSMIKNEGIRSFWKGN 79
           LL+ A +   A  +  P + IK++ Q T    + P+ + V+E  + M   EG+  F+KG 
Sbjct: 119 LLSSATAEFFADIMLCPFEAIKVKQQTT----MPPWCNNVIEGWKKMYAKEGLNGFYKGI 174

Query: 80  IPGSLLYVTYGSAQFSSY-----SLFNRYLTPFGLEARLH----SLVVGAFAGITSSIVS 130
            P     + Y   +F+S+     +++ R  T     + L     S V G  AGI  +IVS
Sbjct: 175 TPLWCRQIPYTMCKFTSFERIVEAIYARLPTKKSEMSALQQISVSFVGGYMAGILCAIVS 234

Query: 131 YPFDVLRTRLVANNQMHSMSITREVRDIWKLEGLPGFFKGSIASMTTITLTASIMFGTYE 190
           +P DV+ ++ + N +  + S+   ++ I+   G  G + G    +  I    S  +  Y+
Sbjct: 235 HPADVMVSK-INNERKVNESMNVALKRIYSRIGFVGLWNGLPVRILMIGTLTSFQWLIYD 293

Query: 191 TIRIY 195
           + + Y
Sbjct: 294 SFKAY 298

 Score = 43.9 bits (102), Expect = 9e-05,   Method: Compositional matrix adjust.
 Identities = 49/235 (20%), Positives = 93/235 (39%), Gaps = 24/235 (10%)

Query: 21  LAGAVSGLLARSITAPMDTIKIRLQLTPANGLKPFGSQVMEVARSMIKNEGIRSFWKGNI 80
           L G V+     S   P+D IK RLQ+ P    +   S ++++    +K EG+   + G  
Sbjct: 21  LGGIVACGPTHSSVTPLDLIKCRLQVDPTL-YRSNTSGIIQI----LKKEGLGKLFTGVG 75

Query: 81  PGSLLYVTYGSAQFSSYSLFNRYL---------TPFGLEARLHSLVVGAFAGITSSIVSY 131
              + Y   G+ ++  Y LF R           T +     ++ L+  A A   + I+  
Sbjct: 76  ATCIGYSLQGAGKYGGYELFKRLYSTHLVKDEATAYKYRTSIY-LLSSATAEFFADIMLC 134

Query: 132 PFDVLRTRLVANNQMHSMSITREVRDIWKLEGLPGFFKGSIASMTTITLTASIMFGTYET 191
           PF+ ++ +          ++    + ++  EGL GF+KG               F ++E 
Sbjct: 135 PFEAIKVKQQTTMPPWCNNVIEGWKKMYAKEGLNGFYKGITPLWCRQIPYTMCKFTSFER 194

Query: 192 IRIYCDENEKTTAAHKKWELATLNH-----SAGTIGGVIAKIITFPLETIRRRMQ 241
           I     E        KK E++ L         G + G++  I++ P + +  ++ 
Sbjct: 195 IV----EAIYARLPTKKSEMSALQQISVSFVGGYMAGILCAIVSHPADVMVSKIN 245

 Score = 43.1 bits (100), Expect = 1e-04,   Method: Compositional matrix adjust.
 Identities = 48/189 (25%), Positives = 77/189 (40%), Gaps = 19/189 (10%)

Query: 122 AGITSSIVSYPFDVLRTRLVANNQMHSMSITREVRDIWKLEGLPGFFKGSIASMTTITLT 181
            G T S V+ P D+++ RL  +  ++  S T  +  I K EGL   F G  A+    +L 
Sbjct: 27  CGPTHSSVT-PLDLIKCRLQVDPTLYR-SNTSGIIQILKKEGLGKLFTGVGATCIGYSLQ 84

Query: 182 ASIMFGTYETI-RIYCDENEKTTAAHKKWELATLNHSAGTIGGVIAKIITFPLETIRRRM 240
            +  +G YE   R+Y     K  A   K+  +    S+ T     A I+  P E I+ + 
Sbjct: 85  GAGKYGGYELFKRLYSTHLVKDEATAYKYRTSIYLLSSAT-AEFFADIMLCPFEAIKVKQ 143

Query: 241 QFMNSKHLEKFSRHSSVYGSYKGYGFARIGLQILKQEGVSSLYRGILVALSKTIPTTFVS 300
           Q            ++ + G  K Y           +EG++  Y+GI     + IP T   
Sbjct: 144 QTTMPPWC-----NNVIEGWKKMYA----------KEGLNGFYKGITPLWCRQIPYTMCK 188

Query: 301 FWGYETAIH 309
           F  +E  + 
Sbjct: 189 FTSFERIVE 197

>YMR166C (YMR166C) [4121] chr13 complement(593366..594472) Member of
           the mitochondrial carrier (MCF) protein family of
           membrane transporters [1107 bp, 368 aa]
          Length = 368

 Score = 58.9 bits (141), Expect = 1e-09,   Method: Compositional matrix adjust.
 Identities = 52/199 (26%), Positives = 90/199 (45%), Gaps = 25/199 (12%)

Query: 114 HSLVVGAFAGITSSIVSYPFDVLRTRLV-ANNQMHSMSITREVRDIWKLEGLP-GFFKGS 171
           H +V G   G       +  D ++TR   A N     ++    R IW  EG+  G + G 
Sbjct: 55  HCVVSGGIGGKIGDSAMHSLDTVKTRQQGAPNVKKYRNMISAYRTIWLEEGVRRGLYGGY 114

Query: 172 IASMTTITLTASIMFGTYETIRIYCDENEKTTAAHKKWEL-ATLNH-SAGTIGGVIAKII 229
           +A+M     +A+I FGTYE  +    E+         W++  T+ H SAG +G  I+  +
Sbjct: 115 MAAMLGSFPSAAIFFGTYEYTKRTMIED---------WQINDTITHLSAGFLGDFISSFV 165

Query: 230 TFPLETIRRRMQFM---NSKHLEKFSRHSSVYGSYKGYGFARIGLQILKQEGVSSLYRGI 286
             P E ++ R+Q     N+   +    +S++  + K          ++K+EG  SL+ G 
Sbjct: 166 YVPSEVLKTRLQLQGRFNNPFFQSGYNYSNLRNAIK---------TVIKEEGFRSLFFGY 216

Query: 287 LVALSKTIPTTFVSFWGYE 305
              L++ +P + + F  YE
Sbjct: 217 KATLARDLPFSALQFAFYE 235

 Score = 54.7 bits (130), Expect = 3e-08,   Method: Compositional matrix adjust.
 Identities = 59/258 (22%), Positives = 112/258 (43%), Gaps = 25/258 (9%)

Query: 3   KEEDSLRKGQNVAA------WKTLLAGAVSGLLARSITAPMDTIKIRLQLTPANGLKPFG 56
           +++D L K +  +       W  +++G + G +  S    +DT+K R Q  P   +K + 
Sbjct: 34  RKDDKLHKKRGDSDEDLSPIWHCVVSGGIGGKIGDSAMHSLDTVKTRQQGAP--NVKKY- 90

Query: 57  SQVMEVARSMIKNEGIRSFWKGNIPGSLLYVTYGSAQ--FSSYSLFNR-YLTPFGLEARL 113
             ++   R++   EG+R    G    ++L  ++ SA   F +Y    R  +  + +   +
Sbjct: 91  RNMISAYRTIWLEEGVRRGLYGGYMAAML-GSFPSAAIFFGTYEYTKRTMIEDWQINDTI 149

Query: 114 HSLVVGAFAGITSSIVSYPFDVLRTRLVANNQMHS---------MSITREVRDIWKLEGL 164
             L  G      SS V  P +VL+TRL    + ++          ++   ++ + K EG 
Sbjct: 150 THLSAGFLGDFISSFVYVPSEVLKTRLQLQGRFNNPFFQSGYNYSNLRNAIKTVIKEEGF 209

Query: 165 PGFFKGSIASMTTITLTASIMFGTYETIRIYCDENEKTTAAHKKWELATLNHS-AGTIGG 223
              F G  A++      +++ F  YE  R    + E+     +  EL+  N    G   G
Sbjct: 210 RSLFFGYKATLARDLPFSALQFAFYEKFRQLAFKIEQKDG--RDGELSIPNEILTGACAG 267

Query: 224 VIAKIITFPLETIRRRMQ 241
            +A IIT P++ ++ R+Q
Sbjct: 268 GLAGIITTPMDVVKTRVQ 285

 Score = 48.1 bits (113), Expect = 4e-06,   Method: Compositional matrix adjust.
 Identities = 52/211 (24%), Positives = 94/211 (44%), Gaps = 40/211 (18%)

Query: 20  LLAGAVSGLLARSITAPMDTIKIRLQLTPANGLKPF------GSQVMEVARSMIKNEGIR 73
           L AG +   ++  +  P + +K RLQL       PF       S +    +++IK EG R
Sbjct: 152 LSAGFLGDFISSFVYVPSEVLKTRLQLQ-GRFNNPFFQSGYNYSNLRNAIKTVIKEEGFR 210

Query: 74  SFWKGNIPGSLLYVTYGSAQFSSYSLFNRYLTPFGLEAR---------LHSLVVGAFAGI 124
           S + G        + + + QF+ Y  F +    F +E +          + ++ GA AG 
Sbjct: 211 SLFFGYKATLARDLPFSALQFAFYEKFRQLA--FKIEQKDGRDGELSIPNEILTGACAGG 268

Query: 125 TSSIVSYPFDVLRTRLVA------NNQMHSM---------------SITREVRDIWKLEG 163
            + I++ P DV++TR+        +N+ +S+               SI+  +R +++ EG
Sbjct: 269 LAGIITTPMDVVKTRVQTQQPPSQSNKSYSVTHPHVTNGRPAALSNSISLSLRTVYQSEG 328

Query: 164 LPGFFKGSIASMTTITLTASIMFGTYE-TIR 193
           + GFF G        ++ +SIM   Y+ T+R
Sbjct: 329 VLGFFSGVGPRFVWTSVQSSIMLLLYQMTLR 359

 Score = 33.1 bits (74), Expect = 0.27,   Method: Compositional matrix adjust.
 Identities = 17/44 (38%), Positives = 24/44 (54%)

Query: 2   FKEEDSLRKGQNVAAWKTLLAGAVSGLLARSITAPMDTIKIRLQ 45
           FK E    +   ++    +L GA +G LA  IT PMD +K R+Q
Sbjct: 242 FKIEQKDGRDGELSIPNEILTGACAGGLAGIITTPMDVVKTRVQ 285

>KLLA0D04290g 366536..367102 similar to sgd|S0006215 Saccharomyces
           cerevisiae YPR011c, hypothetical start
          Length = 188

 Score = 57.0 bits (136), Expect = 1e-09,   Method: Compositional matrix adjust.
 Identities = 38/152 (25%), Positives = 70/152 (46%), Gaps = 8/152 (5%)

Query: 19  TLLAGAVSGLLARSITAPMDTIKIRLQLTPANGLKPFGSQVMEVARSMIKNEGIRSFWKG 78
             +AG V+G ++R++ +P + +KI LQ+  +     +   ++     + K EG+   ++G
Sbjct: 14  AFIAGGVAGAVSRTVVSPFERVKILLQVQSST--SAYNHGIINAVGQVYKEEGVAGLFRG 71

Query: 79  NIPGSLLYVTYGSAQFSSYSLFNRYL----TPFGLEARLH--SLVVGAFAGITSSIVSYP 132
           N    +    Y + QF  Y    +++       G E  L+   L  GA  G  S + +YP
Sbjct: 72  NGLNCVRIFPYSAVQFVVYEWCKKHIFHVDGTVGKEQLLNWQRLSAGALCGGMSVLATYP 131

Query: 133 FDVLRTRLVANNQMHSMSITREVRDIWKLEGL 164
            D++RTRL       +     + +DI K  G+
Sbjct: 132 LDLVRTRLSIQTANLAKLSKSKAKDIAKPPGV 163

 Score = 54.7 bits (130), Expect = 8e-09,   Method: Compositional matrix adjust.
 Identities = 44/175 (25%), Positives = 85/175 (48%), Gaps = 7/175 (4%)

Query: 115 SLVVGAFAGITSSIVSYPFDVLRT--RLVANNQMHSMSITREVRDIWKLEGLPGFFKGSI 172
           + + G  AG  S  V  PF+ ++   ++ ++   ++  I   V  ++K EG+ G F+G+ 
Sbjct: 14  AFIAGGVAGAVSRTVVSPFERVKILLQVQSSTSAYNHGIINAVGQVYKEEGVAGLFRGNG 73

Query: 173 ASMTTITLTASIMFGTYETIRIYCDENEKTTAAHKKWELATLNHSAGTIGGVIAKIITFP 232
            +   I   +++ F  YE  + +    + T    +      L  SAG + G ++ + T+P
Sbjct: 74  LNCVRIFPYSAVQFVVYEWCKKHIFHVDGTVGKEQLLNWQRL--SAGALCGGMSVLATYP 131

Query: 233 LETIRRRMQFMNSKHLEKFSRHSSVYGSYKGYGFARIGLQILKQE-GVSSLYRGI 286
           L+ +R R+  + + +L K S+ S      K  G   + ++  K+E G+  LYRGI
Sbjct: 132 LDLVRTRLS-IQTANLAKLSK-SKAKDIAKPPGVWELLVKTFKEEGGIRGLYRGI 184

 Score = 35.4 bits (80), Expect = 0.027,   Method: Compositional matrix adjust.
 Identities = 24/77 (31%), Positives = 38/77 (49%), Gaps = 10/77 (12%)

Query: 17  WKTLLAGAVSGLLARSITAPMDTIKIRLQLTPANGLKPFGSQVMEVAR---------SMI 67
           W+ L AGA+ G ++   T P+D ++ RL +  AN  K   S+  ++A+            
Sbjct: 112 WQRLSAGALCGGMSVLATYPLDLVRTRLSIQTANLAKLSKSKAKDIAKPPGVWELLVKTF 171

Query: 68  KNE-GIRSFWKGNIPGS 83
           K E GIR  ++G  P S
Sbjct: 172 KEEGGIRGLYRGIYPTS 188

 Score = 34.7 bits (78), Expect = 0.047,   Method: Compositional matrix adjust.
 Identities = 23/88 (26%), Positives = 41/88 (46%), Gaps = 13/88 (14%)

Query: 218 AGTIGGVIAKIITFPLETIRRRMQFMNSKHLEKFSRHSSVYGSYKGYGFARIGLQILKQE 277
           AG + G +++ +  P E ++  +Q  +S         +S Y     +G      Q+ K+E
Sbjct: 17  AGGVAGAVSRTVVSPFERVKILLQVQSS---------TSAYN----HGIINAVGQVYKEE 63

Query: 278 GVSSLYRGILVALSKTIPTTFVSFWGYE 305
           GV+ L+RG  +   +  P + V F  YE
Sbjct: 64  GVAGLFRGNGLNCVRIFPYSAVQFVVYE 91

>YPR058W (YMC1) [5488] chr16 (673746..674669) Member of the
           mitochondrial carrier (MCF) family of membrane
           transporters [924 bp, 307 aa]
          Length = 307

 Score = 57.4 bits (137), Expect = 3e-09,   Method: Compositional matrix adjust.
 Identities = 73/314 (23%), Positives = 118/314 (37%), Gaps = 48/314 (15%)

Query: 12  QNVAAWKTLLAGAVSGLLARSITAPMDTIKIRLQL--TPANGLKPFGSQVMEVARSMIKN 69
            N    K LLAG   G+    +  P DT K+RLQ   TP        +  MEV R ++ N
Sbjct: 21  DNARVVKDLLAGTAGGIAQVLVGQPFDTTKVRLQTSSTP--------TTAMEVVRKLLAN 72

Query: 70  EGIRSFWKGNIPGSLLYVTYGSAQFSSYSLFNRYLTPFGLEARLHSLV-------VGAFA 122
           EG R F+KG +   +      S QF       R+       A + S +        G   
Sbjct: 73  EGPRGFYKGTLTPLIGVGACVSLQFGVNEAMKRFF--HHRNADMSSTLSLPQYYACGVTG 130

Query: 123 GITSSIVSYPFDVLRTRLVANNQMHSMSITR-----EVRDIWKLEGLPGFFKGSIASMTT 177
           GI +S ++ P + +R RL    Q  + S T       +  I KL       +G   ++  
Sbjct: 131 GIVNSFLASPIEHVRIRL----QTQTGSGTNAEFKGPLECIKKLRHNKALLRGLTPTILR 186

Query: 178 ITLTASIMFGTYETIRIYCDENEKTTAAHKK---WELATLNHSAGTIGGVIAKIITFPLE 234
                   F  YE + I    N++     K    W+L       G + G    ++ +PL+
Sbjct: 187 EGHGCGTYFLVYEAL-IANQMNKRRGLERKDIPAWKLCIF----GALSGTALWLMVYPLD 241

Query: 235 TIRRRMQFMNSKHLEKFSRHSSVYGSYKGYGFARIGLQILKQEGVSSLYRGILVALSKTI 294
            I+  MQ  N +   KF           G   + +   +    G+ + ++G    + +  
Sbjct: 242 VIKSVMQTDNLQK-PKF-----------GNSISSVAKTLYANGGIGAFFKGFGPTMLRAA 289

Query: 295 PTTFVSFWGYETAI 308
           P    +F  +E A+
Sbjct: 290 PANGATFATFELAM 303

 Score = 49.7 bits (117), Expect = 1e-06,   Method: Compositional matrix adjust.
 Identities = 32/94 (34%), Positives = 50/94 (53%), Gaps = 3/94 (3%)

Query: 12  QNVAAWKTLLAGAVSGLLARSITAPMDTIKIRLQLTPANGLKP-FGSQVMEVARSMIKNE 70
           +++ AWK  + GA+SG     +  P+D IK  +Q    N  KP FG+ +  VA+++  N 
Sbjct: 215 KDIPAWKLCIFGALSGTALWLMVYPLDVIKSVMQTD--NLQKPKFGNSISSVAKTLYANG 272

Query: 71  GIRSFWKGNIPGSLLYVTYGSAQFSSYSLFNRYL 104
           GI +F+KG  P  L       A F+++ L  R L
Sbjct: 273 GIGAFFKGFGPTMLRAAPANGATFATFELAMRLL 306

>KLLA0A09383g complement(818752..819852) similar to sp|P53320
           Saccharomyces cerevisiae YGR257c, start by similarity
          Length = 366

 Score = 57.8 bits (138), Expect = 3e-09,   Method: Compositional matrix adjust.
 Identities = 53/225 (23%), Positives = 109/225 (48%), Gaps = 41/225 (18%)

Query: 1   MFKEEDSLRKGQNVAAWKTLLAGAVSGLLARSITAPMDTIKIRLQLTPANGLKPFGSQVM 60
           MF++   +R   +  +   L  GA + ++A +  AP++ IK RLQ  P    K   +Q+M
Sbjct: 140 MFRDHSPMR--DSYPSLNPLFCGATARMVAATTVAPLELIKTRLQSIP-RSRKDTTTQMM 196

Query: 61  -----EVARSMIKNEGIRSFWKG-------NIPGSLLYVTYGSAQFSSYSLFNRY----- 103
                +  R+ I++ G +  +KG       ++P S +Y  +GS +F   + +  +     
Sbjct: 197 FKDLLKETRNEIRSGGYKVLFKGLEITLWRDVPFSAIY--WGSYEFYKKNFWIDFSEQCL 254

Query: 104 ---LTPFGLEARLHSLVVGAFAGITSSIVSYPFDVLRTRL-----VANNQMHSMSITRE- 154
              L+P   +  ++S + G+ +G +++++++PFDV +TR+     + N Q +++   ++ 
Sbjct: 255 RWNLSP-NWDFFINSFIGGSVSGSSAALLTHPFDVGKTRMQITMDIENKQRNTLVSPKKR 313

Query: 155 ---------VRDIWKLEGLPGFFKGSIASMTTITLTASIMFGTYE 190
                    + +I + EG    + G I  +  I  + +IM  TYE
Sbjct: 314 VSARGMFKFLYNIKQTEGYGALYTGLIPRVMKIAPSCAIMISTYE 358

 Score = 57.4 bits (137), Expect = 4e-09,   Method: Compositional matrix adjust.
 Identities = 55/250 (22%), Positives = 107/250 (42%), Gaps = 16/250 (6%)

Query: 70  EGIRSFWKGNIPGSLLYVTYGSAQFSSYSLFNRYLTPFGLEARLHSLVVGAFAGITSSIV 129
           EG+ + W+G     L+ +      FS Y +F  +         L+ L  GA A + ++  
Sbjct: 111 EGLATLWRGLSITLLMAIPANVVYFSGYEMFRDHSPMRDSYPSLNPLFCGATARMVAATT 170

Query: 130 SYPFDVLRTRLVA--------NNQMHSMSITREVRDIWKLEGLPGFFKGSIASMTTITLT 181
             P ++++TRL +          QM    + +E R+  +  G    FKG   ++      
Sbjct: 171 VAPLELIKTRLQSIPRSRKDTTTQMMFKDLLKETRNEIRSGGYKVLFKGLEITLWRDVPF 230

Query: 182 ASIMFGTYETIR--IYCDENEKTTAAH--KKWELATLNHSAGTIGGVIAKIITFPLETIR 237
           ++I +G+YE  +   + D +E+    +    W+    +   G++ G  A ++T P +  +
Sbjct: 231 SAIYWGSYEFYKKNFWIDFSEQCLRWNLSPNWDFFINSFIGGSVSGSSAALLTHPFDVGK 290

Query: 238 RRMQFMNSKHLEKFSRHSSVYGSYK--GYGFARIGLQILKQEGVSSLYRGILVALSKTIP 295
            RMQ   +  +E   R++ V    +    G  +    I + EG  +LY G++  + K  P
Sbjct: 291 TRMQI--TMDIENKQRNTLVSPKKRVSARGMFKFLYNIKQTEGYGALYTGLIPRVMKIAP 348

Query: 296 TTFVSFWGYE 305
           +  +    YE
Sbjct: 349 SCAIMISTYE 358

 Score = 30.8 bits (68), Expect = 1.2,   Method: Compositional matrix adjust.
 Identities = 14/34 (41%), Positives = 22/34 (64%)

Query: 272 QILKQEGVSSLYRGILVALSKTIPTTFVSFWGYE 305
           +I + EG+++L+RG+ + L   IP   V F GYE
Sbjct: 106 KISEVEGLATLWRGLSITLLMAIPANVVYFSGYE 139

>Scas_669.6
          Length = 373

 Score = 57.8 bits (138), Expect = 3e-09,   Method: Compositional matrix adjust.
 Identities = 66/251 (26%), Positives = 103/251 (41%), Gaps = 17/251 (6%)

Query: 3   KEEDSLRKGQNVAAWKTLLAGAVSGLLARSITAPMDTIKIRLQLTPANGLKPFGSQVMEV 62
            E  SL      +    +LAG + G++  S    +DT+K R Q  P   + P    +   
Sbjct: 38  NEPSSLNGDNGSSLLHCVLAGGIGGIIGDSSMHSLDTVKTRQQGAP---MTPKYKNMTTA 94

Query: 63  ARSMIKNEGI-RSFWKGNIPGSLLYVTYGSAQFSSYSLFNRYLT-PFGLEARLHSLVVGA 120
            R++   EGI R  + G     L      +  F +Y    R +    G    +  L  G 
Sbjct: 95  YRTIFLEEGIARGLYGGYFAAMLGSFPSAAIFFGTYEWCKRKMIGDLGFNDTVSHLSAGL 154

Query: 121 FAGITSSIVSYPFDVLRTRLVANNQMHS---------MSITREVRDIWKLEGLPGFFKGS 171
                SS V  P +VL+TRL    ++++          S+   +R I   EG+   F G 
Sbjct: 155 LGDFVSSFVYVPSEVLKTRLQLQGRVNNPFFQSGYNYRSLRTAIRIIVNTEGVKALFFGY 214

Query: 172 IASMTTITLTASIMFGTYETIRIYCDENEKTTAAHKKWELATLNHS-AGTIGGVIAKIIT 230
            A++      +++ FG YE  R    + EK      K  L+  N    G I G +A IIT
Sbjct: 215 KATLARDLPFSALQFGFYEKFRQTAFKLEKKDIT--KHNLSIPNEIFTGAIAGGLAGIIT 272

Query: 231 FPLETIRRRMQ 241
            P++ I+ R+Q
Sbjct: 273 TPMDVIKTRLQ 283

 Score = 44.7 bits (104), Expect = 5e-05,   Method: Compositional matrix adjust.
 Identities = 52/214 (24%), Positives = 90/214 (42%), Gaps = 41/214 (19%)

Query: 20  LLAGAVSGLLARSITAPMDTIKIRLQLTPANGLKPFGS-----QVMEVARSMIKNEGIRS 74
           L AG +   ++  +  P + +K RLQL        F S      +    R ++  EG+++
Sbjct: 150 LSAGLLGDFVSSFVYVPSEVLKTRLQLQGRVNNPFFQSGYNYRSLRTAIRIIVNTEGVKA 209

Query: 75  FWKGNIPGSLLYVTYGSAQFSSYSLFNRYLTPFGLEAR---LHSLVV------GAFAGIT 125
            + G        + + + QF  Y  F +  T F LE +    H+L +      GA AG  
Sbjct: 210 LFFGYKATLARDLPFSALQFGFYEKFRQ--TAFKLEKKDITKHNLSIPNEIFTGAIAGGL 267

Query: 126 SSIVSYPFDVLRTRLVANNQ------------------------MHSMSITREVRDIWKL 161
           + I++ P DV++TRL                             + S SI R ++ +++ 
Sbjct: 268 AGIITTPMDVIKTRLQTQQADINPNSATTVGAISAKTNKKSRPIVLSNSIFRSLKLVYQS 327

Query: 162 EGLPGFFKGSIASMTTITLTASIMFGTYE-TIRI 194
           EG+ GFF G        ++ +SIM   Y+ T+R+
Sbjct: 328 EGVIGFFSGVGPRFVWTSVQSSIMLLLYQMTLRL 361

 Score = 43.9 bits (102), Expect = 8e-05,   Method: Compositional matrix adjust.
 Identities = 41/160 (25%), Positives = 72/160 (45%), Gaps = 20/160 (12%)

Query: 150 SITREVRDIWKLEGLP-GFFKGSIASMTTITLTASIMFGTYETIR--IYCDENEKTTAAH 206
           ++T   R I+  EG+  G + G  A+M     +A+I FGTYE  +  +  D     T +H
Sbjct: 90  NMTTAYRTIFLEEGIARGLYGGYFAAMLGSFPSAAIFFGTYEWCKRKMIGDLGFNDTVSH 149

Query: 207 KKWELATLNHSAGTIGGVIAKIITFPLETIRRRMQFMNSKHLEKFSRHSSVYGSYKGYGF 266
                     SAG +G  ++  +  P E ++ R+Q     +       +  + S   Y  
Sbjct: 150 L---------SAGLLGDFVSSFVYVPSEVLKTRLQLQGRVN-------NPFFQSGYNYRS 193

Query: 267 ARIGLQIL-KQEGVSSLYRGILVALSKTIPTTFVSFWGYE 305
            R  ++I+   EGV +L+ G    L++ +P + + F  YE
Sbjct: 194 LRTAIRIIVNTEGVKALFFGYKATLARDLPFSALQFGFYE 233

 Score = 36.6 bits (83), Expect = 0.018,   Method: Compositional matrix adjust.
 Identities = 20/49 (40%), Positives = 26/49 (53%)

Query: 2   FKEEDSLRKGQNVAAWKTLLAGAVSGLLARSITAPMDTIKIRLQLTPAN 50
           FK E       N++    +  GA++G LA  IT PMD IK RLQ   A+
Sbjct: 240 FKLEKKDITKHNLSIPNEIFTGAIAGGLAGIITTPMDVIKTRLQTQQAD 288

>Kwal_23.3529
          Length = 395

 Score = 57.8 bits (138), Expect = 3e-09,   Method: Compositional matrix adjust.
 Identities = 66/223 (29%), Positives = 99/223 (44%), Gaps = 20/223 (8%)

Query: 32  SITAPMDTIKIRLQLTPANGLKPFGSQVMEVARSMIKNEGIRSFWKGNIPGSLLYVTYGS 91
           S+   +DT+K R Q  P     P    ++   + +   EGIR    G    ++L  ++ S
Sbjct: 101 SVMHSLDTVKTRQQGAPN---APKYRNMISAYQKIFMEEGIRRGLYGGYTAAML-GSFPS 156

Query: 92  AQ--FSSYSLFNRYL-TPFGLEARLHSLVVGAFAGITSSIVSYPFDVLRTRL-----VAN 143
           A   F +Y L  R L   +G+   L  L  G    + SS+V  P +VL+TRL       N
Sbjct: 157 AAIFFGTYELTKRKLIDDWGVNETLSHLTAGLSGDLVSSVVYVPSEVLKTRLQLQGCYNN 216

Query: 144 NQMHSMSITREVRD----IWKLEGLPGFFKGSIASMTTITLTASIMFGTYETIRIYCDEN 199
              HS    R +RD    I +LEG    F G  A++      ++  F  YE  R +    
Sbjct: 217 PHFHSGYNYRNLRDAITAIVRLEGWQTLFFGYKATLCRDLPFSAFQFAFYEKFRQWAFTL 276

Query: 200 EKTTAAHKKWELATLNH-SAGTIGGVIAKIITFPLETIRRRMQ 241
           E  T +    +L+ LN    G   G +A IIT P++ I+ R+Q
Sbjct: 277 EGKTPSQ---DLSLLNELLTGAAAGGLAGIITTPMDVIKTRIQ 316

 Score = 37.7 bits (86), Expect = 0.008,   Method: Compositional matrix adjust.
 Identities = 54/214 (25%), Positives = 91/214 (42%), Gaps = 30/214 (14%)

Query: 20  LLAGAVSGLLARSITAPMDTIKIRLQLTPANGLKPFGS-----QVMEVARSMIKNEGIRS 74
           L AG    L++  +  P + +K RLQL        F S      + +   ++++ EG ++
Sbjct: 184 LTAGLSGDLVSSVVYVPSEVLKTRLQLQGCYNNPHFHSGYNYRNLRDAITAIVRLEGWQT 243

Query: 75  FWKGNIPGSLLYVTYGSAQFSSYSLFNRYLTPFGLEAR--------LHSLVVGAFAGITS 126
            + G        + + + QF+ Y  F ++   F LE +        L+ L+ GA AG  +
Sbjct: 244 LFFGYKATLCRDLPFSAFQFAFYEKFRQW--AFTLEGKTPSQDLSLLNELLTGAAAGGLA 301

Query: 127 SIVSYPFDVLRTRLVANNQMHSM---SITREVR----------DIWKLEGLPGFFKGSIA 173
            I++ P DV++TR+    QM S      TR VR           +++ EG  GFF G   
Sbjct: 302 GIITTPMDVIKTRI--QTQMPSTVASDSTRLVRIENSLIKGLTAVYRSEGTLGFFSGVGP 359

Query: 174 SMTTITLTASIMFGTYETIRIYCDENEKTTAAHK 207
                ++ +SIM   Y+      D      +A K
Sbjct: 360 RFIWTSIQSSIMLLLYQVTLKSLDRFASPNSAFK 393

>Scas_602.8
          Length = 885

 Score = 57.8 bits (138), Expect = 4e-09,   Method: Compositional matrix adjust.
 Identities = 59/225 (26%), Positives = 95/225 (42%), Gaps = 17/225 (7%)

Query: 9   RKGQNVAAWKTLLAGAVSGLLARSITAPMDTIKIRLQLTP--ANGLKPFGSQVMEVARSM 66
           +KG N+     +L+GA +G      T P++ +KIRLQ+     N + P  SQ+   A  +
Sbjct: 586 KKG-NLQLGAEVLSGATAGACQVVFTNPLEIVKIRLQVKSEYTNAMIP-KSQL--TAFQI 641

Query: 67  IKNEGIRSFWKGNIPGSLLYVTYGSAQFSSYSLFNRYLTPFGLEA-----RLHS---LVV 118
           IK   +   +KG     L  V + +  F +Y+   + +  F         RL +   L  
Sbjct: 642 IKELKLIGLYKGVGACLLRDVPFSAIYFPTYAHLKKNVFQFDPNDKDKRDRLKTWELLTA 701

Query: 119 GAFAGITSSIVSYPFDVLRTRLVAN---NQMHSMSITREVRDIWKLEGLPGFFKGSIASM 175
           GA AG+ ++ ++ PFDV++TRL       +     I   VR I K E    FFKG  A +
Sbjct: 702 GALAGVPAAFLTTPFDVIKTRLQIEPGVGETRYTGILHAVRTILKEESFRSFFKGGAARV 761

Query: 176 TTITLTASIMFGTYETIRIYCDENEKTTAAHKKWELATLNHSAGT 220
              +         YE  +   + ++       +      N S GT
Sbjct: 762 MRSSPQFGFTLAAYELFKNMFNISDDKQPTKNEKSTEDYNDSVGT 806

 Score = 57.4 bits (137), Expect = 5e-09,   Method: Compositional matrix adjust.
 Identities = 68/298 (22%), Positives = 122/298 (40%), Gaps = 41/298 (13%)

Query: 23  GAVSGLLARSITAPMDTIKIRLQLTPANGLKPFGSQVMEVARSMIKNEGIRSFWKGNIPG 82
           G+V+G +  ++  P+D IK R+Q      L  + + +  + +   K EGIR  + G  P 
Sbjct: 505 GSVAGCIGATLVYPIDFIKTRMQ--AQRSLTKYKNSIDCLVKIFGK-EGIRGLYSGLGPQ 561

Query: 83  SLLYVTYGSAQFSSYSLFNRYLTPFGLEARLHSLVV-GAFAGITSSIVSYPFDVLRTRL- 140
            +      + + +      + L       +L + V+ GA AG    + + P ++++ RL 
Sbjct: 562 LIGVAPEKAIKLTVNDFMRKSLVDKKGNLQLGAEVLSGATAGACQVVFTNPLEIVKIRLQ 621

Query: 141 ---------VANNQMHSMSITREVRDIWKLEGLPGFFKGSIASMTTITLTASIMFGTYET 191
                    +  +Q+ +  I +E++       L G +KG  A +      ++I F TY  
Sbjct: 622 VKSEYTNAMIPKSQLTAFQIIKELK-------LIGLYKGVGACLLRDVPFSAIYFPTYAH 674

Query: 192 IR---IYCDENEKTTAAH-KKWELATLNHSAGTIGGVIAKIITFPLETIRRRMQFMNSKH 247
           ++      D N+K      K WEL T    AG + GV A  +T P + I+ R+Q      
Sbjct: 675 LKKNVFQFDPNDKDKRDRLKTWELLT----AGALAGVPAAFLTTPFDVIKTRLQI----- 725

Query: 248 LEKFSRHSSVYGSYKGYGFARIGLQILKQEGVSSLYRGILVALSKTIPTTFVSFWGYE 305
                      G  +  G       ILK+E   S ++G    + ++ P    +   YE
Sbjct: 726 -------EPGVGETRYTGILHAVRTILKEESFRSFFKGGAARVMRSSPQFGFTLAAYE 776

 Score = 39.3 bits (90), Expect = 0.003,   Method: Compositional matrix adjust.
 Identities = 45/207 (21%), Positives = 85/207 (41%), Gaps = 26/207 (12%)

Query: 101 NRYLTPFGLEARLHSLVVGAFAGITSSIVSYPFDVLRTRLVANNQM--HSMSITREVRDI 158
           N Y  P  +   + +  +G+ AG   + + YP D ++TR+ A   +  +  SI   V+ I
Sbjct: 489 NYYFYP--IFDSIFNFSLGSVAGCIGATLVYPIDFIKTRMQAQRSLTKYKNSIDCLVK-I 545

Query: 159 WKLEGLPGFFKGSIASMTTITLTASIMFGTYETIRIYCDENEKTTAAHKKWELAT-LNHS 217
           +  EG+ G + G    +  +    +I     + +R         +   KK  L       
Sbjct: 546 FGKEGIRGLYSGLGPQLIGVAPEKAIKLTVNDFMR--------KSLVDKKGNLQLGAEVL 597

Query: 218 AGTIGGVIAKIITFPLETIRRRMQFMNSKHLEKFSRHSSVYGSYKGYGFARIGLQILKQE 277
           +G   G    + T PLE ++ R+Q + S++       S +              QI+K+ 
Sbjct: 598 SGATAGACQVVFTNPLEIVKIRLQ-VKSEYTNAMIPKSQL-----------TAFQIIKEL 645

Query: 278 GVSSLYRGILVALSKTIPTTFVSFWGY 304
            +  LY+G+   L + +P + + F  Y
Sbjct: 646 KLIGLYKGVGACLLRDVPFSAIYFPTY 672

>YBR291C (CTP1) [469] chr2 complement(783631..784530) Mitochondrial
           inner membrane citrate transport protein, member of the
           mitochondrial carrier family (MCF) of membrane
           transporters [900 bp, 299 aa]
          Length = 299

 Score = 57.0 bits (136), Expect = 4e-09,   Method: Compositional matrix adjust.
 Identities = 63/307 (20%), Positives = 126/307 (41%), Gaps = 31/307 (10%)

Query: 13  NVAAWKTLLAGAVSGLLARSITAPMDTIKIRLQLTPANGLKPFGSQVMEVARSMIKNEGI 72
           +V    + LAG+++G     IT P +  K RLQL   +         + +     K +GI
Sbjct: 9   DVDPLHSFLAGSLAGAAEACITYPFEFAKTRLQLI--DKASKASRNPLVLIYKTAKTQGI 66

Query: 73  RSFWKGNIPGSLLYVTYGSA-QFSSYSLFNRYL--TPFGLEARLHSLVVGAFAGITSSIV 129
            S + G  P  ++  T  +  +F  +      L  +  G  +    ++ G  AG+  S+ 
Sbjct: 67  GSIYVG-CPAFIIGNTAKAGIRFLGFDTIKDMLRDSETGELSGTRGVIAGLGAGLLESVA 125

Query: 130 SY-PFDVLRTRLVANNQM-------HSMSITREVRDIWKLEGLPGFFKGSIASMTTITLT 181
           +  PF+ ++T L+ + Q        +   + R    + + +G  G ++G +         
Sbjct: 126 AVTPFEAIKTALIDDKQSATPKYHNNGRGVVRNYSSLVRDKGFSGLYRGVLPVSMRQAAN 185

Query: 182 ASIMFGTYETIRIYCDENEKTTAAHKKWELATLNHSAGTIGGVIAKIITFPLETIRRRMQ 241
            ++  G Y  I+      + T +   K   + L    G   G++    T PL+T++ RMQ
Sbjct: 186 QAVRLGCYNKIKTLI--QDYTDSPKDKPLSSGLTFLVGAFSGIVTVYSTMPLDTVKTRMQ 243

Query: 242 FMNSKHLEKFSRHSSVYGSYKGYGFARIGLQILKQEGVSSLYRGILVALSKTIPTTFVSF 301
            ++S      +++SS    +           I K+EG+ + ++G    L + + +  + F
Sbjct: 244 SLDS------TKYSSTMNCFA---------TIFKEEGLKTFWKGATPRLGRLVLSGGIVF 288

Query: 302 WGYETAI 308
             YE  +
Sbjct: 289 TIYEKVL 295

 Score = 56.2 bits (134), Expect = 7e-09,   Method: Compositional matrix adjust.
 Identities = 47/203 (23%), Positives = 93/203 (45%), Gaps = 14/203 (6%)

Query: 5   EDSLRKGQ--NVAAWKTLLAGAVSGLLARSITA--PMDTIKIRLQLTPANGLKPF---GS 57
           +D LR  +   ++  + ++AG  +GLL  S+ A  P + IK  L     +    +   G 
Sbjct: 95  KDMLRDSETGELSGTRGVIAGLGAGLL-ESVAAVTPFEAIKTALIDDKQSATPKYHNNGR 153

Query: 58  QVMEVARSMIKNEGIRSFWKGNIPGSLLYVTYGSAQFSSYSLFNRYLTPFGLEARLHSL- 116
            V+    S+++++G    ++G +P S+      + +   Y+     +  +    +   L 
Sbjct: 154 GVVRNYSSLVRDKGFSGLYRGVLPVSMRQAANQAVRLGCYNKIKTLIQDYTDSPKDKPLS 213

Query: 117 -----VVGAFAGITSSIVSYPFDVLRTRLVANNQMHSMSITREVRDIWKLEGLPGFFKGS 171
                +VGAF+GI +   + P D ++TR+ + +     S       I+K EGL  F+KG+
Sbjct: 214 SGLTFLVGAFSGIVTVYSTMPLDTVKTRMQSLDSTKYSSTMNCFATIFKEEGLKTFWKGA 273

Query: 172 IASMTTITLTASIMFGTYETIRI 194
              +  + L+  I+F  YE + +
Sbjct: 274 TPRLGRLVLSGGIVFTIYEKVLV 296

>YER053C (PIC2) [1481] chr5 complement(258736..259638) Member of the
           mitochondrial carrier (MCF) family of membrane
           transporters, has similarity to C. elegans mitochondrial
           phosphate carrier protein [903 bp, 300 aa]
          Length = 300

 Score = 56.6 bits (135), Expect = 6e-09,   Method: Compositional matrix adjust.
 Identities = 47/187 (25%), Positives = 91/187 (48%), Gaps = 17/187 (9%)

Query: 20  LLAGAVSGLLARSITAPMDTIKIRLQLTPANGLKPFGSQVMEVARSMI-KNEGIRSFWKG 78
           L+A A +  LA  +  P + IK++ Q T    + PF + V++  + M  ++ G+++F+KG
Sbjct: 113 LMASATAEFLADIMLCPFEAIKVKQQTT----MPPFCNNVVDGWKKMYAESGGMKAFYKG 168

Query: 79  NIPGSLLYVTYGSAQFSS--------YSLFNRYLTPF-GLEARLHSLVVGAFAGITSSIV 129
            +P     + Y   +F+S        YS+  +       L+    S V G  AGI  + V
Sbjct: 169 IVPLWCRQIPYTMCKFTSFEKIVQKIYSVLPKKKEEMNALQQISVSFVGGYLAGILCAAV 228

Query: 130 SYPFDVLRTRLVANNQMH-SMSITREVRDIWKLEGLPGFFKGSIASMTTITLTASIMFGT 188
           S+P DV+ +++ +  + + SMS+    + I++  G  G + G +  +  I    S  +  
Sbjct: 229 SHPADVMVSKINSERKANESMSVAS--KRIYQKIGFTGLWNGLMVRIVMIGTLTSFQWLI 286

Query: 189 YETIRIY 195
           Y++ + Y
Sbjct: 287 YDSFKAY 293

 Score = 44.7 bits (104), Expect = 5e-05,   Method: Compositional matrix adjust.
 Identities = 51/218 (23%), Positives = 86/218 (39%), Gaps = 23/218 (10%)

Query: 21  LAGAVSGLLARSITAPMDTIKIRLQLTPANGLKPFGSQVMEVARSMIKNEGIRSFWKGNI 80
           L G ++     S   P+D +K RLQ+ P    K + S  ++  R +I NEG +  + G  
Sbjct: 23  LGGIIACGPTHSSITPLDLVKCRLQVNP----KLYTSN-LQGFRKIIANEGWKKVYTGFG 77

Query: 81  PGSLLYVTYGSAQFSSYSLFNRYLTPFGLEARLHSLVVGAFAGITSSIVSYPFDVLRTRL 140
              + Y   G+ ++  Y  F    + +        L+  A A   + I+  PF+ ++ + 
Sbjct: 78  ATFVGYSLQGAGKYGGYEYFKHLYSSWLSPGVTVYLMASATAEFLADIMLCPFEAIKVK- 136

Query: 141 VANNQMHSMSITREVRDIWKLE-----GLPGFFKGSIASMTTITLTASIMFGTYETI--R 193
               Q         V D WK       G+  F+KG +             F ++E I  +
Sbjct: 137 ---QQTTMPPFCNNVVDGWKKMYAESGGMKAFYKGIVPLWCRQIPYTMCKFTSFEKIVQK 193

Query: 194 IYCDENEKTTAAHKKWELATLNH-SAGTIGGVIAKIIT 230
           IY      +    KK E+  L   S   +GG +A I+ 
Sbjct: 194 IY------SVLPKKKEEMNALQQISVSFVGGYLAGILC 225

>CAGL0B03883g 383602..384522 weakly similar to sp|P32331
           Saccharomyces cerevisiae YPR058w YMC1 or sp|P38087
           Saccharomyces cerevisiae YBR104w YMC2, hypothetical
           start
          Length = 306

 Score = 56.2 bits (134), Expect = 7e-09,   Method: Compositional matrix adjust.
 Identities = 64/297 (21%), Positives = 123/297 (41%), Gaps = 45/297 (15%)

Query: 20  LLAGAVSGLLARSITAPMDTIKIRLQLTPAN---GLKPFGSQVMEVARSMIKNEGIRSFW 76
            +AG  SG+   ++  P DT+K+RLQ +      G++  G   ++     +KN+GIR  +
Sbjct: 13  FVAGMFSGVAKNTVGHPFDTVKVRLQTSQVGSGAGIQFKGP--LDCVYKTLKNQGIRGLY 70

Query: 77  KGNIPGSLLYVTYGSAQFSSYS----LFNRYLTPFGLEARLHSLVV-GAFAGITSSIVSY 131
            G  P    ++   SA   S      L ++Y+ P   +  L   ++ G  AG T S ++ 
Sbjct: 71  LGFTPPLFGWIMMDSALLGSLHNYRMLLHKYVYPEHDKLPLSGCIISGVMAGWTVSFIAA 130

Query: 132 PFDVLRTRLVANNQMHSMSITREVRDIWK-----------LEGLPGFFKGSIASMTTITL 180
           P ++ + +L       +   T  +  + K           L G+   +KG I   +T+  
Sbjct: 131 PVELAKAKLQVQYDAKTTKYTGPIDVVQKVFKQGMATNGILGGVRSLYKGLI---STLIF 187

Query: 181 TASIMF--GTYETIRIYCDENEKTTAAHKKWELATLNHSAGTIGGVIAKIITFPLETIRR 238
            ++ +F  G+YE I  +  +N   +A         +N  AG +        +     + +
Sbjct: 188 RSNFVFWWGSYELITQWFQKNTNLSA-------PAINFWAGGLSASFGFWTSAYPSDVVK 240

Query: 239 RMQFMNSKHLEKFSRHSSVYGSYKGYGFARIGLQILKQEGVSSLYRGILVALSKTIP 295
           ++   N K+           GS+K +  A     I +Q G+   ++G L +  ++ P
Sbjct: 241 QVVLCNDKYD----------GSFKSWRTAVS--DIYRQRGIHGFFKGFLPSFLRSFP 285

 Score = 46.2 bits (108), Expect = 1e-05,   Method: Compositional matrix adjust.
 Identities = 48/201 (23%), Positives = 82/201 (40%), Gaps = 15/201 (7%)

Query: 111 ARLHSLVVGAFAGITSSIVSYPFDVLRTRLVANNQMHSMSITRE-----VRDIWKLEGLP 165
           +R+   V G F+G+  + V +PFD ++ RL  +       I  +     V    K +G+ 
Sbjct: 8   SRVMGFVAGMFSGVAKNTVGHPFDTVKVRLQTSQVGSGAGIQFKGPLDCVYKTLKNQGIR 67

Query: 166 GFFKGSIASMTTITLTASIMFGTYETIRIYCDENEKTTAAHKKWELATLNHSAGTIGGVI 225
           G + G    +    +  S + G+    R+    ++     H K  L+    S G + G  
Sbjct: 68  GLYLGFTPPLFGWIMMDSALLGSLHNYRMLL--HKYVYPEHDKLPLSGCIIS-GVMAGWT 124

Query: 226 AKIITFPLETIRRRMQFMNSKHLEKFSRHSSVYGSYKGYGFARIGLQILKQEGVSSLYRG 285
              I  P+E  + ++Q        K++    V       G A  G+      GV SLY+G
Sbjct: 125 VSFIAAPVELAKAKLQVQYDAKTTKYTGPIDVVQKVFKQGMATNGI----LGGVRSLYKG 180

Query: 286 ILVALSKTIPTTFVSFWG-YE 305
           ++  L     + FV +WG YE
Sbjct: 181 LISTL--IFRSNFVFWWGSYE 199

>Kwal_26.7967
          Length = 297

 Score = 56.2 bits (134), Expect = 8e-09,   Method: Compositional matrix adjust.
 Identities = 62/311 (19%), Positives = 126/311 (40%), Gaps = 29/311 (9%)

Query: 8   LRKGQNVAAWKTLLAGAVSGLLARSITAPMDTIKIRLQLTPANGLKPFGSQVMEVARSMI 67
           + + + V    + LAG+++G +  SIT P +  K RLQL   +         + +     
Sbjct: 1   MSQKKQVDPLHSFLAGSLAGAVEASITYPFEFAKTRLQLVDKSSTA--SRNPLTLIYRTA 58

Query: 68  KNEGIRSFWKGNIPGSLLYVTYGSAQFSSYSLFNRYL--TPFGLEARLHSLVVGAFAGIT 125
           K +G+ + + G     +        +F  +      L     G  +    +V G  AG+ 
Sbjct: 59  KVQGLGAVYVGCPAFIVGNTAKAGVRFLGFDAIKNILRDPTTGELSGPRGIVAGLGAGLL 118

Query: 126 SSIVSY-PFDVLRTRLVANNQMHS-------MSITREVRDIWKLEGLPGFFKGSIASMTT 177
            S+V+  PF+ ++T L+ + Q  S         + R    +   +G  G ++G +     
Sbjct: 119 ESVVAVTPFEAIKTALIDDKQSASPKYHNNGRGMLRNYSSLVYDKGFSGLYRGVLPVSMR 178

Query: 178 ITLTASIMFGTYETIRIYCDENEKTTAAHKKWELATLNHSAGTIGGVIAKIITFPLETIR 237
                ++  G Y  I+      + T +A  K   + +    G   G++    T P++T++
Sbjct: 179 QAANQAVRLGCYNKIKTMI--QDYTNSAKDKPLSSGMTFVVGAFSGIVTVYTTMPIDTVK 236

Query: 238 RRMQFMNSKHLEKFSRHSSVYGSYKGYGFARIGLQILKQEGVSSLYRGILVALSKTIPTT 297
            RMQ ++S      S++SS    +           + ++EG+ + ++G    L + I + 
Sbjct: 237 TRMQSLDS------SKYSSTINCFA---------TVFREEGLKTFWKGATPRLGRLILSG 281

Query: 298 FVSFWGYETAI 308
            + F  YE  +
Sbjct: 282 GIVFTIYEKVL 292

 Score = 52.0 bits (123), Expect = 2e-07,   Method: Compositional matrix adjust.
 Identities = 41/187 (21%), Positives = 84/187 (44%), Gaps = 10/187 (5%)

Query: 18  KTLLAGAVSGLLARSITA-PMDTIKIRLQLTPANGLKPF---GSQVMEVARSMIKNEGIR 73
           + ++AG  +GLL   +   P + IK  L     +    +   G  ++    S++ ++G  
Sbjct: 107 RGIVAGLGAGLLESVVAVTPFEAIKTALIDDKQSASPKYHNNGRGMLRNYSSLVYDKGFS 166

Query: 74  SFWKGNIPGSLLYVTYGSAQFSSYSLFNRYLTPFGLEARLHSL------VVGAFAGITSS 127
             ++G +P S+      + +   Y+     +  +   A+   L      VVGAF+GI + 
Sbjct: 167 GLYRGVLPVSMRQAANQAVRLGCYNKIKTMIQDYTNSAKDKPLSSGMTFVVGAFSGIVTV 226

Query: 128 IVSYPFDVLRTRLVANNQMHSMSITREVRDIWKLEGLPGFFKGSIASMTTITLTASIMFG 187
             + P D ++TR+ + +     S       +++ EGL  F+KG+   +  + L+  I+F 
Sbjct: 227 YTTMPIDTVKTRMQSLDSSKYSSTINCFATVFREEGLKTFWKGATPRLGRLILSGGIVFT 286

Query: 188 TYETIRI 194
            YE + +
Sbjct: 287 IYEKVLV 293

 Score = 43.5 bits (101), Expect = 1e-04,   Method: Compositional matrix adjust.
 Identities = 22/81 (27%), Positives = 44/81 (54%), Gaps = 4/81 (4%)

Query: 1   MFKEEDSLRKGQNVAAWKTLLAGAVSGLLARSITAPMDTIKIRLQLTPANGLKPFGSQVM 60
           M ++  +  K + +++  T + GA SG++    T P+DT+K R+Q   ++      S  +
Sbjct: 196 MIQDYTNSAKDKPLSSGMTFVVGAFSGIVTVYTTMPIDTVKTRMQSLDSSKY----SSTI 251

Query: 61  EVARSMIKNEGIRSFWKGNIP 81
               ++ + EG+++FWKG  P
Sbjct: 252 NCFATVFREEGLKTFWKGATP 272

>Kwal_23.5757
          Length = 307

 Score = 55.8 bits (133), Expect = 9e-09,   Method: Compositional matrix adjust.
 Identities = 47/183 (25%), Positives = 78/183 (42%), Gaps = 13/183 (7%)

Query: 20  LLAGAVSGLLARSITAPMDTIKIRLQLTPANGLKPFGSQVMEVARSMIKNEGIRSFWKGN 79
           L A A +  +A     P + IK+R Q        PF   V +    M+  EG  S +KG 
Sbjct: 120 LAASASAEFIADIFLCPWEAIKVRQQTAVP---PPFARNVFDAYSKMVGAEGFASLYKGI 176

Query: 80  IPGSLLYVTYGSAQFSSYS-----LFNRYLTPFGLEARLHSLVV----GAFAGITSSIVS 130
            P     + Y   +F+S+      ++ R  TP    ++L  + V    G  AGI  ++VS
Sbjct: 177 TPLWFRQIPYTMCKFTSFERIVEMIYARLPTPKREMSQLGQISVSFAGGYLAGILCAVVS 236

Query: 131 YPFDVLRTRLVANNQMHSMSITREVRDIWKLEGLPGFFKGSIASMTTITLTASIMFGTYE 190
           +P DV+ ++ V N +    S  +    I+   G PG + G    +  I    S  +  Y+
Sbjct: 237 HPADVMVSK-VNNERKSGESTLQATSRIYGKIGFPGLWNGLAVRILMIGTLTSFQWLIYD 295

Query: 191 TIR 193
           + +
Sbjct: 296 SFK 298

 Score = 41.2 bits (95), Expect = 5e-04,   Method: Compositional matrix adjust.
 Identities = 47/184 (25%), Positives = 76/184 (41%), Gaps = 18/184 (9%)

Query: 122 AGITSSIVSYPFDVLRTRLVANNQMHSMSITREVRDIWKLEGLPGFFKGSIASMTTITLT 181
            G T S V+ P D+++ R   +  ++  ++    R I + EG    F G  A+    +L 
Sbjct: 30  CGPTHSAVT-PLDLVKCRRQVDASLYKSNLD-GWRQIVRSEGATKVFTGVGATAIGYSLQ 87

Query: 182 ASIMFGTYETIRIYCDENEKTTAAHKKWELATLNHSAGTIGGVIAKIITFPLETIRRRMQ 241
            +  +G YE  +    +      AH       L  SA      IA I   P E I+ R Q
Sbjct: 88  GAFKYGGYEFFKHQYSQLVSPETAHSYRTGIFLAASAS--AEFIADIFLCPWEAIKVRQQ 145

Query: 242 FMNSKHLEKFSRHSSVYGSYKGYGFARIGLQILKQEGVSSLYRGILVALSKTIPTTFVSF 301
              +     F+R+  V+ +Y          +++  EG +SLY+GI     + IP T   F
Sbjct: 146 ---TAVPPPFARN--VFDAYS---------KMVGAEGFASLYKGITPLWFRQIPYTMCKF 191

Query: 302 WGYE 305
             +E
Sbjct: 192 TSFE 195

>Kwal_55.21338
          Length = 323

 Score = 55.5 bits (132), Expect = 1e-08,   Method: Compositional matrix adjust.
 Identities = 62/281 (22%), Positives = 118/281 (41%), Gaps = 25/281 (8%)

Query: 29  LARSITAPMDTIKIRLQLTPANGLKPFGSQVMEVARSMIKNEGIRSFWKGNIPGSLLYVT 88
           ++ ++T P+  +  +LQ   A G K     + +  + + + +G   F+ G +  +L   T
Sbjct: 35  ISMTLTYPLIVVTTKLQTQDAKGEK---LSLADTIKDIYRKDGAMGFFAG-LESALFGTT 90

Query: 89  YGS-AQFSSYSLFNRYLTPFGLEARL---HSLVVGAFAGITSSIVSYPFDVLRTRLVANN 144
             +   +  Y   +R +       RL    S++VG+ AG  ++  + P  V  TR+    
Sbjct: 91  LSNFVYYYCYEASSRCVLRARHTQRLTTAESMLVGSIAGSLNATAANPLWVANTRMTV-- 148

Query: 145 QMHSMSITREVRDIWKLEGLPGFFKGSIASMTTITLTASIMFGTYETIRIYCDENEKTTA 204
           Q         + DI K EG+ G FKG +     + +   I +  YE ++ +   + +T  
Sbjct: 149 QKSDRGTLSTIFDIVKDEGISGLFKG-LNPALILVINPIIQYTVYEQLKNWILSSRQTRT 207

Query: 205 AHKKWELATLNHSAGTIGGVIAKIITFPLETIRRRMQFMNSKHLEKFSRHSSVYGSYKGY 264
               W         G +G + A   T+P  T++ RM  +        +   S+       
Sbjct: 208 LSPSWAFIL-----GAVGKLAATGSTYPYVTMKARMHLLGEHKSSTAAPPRSLLS----- 257

Query: 265 GFARIGLQILKQEGVSSLYRGILVALSKTIPTTFVSFWGYE 305
               +  +I+K++G+  LYRGI + L ++I T    F+  E
Sbjct: 258 ----LMAEIIKKDGILGLYRGIGIKLVQSILTAAFLFFFKE 294

 Score = 36.2 bits (82), Expect = 0.022,   Method: Compositional matrix adjust.
 Identities = 38/196 (19%), Positives = 88/196 (44%), Gaps = 16/196 (8%)

Query: 9   RKGQNVAAWKTLLAGAVSGLLARSITAPMDTIKIRLQLTPANGLKPFGSQVMEVARSMIK 68
           R  Q +   +++L G+++G L  +   P+     R+ +  ++         +     ++K
Sbjct: 111 RHTQRLTTAESMLVGSIAGSLNATAANPLWVANTRMTVQKSD------RGTLSTIFDIVK 164

Query: 69  NEGIRSFWKGNIPGSLLYVTYGSAQFSSYSLFNRYLTPFGLEARLH---SLVVGAFAGIT 125
           +EGI   +KG  P +L+ V     Q++ Y     ++        L    + ++GA   + 
Sbjct: 165 DEGISGLFKGLNP-ALILVINPIIQYTVYEQLKNWILSSRQTRTLSPSWAFILGAVGKLA 223

Query: 126 SSIVSYPFDVLRTR--LVANNQMHSMSITREV----RDIWKLEGLPGFFKGSIASMTTIT 179
           ++  +YP+  ++ R  L+  ++  + +  R +     +I K +G+ G ++G    +    
Sbjct: 224 ATGSTYPYVTMKARMHLLGEHKSSTAAPPRSLLSLMAEIIKKDGILGLYRGIGIKLVQSI 283

Query: 180 LTASIMFGTYETIRIY 195
           LTA+ +F   E + I+
Sbjct: 284 LTAAFLFFFKEGLVIW 299

>Kwal_33.12988
          Length = 303

 Score = 54.7 bits (130), Expect = 2e-08,   Method: Compositional matrix adjust.
 Identities = 54/204 (26%), Positives = 83/204 (40%), Gaps = 35/204 (17%)

Query: 113 LHSLVVGAFAGITSSIVSYPFDVLRTRLVANNQMHSMSIT--REVRDIWKLEGLPGFFKG 170
           L  +  G   GI   +V  PFD+ + RL    Q  S   T  R V+D+ K EGL GF+KG
Sbjct: 24  LKDITAGTTGGIAQVLVGQPFDITKVRL----QTSSTPTTALRVVQDLVKNEGLRGFYKG 79

Query: 171 SIASMTTITLTASIMFGTYETIRIYCDENEKTTAAHKKWELATLN------HSAGTIGGV 224
           +   +  + L  S  FGT E ++ Y          HK+    + +      ++ G + G 
Sbjct: 80  TTLPLIGVGLCVSSQFGTNEAMKRY---------FHKRNNFQSTSLRLPEYYACGFVSGC 130

Query: 225 IAKIITFPLETIRRRMQFMNSKHLEKFSRHSSVYGSYKGYGFARIGLQILKQEGVSSLYR 284
               +  P+E +R  +Q       +           Y+G   A   ++ L +EG   L R
Sbjct: 131 ANAFLATPIEHVRILLQVQTKSRAD---------AEYQG---AMDCIKKLLKEG--KLMR 176

Query: 285 GILVALSKTIPTTFVSFWGYETAI 308
           G    + +T     V F  YE  I
Sbjct: 177 GFTPTILRTSHGFGVYFTSYEAMI 200

 Score = 53.9 bits (128), Expect = 4e-08,   Method: Compositional matrix adjust.
 Identities = 68/308 (22%), Positives = 120/308 (38%), Gaps = 48/308 (15%)

Query: 18  KTLLAGAVSGLLARSITAPMDTIKIRLQL--TPANGLKPFGSQVMEVARSMIKNEGIRSF 75
           K + AG   G+    +  P D  K+RLQ   TP   L+        V + ++KNEG+R F
Sbjct: 25  KDITAGTTGGIAQVLVGQPFDITKVRLQTSSTPTTALR--------VVQDLVKNEGLRGF 76

Query: 76  WKGNIPGSLLYVTYG---SAQFSSYSLFNRYLTPFGLEARLHS--------LVVGAFAGI 124
           +KG    +L  +  G   S+QF +     RY   F       S           G  +G 
Sbjct: 77  YKGT---TLPLIGVGLCVSSQFGTNEAMKRY---FHKRNNFQSTSLRLPEYYACGFVSGC 130

Query: 125 TSSIVSYPFDVLRTRLVANNQMHSMSITREVRD-IWKLEGLPGFFKGSIASMTTITLTAS 183
            ++ ++ P + +R  L    +  + +  +   D I KL       +G   ++   +    
Sbjct: 131 ANAFLATPIEHVRILLQVQTKSRADAEYQGAMDCIKKLLKEGKLMRGFTPTILRTSHGFG 190

Query: 184 IMFGTYETIRIYCDENEKTTAAHK--KWELATLNHSAGTIGGVIAKIITFPLETIRRRMQ 241
           + F +YE   + C E  K  A      W+L       G   G +   + +P + I+  MQ
Sbjct: 191 VYFTSYEA--MICSEQRKGIARKDIPAWKLCLY----GAFSGSLLWAMVYPFDVIKSVMQ 244

Query: 242 FMNSKHLEKFSRHSSVYGSYKGYGFARIGLQILKQEGVSSLYRGILVALSKTIPTTFVSF 301
              S  L      + VYG+       ++   I  + G  +  +G    + +++P    +F
Sbjct: 245 ---SDKL-----RTPVYGT----NVFQVAKNIYNERGPKAFVKGFGPTMLRSLPVNGATF 292

Query: 302 WGYETAIH 309
             +E A+ 
Sbjct: 293 TAFEMAMR 300

 Score = 47.4 bits (111), Expect = 5e-06,   Method: Compositional matrix adjust.
 Identities = 33/103 (32%), Positives = 52/103 (50%), Gaps = 12/103 (11%)

Query: 9   RKG---QNVAAWKTLLAGAVSGLLARSITAPMDTIKIRLQ----LTPANGLKPFGSQVME 61
           RKG   +++ AWK  L GA SG L  ++  P D IK  +Q     TP      +G+ V +
Sbjct: 205 RKGIARKDIPAWKLCLYGAFSGSLLWAMVYPFDVIKSVMQSDKLRTPV-----YGTNVFQ 259

Query: 62  VARSMIKNEGIRSFWKGNIPGSLLYVTYGSAQFSSYSLFNRYL 104
           VA+++    G ++F KG  P  L  +    A F+++ +  R L
Sbjct: 260 VAKNIYNERGPKAFVKGFGPTMLRSLPVNGATFTAFEMAMRIL 302

>Kwal_33.15446
          Length = 305

 Score = 54.7 bits (130), Expect = 2e-08,   Method: Compositional matrix adjust.
 Identities = 44/165 (26%), Positives = 79/165 (47%), Gaps = 14/165 (8%)

Query: 19  TLLAGAVSGLLARSITAPMDTIKIRLQLT-PANGLKPFGSQVMEVARSMIKNEGIRSFWK 77
            +L+G ++G     I AP++  K +LQ+   A   +  G   ++V + +   +GIR  +K
Sbjct: 119 CILSGVLAGWSVSFIAAPVELAKAKLQVQYDAQTTRYRGP--LDVIKKVYAADGIRGMYK 176

Query: 78  GNIPGSLLYVTYGSAQFSSYSLFNRYLTPFGLEARLHSLVVGAFAGITSS-----IVSYP 132
           G +  +L++ T+    + SY L  R+   F     L    +  +AG  S+       +YP
Sbjct: 177 GLV-STLIFRTHFVYWWGSYELLTRW---FKANTNLSDTAINFWAGGFSASFGFWTTAYP 232

Query: 133 FDVLRTRLVANNQMHS--MSITREVRDIWKLEGLPGFFKGSIASM 175
            DV++  ++ N++      S      DIW+  G+ GFFKG + S 
Sbjct: 233 SDVIKQVILCNDKYDGSLRSWRNAASDIWRTRGIRGFFKGFVPSF 277

 Score = 47.8 bits (112), Expect = 4e-06,   Method: Compositional matrix adjust.
 Identities = 47/205 (22%), Positives = 84/205 (40%), Gaps = 35/205 (17%)

Query: 111 ARLHSLVVGAFAGITSSIVSYPFDVLRTRLVANNQMHSMSITRE-VRDIWKLEGLPGFFK 169
           +R+   V G F+GI  + V +PFD ++ RL  +          + V    + +G+ GF+ 
Sbjct: 17  SRMMGFVSGMFSGIAKNAVGHPFDTIKVRLQTSQDTGRFKGPLDCVYQTMRQQGIRGFYL 76

Query: 170 GSIASMTTITLTASIMFGTYETIRIYCDENEKTTAAHKKWELATLNHSAGTIGGVIA--- 226
           G    +    L  S+M G     R+     +K    H++     L  S   + GV+A   
Sbjct: 77  GFTPPLVGWILMDSVMLGCLHNYRMLL---KKYVYQHEE----KLPLSGCILSGVLAGWS 129

Query: 227 -KIITFPLETIRRRMQFMNSKHLEKFSRHSSVYGSYKGYGFARIGLQILKQ----EGVSS 281
              I  P+E  + ++Q        ++                R  L ++K+    +G+  
Sbjct: 130 VSFIAAPVELAKAKLQVQYDAQTTRY----------------RGPLDVIKKVYAADGIRG 173

Query: 282 LYRGILVALSKTIPTTFVSFWG-YE 305
           +Y+G++  L     T FV +WG YE
Sbjct: 174 MYKGLVSTL--IFRTHFVYWWGSYE 196

 Score = 43.5 bits (101), Expect = 9e-05,   Method: Compositional matrix adjust.
 Identities = 42/191 (21%), Positives = 86/191 (45%), Gaps = 18/191 (9%)

Query: 20  LLAGAVSGLLARSITAPMDTIKIRLQLTPANGLKPFGSQVMEVARSMIKNEGIRSFWKGN 79
            ++G  SG+   ++  P DTIK+RLQ +   G   F   +  V ++M + +GIR F+ G 
Sbjct: 22  FVSGMFSGIAKNAVGHPFDTIKVRLQTSQDTGR--FKGPLDCVYQTM-RQQGIRGFYLGF 78

Query: 80  IPGSLLYVTYGSAQFSSYS----LFNRYLTPFGLEARLHSLVV-GAFAGITSSIVSYPFD 134
            P  + ++   S           L  +Y+     +  L   ++ G  AG + S ++ P +
Sbjct: 79  TPPLVGWILMDSVMLGCLHNYRMLLKKYVYQHEEKLPLSGCILSGVLAGWSVSFIAAPVE 138

Query: 135 VLRTRLVANNQMHSMSITRE------VRDIWKLEGLPGFFKGSIASMTTITLTASIMFGT 188
           + + +L      +    TR       ++ ++  +G+ G +KG ++++   T      +G+
Sbjct: 139 LAKAKLQVQ---YDAQTTRYRGPLDVIKKVYAADGIRGMYKGLVSTLIFRTHFV-YWWGS 194

Query: 189 YETIRIYCDEN 199
           YE +  +   N
Sbjct: 195 YELLTRWFKAN 205

>Sklu_2442.8 YNL003C, Contig c2442 12309-13136
          Length = 275

 Score = 53.9 bits (128), Expect = 3e-08,   Method: Compositional matrix adjust.
 Identities = 53/195 (27%), Positives = 85/195 (43%), Gaps = 29/195 (14%)

Query: 113 LHSLVVGAFAGITSSIVSYPFDVLRTRLVANNQMHSMSITREVRDIWKLEGLPGFFKGSI 172
           L SL  GA AG ++ +  +P D L+TRL A     +              G  G ++G  
Sbjct: 7   LVSLASGAAAGTSTDLAFFPIDTLKTRLQAKGGFFANG------------GYKGVYRGLG 54

Query: 173 ASMTTITLTASIMFGTYETIRIYCDENEKTTAAHKKWELATLNHS-AGTIGGVIAKIITF 231
           +++     +AS+ F +Y+++++Y                 TL+H  + +IG V A ++  
Sbjct: 55  SAVIASAPSASLFFVSYDSMKVYSKPVISKYVTSNNQMADTLSHMFSSSIGEVSACLVRV 114

Query: 232 PLETIRRRMQFMNSKHLEKFSRHSSVYGSYKGYGFARIGLQILKQEGV-SSLYRGILVAL 290
           P E I++R Q     H    S  +          F +I LQ    EGV  +LYRG    +
Sbjct: 115 PAEVIKQRTQ----THKTNSSWQT----------FTKI-LQNENGEGVLRNLYRGWNTTI 159

Query: 291 SKTIPTTFVSFWGYE 305
            + IP T + F  YE
Sbjct: 160 MREIPFTCIQFPLYE 174

 Score = 40.8 bits (94), Expect = 7e-04,   Method: Compositional matrix adjust.
 Identities = 44/178 (24%), Positives = 77/178 (43%), Gaps = 19/178 (10%)

Query: 23  GAVSGLLARSITAPMDTIKIRLQLTPANGLKPFGSQVMEVARSMIKNEG----IRSFWKG 78
           G VS  L R    P + IK R Q    N          +    +++NE     +R+ ++G
Sbjct: 105 GEVSACLVR---VPAEVIKQRTQTHKTN-------SSWQTFTKILQNENGEGVLRNLYRG 154

Query: 79  NIPGSLLYVTYGSAQFSSYSLFNR-YLTPFGLE--ARLHSLVVGAFAGITSSIVSYPFDV 135
                +  + +   QF  Y    + +    G +  A     V G+ AG  ++  + P DV
Sbjct: 155 WNTTIMREIPFTCIQFPLYEFLKKTWAKRNGQDHVAPWQGSVCGSVAGAIAAATTTPLDV 214

Query: 136 LRTRLVANNQMHSMSITREVRDIWKLEGLPGFFKGSIASMTTITLTASIMFGTYETIR 193
           L+TRL+ +++  S+ + +  ++I+  EG   FF G       I+   +I  G YET+ 
Sbjct: 215 LKTRLMLSHK--SIPVAQLAKNIYAEEGFKVFFSGVGPRTMWISAGGAIFLGVYETVH 270

 Score = 36.6 bits (83), Expect = 0.017,   Method: Compositional matrix adjust.
 Identities = 27/87 (31%), Positives = 50/87 (57%), Gaps = 8/87 (9%)

Query: 9   RKGQN-VAAWKTLLAGAVSGLLARSITAPMDTIKIRLQLTPANGLKPFGSQVMEVARSMI 67
           R GQ+ VA W+  + G+V+G +A + T P+D +K RL L+  +        V ++A+++ 
Sbjct: 183 RNGQDHVAPWQGSVCGSVAGAIAAATTTPLDVLKTRLMLSHKS------IPVAQLAKNIY 236

Query: 68  KNEGIRSFWKGNIPGSLLYVTYGSAQF 94
             EG + F+ G  P + ++++ G A F
Sbjct: 237 AEEGFKVFFSGVGPRT-MWISAGGAIF 262

 Score = 33.5 bits (75), Expect = 0.17,   Method: Compositional matrix adjust.
 Identities = 63/280 (22%), Positives = 110/280 (39%), Gaps = 52/280 (18%)

Query: 19  TLLAGAVSGLLARSITAPMDTIKIRLQLTP---ANG-----LKPFGSQVMEVARSMIKNE 70
           +L +GA +G        P+DT+K RLQ      ANG      +  GS V+  A S     
Sbjct: 9   SLASGAAAGTSTDLAFFPIDTLKTRLQAKGGFFANGGYKGVYRGLGSAVIASAPS----- 63

Query: 71  GIRSFWKGNIPGSLLYVTYGSAQFSSYSLFNRYLTPFGLEAR-LHSLVVGAFAGITSSIV 129
                       SL +V+Y S +  S  + ++Y+T     A  L  +   +   +++ +V
Sbjct: 64  -----------ASLFFVSYDSMKVYSKPVISKYVTSNNQMADTLSHMFSSSIGEVSACLV 112

Query: 130 SYPFDVLRTRLVANNQMHSMSITREVRDIWKLEG-LPGFFKG-SIASMTTITLTASIMFG 187
             P +V++ R   +    S     ++      EG L   ++G +   M  I  T  I F 
Sbjct: 113 RVPAEVIKQRTQTHKTNSSWQTFTKILQNENGEGVLRNLYRGWNTTIMREIPFTC-IQFP 171

Query: 188 TYETI-RIYCDENEKTTAAHKKWELATLNHSAGTIGGVIAKIITFPLETIRRRMQFMNSK 246
            YE + + +   N +   A   W+ +      G++ G IA   T PL+ ++ R+      
Sbjct: 172 LYEFLKKTWAKRNGQDHVA--PWQGSV----CGSVAGAIAAATTTPLDVLKTRLML---- 221

Query: 247 HLEKFSRHSSVYGSYKGYGFARIGLQILKQEGVSSLYRGI 286
                        S+K    A++   I  +EG    + G+
Sbjct: 222 -------------SHKSIPVAQLAKNIYAEEGFKVFFSGV 248

>AFR147C [3339] [Homologous to NOHBY] (703270..704217) [948 bp, 315
           aa]
          Length = 315

 Score = 53.9 bits (128), Expect = 4e-08,   Method: Compositional matrix adjust.
 Identities = 72/291 (24%), Positives = 127/291 (43%), Gaps = 49/291 (16%)

Query: 29  LARSITAPMDTIKIRLQLTPANGLKPFGSQV---MEVARSMIKNEGIRSFWKGNIPGSLL 85
           L+ ++T P+ T+  R+Q++  +  K  G++    +E  R + + EG+  F+ G     L 
Sbjct: 29  LSMALTMPLVTLATRMQVSEQD--KEPGTRSKSKLEAVREIYRKEGVVGFYYG-----LE 81

Query: 86  YVTYGSAQFSS-----YSLFNRYLTPFGLEARLHS---LVVGAFAGITSSIVSYPFDVLR 137
              YG A  S      Y L  R         RL++   ++  A AG  ++I S P  V+ 
Sbjct: 82  SAMYGMAANSLNYYYFYELAARATMRVRGSRRLNTSEAILSSAVAGSMTAIASNPIWVVN 141

Query: 138 TRL-VANNQMHSMSITREVRDIWKLEGLPGFFKGSIASMTTITLTASIMFGTYETIRIYC 196
           TR+ VA ++  ++++   + DI + +G+   F G         L  ++M  +   I+   
Sbjct: 142 TRMTVAKSEQSTLAV---LLDIVRKDGVTALFNG---------LRPALMLVSNPIIQYTV 189

Query: 197 DENEKTTAAHKKWE-----LATLNHSAGTIGGVIAKIITFPLETIRRRMQFMNSKHLEKF 251
            E  K      KW      L +     G +G + A   T+P  T++ RM     K  E  
Sbjct: 190 FEQLKNVVL--KWSGSDVLLPSWAFLLGAVGKLAATGSTYPYITLKTRMHLAKGK--EDA 245

Query: 252 SRHSSVYGSYKGYGFARIGLQILKQEGVSSLYRGILVALSKTIPTTFVSFW 302
               S++          + + I+K+EG+  LY GI V L+++I T    F+
Sbjct: 246 DTQQSMWS---------LMVDIVKKEGIQGLYHGIGVKLTQSILTAAFLFY 287

>Kwal_56.23011
          Length = 303

 Score = 53.9 bits (128), Expect = 4e-08,   Method: Compositional matrix adjust.
 Identities = 49/221 (22%), Positives = 90/221 (40%), Gaps = 25/221 (11%)

Query: 91  SAQFSSYSLFNRYLTPFGLEARLHSLVVGAFAGITSSIVSYPFDVLRTRLVANNQMHSMS 150
           S + +S  + +  +     +  L  +  G   G+   +V  PFD+ + RL         +
Sbjct: 2   SEELTSPQVVDDLVDTHDFKQALKDVFCGTVGGVAQVLVGQPFDITKVRL--QTSPVPTT 59

Query: 151 ITREVRDIWKLEGLPGFFKGSIASMTTITLTASIMFGTYETIRIYC---DENEKTTAAHK 207
             + ++ + K EGL  F+KG++A +  +    S  FG  E ++ +    D N     A +
Sbjct: 60  AAQVIKSLVKNEGLLAFYKGTLAPLAGVGACVSCQFGVNEALKKWFRKKDGNFDQPLALR 119

Query: 208 KWELATLNHSAGTIGGVIAKIITFPLETIRRRMQFMNSKHLEKFSRHSSVYGSYKGYGFA 267
           ++      ++ G + G     +  P+E +R R+Q   +         SS    Y  +G  
Sbjct: 120 QY------YACGFVSGTANAFLATPIEHVRIRLQLQTA---------SSSAAEY--HGSL 162

Query: 268 RIGLQILKQEGVSSLYRGILVALSKTIPTTFVSFWGYETAI 308
               ++LKQ    +L RG      +T     + F  YET I
Sbjct: 163 DCARKLLKQ---GALMRGFTATTLRTSHGFGIYFLTYETLI 200

 Score = 51.2 bits (121), Expect = 3e-07,   Method: Compositional matrix adjust.
 Identities = 61/299 (20%), Positives = 109/299 (36%), Gaps = 34/299 (11%)

Query: 16  AWKTLLAGAVSGLLARSITAPMDTIKIRLQLTPANGLKPFGSQVMEVARSMIKNEGIRSF 75
           A K +  G V G+    +  P D  K+RLQ +P        +   +V +S++KNEG+ +F
Sbjct: 23  ALKDVFCGTVGGVAQVLVGQPFDITKVRLQTSPVP------TTAAQVIKSLVKNEGLLAF 76

Query: 76  WKGNIPGSLLYVTYGSAQFSSYSLFNRYL--------TPFGLEARLHSLVVGAFAGITSS 127
           +KG +          S QF       ++          P  L         G  +G  ++
Sbjct: 77  YKGTLAPLAGVGACVSCQFGVNEALKKWFRKKDGNFDQPLALR---QYYACGFVSGTANA 133

Query: 128 IVSYPFDVLRTRLVANNQMHSMSITREVRDIW-KLEGLPGFFKGSIASMTTITLTASIMF 186
            ++ P + +R RL       S +      D   KL       +G  A+    +    I F
Sbjct: 134 FLATPIEHVRIRLQLQTASSSAAEYHGSLDCARKLLKQGALMRGFTATTLRTSHGFGIYF 193

Query: 187 GTYETIRIYCDENEKTTAAHKKWELATLNHSAGTIGGVIAKIITFPLETIRRRMQFMNSK 246
            TYET+      +         W++       G   G     +T+P + ++  MQ    K
Sbjct: 194 LTYETLIANQAHHGVLRENIPAWKVCVY----GAFSGAFFWAMTYPFDVVKSVMQADKLK 249

Query: 247 HLEKFSRHSSVYGSYKGYGFARIGLQILKQEGVSSLYRGILVALSKTIPTTFVSFWGYE 305
           +         VYG         +   I ++ G  +  +G    + +++P    +F  +E
Sbjct: 250 N--------PVYGRNP----LAVAKAIYRERGPRAFTKGFTPTMLRSLPVNGATFAAFE 296

 Score = 48.9 bits (115), Expect = 2e-06,   Method: Compositional matrix adjust.
 Identities = 29/95 (30%), Positives = 50/95 (52%), Gaps = 5/95 (5%)

Query: 12  QNVAAWKTLLAGAVSGLLARSITAPMDTIKIRLQLTPANGLKP--FGSQVMEVARSMIKN 69
           +N+ AWK  + GA SG    ++T P D +K  +Q   A+ LK   +G   + VA+++ + 
Sbjct: 211 ENIPAWKVCVYGAFSGAFFWAMTYPFDVVKSVMQ---ADKLKNPVYGRNPLAVAKAIYRE 267

Query: 70  EGIRSFWKGNIPGSLLYVTYGSAQFSSYSLFNRYL 104
            G R+F KG  P  L  +    A F+++ +  R +
Sbjct: 268 RGPRAFTKGFTPTMLRSLPVNGATFAAFEITMRLI 302

 Score = 38.5 bits (88), Expect = 0.005,   Method: Compositional matrix adjust.
 Identities = 46/204 (22%), Positives = 91/204 (44%), Gaps = 18/204 (8%)

Query: 2   FKEEDSLRKGQNVAAWKTLLAGAVSGLLARSITAPMDTIKIRLQLTPANGLKPFGSQVME 61
           F+++D     Q +A  +    G VSG     +  P++ ++IRLQL  A+         ++
Sbjct: 105 FRKKDG-NFDQPLALRQYYACGFVSGTANAFLATPIEHVRIRLQLQTASSSAAEYHGSLD 163

Query: 62  VARSMIKNEGI-RSFWKGNIPGS----LLYVTYGS--AQFSSYSLFNRYLTPFGLEARLH 114
            AR ++K   + R F    +  S    + ++TY +  A  + + +    +  + +     
Sbjct: 164 CARKLLKQGALMRGFTATTLRTSHGFGIYFLTYETLIANQAHHGVLRENIPAWKV----- 218

Query: 115 SLVVGAFAGITSSIVSYPFDVLRTRLVAN---NQMHSMSITREVRDIWKLEGLPGFFKGS 171
             V GAF+G     ++YPFDV+++ + A+   N ++  +     + I++  G   F KG 
Sbjct: 219 -CVYGAFSGAFFWAMTYPFDVVKSVMQADKLKNPVYGRNPLAVAKAIYRERGPRAFTKGF 277

Query: 172 IASMTTITLTASIMFGTYE-TIRI 194
             +M          F  +E T+R+
Sbjct: 278 TPTMLRSLPVNGATFAAFEITMRL 301

>Kwal_27.11419
          Length = 298

 Score = 53.5 bits (127), Expect = 5e-08,   Method: Compositional matrix adjust.
 Identities = 72/314 (22%), Positives = 127/314 (40%), Gaps = 55/314 (17%)

Query: 20  LLAGAVSGLLARSITAPMDTIKIRLQLTPANGLKPFGSQVMEVARSMIKNEGIRSFWKGN 79
            + G V GL +  I  P D +K RLQ   +       S +++V RS I+  G    WKG 
Sbjct: 11  FIGGFVGGLTSAVILQPFDLLKTRLQQNKS-------SNLLDVVRS-IETPG--QLWKGT 60

Query: 80  IPGSLLYVTYGSAQF-SSYSLFNRYLTPFGLE---------------ARLHSLVVGAFAG 123
           +P S L  + GSA F S+ ++    +    ++               +   +L+ GA   
Sbjct: 61  LP-SALRTSVGSALFLSTLNIVRSAIADKRVKGIAGKNGSSSFLPQLSMYENLISGAITR 119

Query: 124 ITSSIVSYPFDVLRTRLVANNQMHSMSITREVRDIWKLEGLPGFFKGSIASMTTITLTAS 183
               + + P  VL+ R   +   +  S+      I++ EG+ G F G  A++      A 
Sbjct: 120 AAVGVATMPITVLKVRF-ESTMYNYKSLGEAATHIYRSEGIRGLFSGCGATVMRDAPYAG 178

Query: 184 IMFGTYETIRI---------YCDENEKTTAAHKKWELATLNHSAGTIGGVIAKIITFPLE 234
           +    YE  ++           + NE    + K   +  +N  A      +A  IT P +
Sbjct: 179 LYVLFYEQSKLQLPRILPVWMVEHNESGVFSTKTSTI--INSIAAFSSASLATTITSPFD 236

Query: 235 TIRRRMQFMNSKHLEKFSRHSSVYGSYKGYGFARIGLQILKQEGVSSLYRGILVALSKTI 294
           TI+ RMQ   S++                YGF +    I++ E   +L+ G+ + LS+  
Sbjct: 237 TIKTRMQLNPSQY----------------YGFIQTFKSIIRYERPRNLFDGLSLRLSRKA 280

Query: 295 PTTFVSFWGYETAI 308
            +  +++  YE  +
Sbjct: 281 LSAGIAWGIYEELV 294

 Score = 43.9 bits (102), Expect = 7e-05,   Method: Compositional matrix adjust.
 Identities = 45/193 (23%), Positives = 81/193 (41%), Gaps = 32/193 (16%)

Query: 112 RLHSLVVGAF-AGITSSIVSYPFDVLRTRLVANNQMHSMSITREVRDIWKLEGLPG-FFK 169
           R  S  +G F  G+TS+++  PFD+L+TRL  N   + + + R +         PG  +K
Sbjct: 6   RGRSHFIGGFVGGLTSAVILQPFDLLKTRLQQNKSSNLLDVVRSIET-------PGQLWK 58

Query: 170 GSIASMTTITLTASIMFGTYETIRIYCDENEKTTAAHKKWE---LATLNHSAGTIGGVIA 226
           G++ S    ++ +++   T   +R    +      A K      L  L+     I G I 
Sbjct: 59  GTLPSALRTSVGSALFLSTLNIVRSAIADKRVKGIAGKNGSSSFLPQLSMYENLISGAIT 118

Query: 227 K----IITFPLETIRRRMQFMNSKHLEKFSRHSSVYGSYKGYGFARIGLQILKQEGVSSL 282
           +    + T P+  ++ R +             S++Y +YK  G A     I + EG+  L
Sbjct: 119 RAAVGVATMPITVLKVRFE-------------STMY-NYKSLGEA--ATHIYRSEGIRGL 162

Query: 283 YRGILVALSKTIP 295
           + G    + +  P
Sbjct: 163 FSGCGATVMRDAP 175

 Score = 39.7 bits (91), Expect = 0.002,   Method: Compositional matrix adjust.
 Identities = 43/195 (22%), Positives = 87/195 (44%), Gaps = 21/195 (10%)

Query: 13  NVAAWKTLLAGAVSGLLARSITAPMDTIKIRLQLTPANGLKPFGSQVMEVARSMIKNEGI 72
            ++ ++ L++GA++       T P+  +K+R + T  N  K  G    E A  + ++EGI
Sbjct: 105 QLSMYENLISGAITRAAVGVATMPITVLKVRFESTMYN-YKSLG----EAATHIYRSEGI 159

Query: 73  RSFWKG-------NIPGSLLYVT-YGSAQFSSYSLFNRYLTPF---GLEARLHSLVVGAF 121
           R  + G       + P + LYV  Y  ++     +   ++      G+ +   S ++ + 
Sbjct: 160 RGLFSGCGATVMRDAPYAGLYVLFYEQSKLQLPRILPVWMVEHNESGVFSTKTSTIINSI 219

Query: 122 AGITS----SIVSYPFDVLRTRLVANNQMHSMSITREVRDIWKLEGLPGFFKGSIASMTT 177
           A  +S    + ++ PFD ++TR+  N   +     +  + I + E     F G    ++ 
Sbjct: 220 AAFSSASLATTITSPFDTIKTRMQLNPSQY-YGFIQTFKSIIRYERPRNLFDGLSLRLSR 278

Query: 178 ITLTASIMFGTYETI 192
             L+A I +G YE +
Sbjct: 279 KALSAGIAWGIYEEL 293

>YBR192W (RIM2) [375] chr2 (607609..608742) Member of the
           mitochondrial carrier (MCF) family of membrane
           transporters, required for respiration [1134 bp, 377 aa]
          Length = 377

 Score = 53.9 bits (128), Expect = 5e-08,   Method: Compositional matrix adjust.
 Identities = 82/357 (22%), Positives = 145/357 (40%), Gaps = 75/357 (21%)

Query: 4   EEDSLRKGQNVAAWKTLLAGAVSGLLARSITAPMDTIKIRLQLTPANGLKPFGSQVMEVA 63
           ++  +     V  W   +AG + G+    +T P D +K RLQ      LK + SQ + ++
Sbjct: 40  KQSEIENHPTVKPWVHFVAGGIGGMAGAVVTCPFDLVKTRLQSDIF--LKAYKSQAVNIS 97

Query: 64  R--------------------------SMIKNEGIRSFWKGNIPG--------SLLYVTY 89
           +                          ++ K EG RS +KG  P         S+ + TY
Sbjct: 98  KGSTRPKSINYVIQAGTHFKETLGIIGNVYKQEGFRSLFKGLGPNLVGVIPARSINFFTY 157

Query: 90  GSAQFSSYSLFNRYLTPFGLEARLHSLVVGAFAGITSSIVSYPFDVLRTRLVANNQMHSM 149
           G+ +      FN      G E  +  L+  A AG  ++  + P  +++TR+  +      
Sbjct: 158 GTTKDMYAKAFNN-----GQETPMIHLMAAATAGWATATATNPIWLIKTRVQLDKA--GK 210

Query: 150 SITREVRDIWKL-------EGLPGFFKGSIASMTTITLTASIMFGTYETIRI-------- 194
           +  R+ ++ W         EG  G +KG  AS    ++   + +  YE ++         
Sbjct: 211 TSVRQYKNSWDCLKSVIRNEGFTGLYKGLSASYLG-SVEGILQWLLYEQMKRLIKERSIE 269

Query: 195 ---YCDENEKTTAAHKKWELATLNHSAGTIGGVIAKIITFPLETIRRRMQFMNSKHLEKF 251
              Y  E  K+T+   K E    + SAG +   +A I T+P E +R R++    ++    
Sbjct: 270 KFGYQAEGTKSTSEKVK-EWCQRSGSAG-LAKFVASIATYPHEVVRTRLRQTPKEN---- 323

Query: 252 SRHSSVYGSYKGYGFARIGLQILKQEGVSSLYRGILVALSKTIPTTFVSFWGYETAI 308
                  G  K  G  +    I+K+EG+ S+Y G+   L +T+P + + F  +E  I
Sbjct: 324 -------GKRKYTGLVQSFKVIIKEEGLFSMYSGLTPHLMRTVPNSIIMFGTWEIVI 373

 Score = 30.0 bits (66), Expect = 2.2,   Method: Compositional matrix adjust.
 Identities = 23/105 (21%), Positives = 47/105 (44%), Gaps = 1/105 (0%)

Query: 2   FKEEDSLRKGQNVAAWKTLLAGA-VSGLLARSITAPMDTIKIRLQLTPANGLKPFGSQVM 60
           ++ E +    + V  W      A ++  +A   T P + ++ RL+ TP    K   + ++
Sbjct: 273 YQAEGTKSTSEKVKEWCQRSGSAGLAKFVASIATYPHEVVRTRLRQTPKENGKRKYTGLV 332

Query: 61  EVARSMIKNEGIRSFWKGNIPGSLLYVTYGSAQFSSYSLFNRYLT 105
           +  + +IK EG+ S + G  P  +  V      F ++ +  R L+
Sbjct: 333 QSFKVIIKEEGLFSMYSGLTPHLMRTVPNSIIMFGTWEIVIRLLS 377

>Sklu_1275.1 , Contig c1275 314-1249
          Length = 311

 Score = 53.5 bits (127), Expect = 6e-08,   Method: Compositional matrix adjust.
 Identities = 49/197 (24%), Positives = 86/197 (43%), Gaps = 21/197 (10%)

Query: 113 LHSLVVGAFAGITSSIVSYPFDVLRTRLVANNQMHSMSITREVRDIWKLEGLPGFFKGSI 172
           +  ++ G   GI   +V  PFD+ + R+  ++   S +    ++++ K EGL  F+KG++
Sbjct: 24  IKDIISGTSGGIAQVLVGQPFDITKVRMQTSS--GSPTAIEVIKNLVKNEGLLAFYKGTL 81

Query: 173 ASMTTITLTASIMFGTYETIRIYCDENEKTTAAHKKWELATLN-HSAGTIGGVIAKIITF 231
             +  +    S  FG  E ++ Y          +K   L+ L  ++ G + G     +  
Sbjct: 82  VPLIGVGACVSCQFGVNEAMKRYFLR----VNGYKDQHLSLLQYYTCGFVSGSANAFLAT 137

Query: 232 PLETIRRRMQFMNSKHLEKFSRHSSVYGSYKGYGFARIGLQILKQEGVSSLYRGILVALS 291
           P+E +R R+Q + +K L K     S+    K          +LKQ+   +L RG    L 
Sbjct: 138 PIEHVRIRLQ-LQTKALAKAEYRGSLDCMKK----------LLKQK---ALMRGFTATLM 183

Query: 292 KTIPTTFVSFWGYETAI 308
           +T     V F  YE  I
Sbjct: 184 RTSHGFGVYFLTYEALI 200

 Score = 53.1 bits (126), Expect = 8e-08,   Method: Compositional matrix adjust.
 Identities = 51/232 (21%), Positives = 99/232 (42%), Gaps = 16/232 (6%)

Query: 16  AWKTLLAGAVSGLLARSITAPMDTIKIRLQLTPANGLKPFGSQVMEVARSMIKNEGIRSF 75
           A K +++G   G+    +  P D  K+R+Q +  +         +EV ++++KNEG+ +F
Sbjct: 23  AIKDIISGTSGGIAQVLVGQPFDITKVRMQTSSGS------PTAIEVIKNLVKNEGLLAF 76

Query: 76  WKGNIPGSLLYVTYGSAQFSSYSLFNRY-LTPFGLEARLHSLV----VGAFAGITSSIVS 130
           +KG +   +      S QF       RY L   G + +  SL+     G  +G  ++ ++
Sbjct: 77  YKGTLVPLIGVGACVSCQFGVNEAMKRYFLRVNGYKDQHLSLLQYYTCGFVSGSANAFLA 136

Query: 131 YPFDVLRTRLVANNQMHSMSITREVRDIW-KLEGLPGFFKGSIASMTTITLTASIMFGTY 189
            P + +R RL    +  + +  R   D   KL       +G  A++   +    + F TY
Sbjct: 137 TPIEHVRIRLQLQTKALAKAEYRGSLDCMKKLLKQKALMRGFTATLMRTSHGFGVYFLTY 196

Query: 190 ETIRIYCDENEKTTAAHKKWELATLNHSAGTIGGVIAKIITFPLETIRRRMQ 241
           E + +  ++N         W++       G   G     +T+P + ++  MQ
Sbjct: 197 EALIMNQNKNGVLRKDIPPWKVCVF----GAFSGAFFWAMTYPFDVVKSIMQ 244

 Score = 42.7 bits (99), Expect = 2e-04,   Method: Compositional matrix adjust.
 Identities = 30/101 (29%), Positives = 50/101 (49%), Gaps = 11/101 (10%)

Query: 8   LRKGQNVAAWKTLLAGAVSGLLARSITAPMDTIKIRLQ----LTPANGLKPFGSQVMEVA 63
           LRK  ++  WK  + GA SG    ++T P D +K  +Q    ++P +     G  V +VA
Sbjct: 209 LRK--DIPPWKVCVFGAFSGAFFWAMTYPFDVVKSIMQADRLVSPVH-----GKNVFQVA 261

Query: 64  RSMIKNEGIRSFWKGNIPGSLLYVTYGSAQFSSYSLFNRYL 104
           +S+    G  +F KG +P  L  +    A F+++ +  R L
Sbjct: 262 KSIHATRGWGAFVKGFVPTMLRSLPVNGATFATFEVTMRLL 302

 Score = 39.7 bits (91), Expect = 0.002,   Method: Compositional matrix adjust.
 Identities = 44/201 (21%), Positives = 89/201 (44%), Gaps = 27/201 (13%)

Query: 10  KGQNVAAWKTLLAGAVSGLLARSITAPMDTIKIRLQLTPANGLKPFGSQVMEVARSMIKN 69
           K Q+++  +    G VSG     +  P++ ++IRLQL      K      ++  + ++K 
Sbjct: 112 KDQHLSLLQYYTCGFVSGSANAFLATPIEHVRIRLQLQTKALAKAEYRGSLDCMKKLLKQ 171

Query: 70  EGI-RSFWKGNIPGSLLYVTYG-SAQFSSYS----------LFNRYLTPFGLEARLHSLV 117
           + + R F       +L+  ++G    F +Y           +  + + P+ +       V
Sbjct: 172 KALMRGF-----TATLMRTSHGFGVYFLTYEALIMNQNKNGVLRKDIPPWKV------CV 220

Query: 118 VGAFAGITSSIVSYPFDVLRTRLVAN---NQMHSMSITREVRDIWKLEGLPGFFKGSIAS 174
            GAF+G     ++YPFDV+++ + A+   + +H  ++ +  + I    G   F KG + +
Sbjct: 221 FGAFSGAFFWAMTYPFDVVKSIMQADRLVSPVHGKNVFQVAKSIHATRGWGAFVKGFVPT 280

Query: 175 MTTITLTASIMFGTYE-TIRI 194
           M          F T+E T+R+
Sbjct: 281 MLRSLPVNGATFATFEVTMRL 301

>Sklu_2398.4 , Contig c2398 9476-10405
          Length = 309

 Score = 53.5 bits (127), Expect = 6e-08,   Method: Compositional matrix adjust.
 Identities = 66/304 (21%), Positives = 126/304 (41%), Gaps = 44/304 (14%)

Query: 16  AWKTLLAGAVSGLLARSITAPMDTIKIRLQLTPANGLKPFGSQVMEVARSMIKNEGIRSF 75
           A K +L+G   G+    +  P D  K+R+Q +  +      +  ++V  S+IKNEGI  F
Sbjct: 23  AIKDILSGTAGGIAQVLVGQPFDITKVRMQTSAGS------ATAVDVVTSLIKNEGILGF 76

Query: 76  WKGNIPGSLLYVTYGSAQFS-SYSLFNRYLTPFGLEARLHSL----VVGAFAGITSSIVS 130
           +KG +   +      S QF  + ++  R+    G  ++  SL    V G  +G  ++ ++
Sbjct: 77  YKGTLAPLVGVGACVSCQFGVNEAMKRRFRRMNGDPSKPLSLKQYYVCGVASGCANAFLA 136

Query: 131 YPFDVLRTRLVANNQMHSMSITR-----EVRDIWKLEGLPGFFKGSIASMTTITLTASIM 185
            P + +R RL    Q+ + S+        +  + KL       +G  A++        I 
Sbjct: 137 TPIEHVRIRL----QLQTKSLANAEYQGSLDCMRKLLKQGALMRGFTATLMRTCHGFGIY 192

Query: 186 FGTYETIRIYCDENEKTTAAHKK----WELATLNHSAGTIGGVIAKIITFPLETIRRRMQ 241
           F TYE +      N+      +K    W++       G   G     + +P++ ++  MQ
Sbjct: 193 FSTYEALI----ANQHKKGIPRKDIAPWKVCIF----GAFSGACYWAMAYPIDVVKSIMQ 244

Query: 242 FMNSKHLEKFSRHSSVYGSYKGYGFARIGLQILKQEGVSSLYRGILVALSKTIPTTFVSF 301
              S  L      S V+G+       ++   I    G  +  +G + A+ +++P    +F
Sbjct: 245 ---SDRLV-----SPVHGT----NVWQVAKSIYTTRGKRAFIKGFMPAMLRSLPVNGATF 292

Query: 302 WGYE 305
             +E
Sbjct: 293 ATFE 296

 Score = 47.8 bits (112), Expect = 5e-06,   Method: Compositional matrix adjust.
 Identities = 48/201 (23%), Positives = 82/201 (40%), Gaps = 29/201 (14%)

Query: 113 LHSLVVGAFAGITSSIVSYPFDVLRTRLVANNQMHSMSITREVRDIWKLEGLPGFFKGSI 172
           +  ++ G   GI   +V  PFD+ + R+       S +    V  + K EG+ GF+KG++
Sbjct: 24  IKDILSGTAGGIAQVLVGQPFDITKVRM--QTSAGSATAVDVVTSLIKNEGILGFYKGTL 81

Query: 173 ASMTTITLTASIMFGTYETI-----RIYCDENEKTTAAHKKWELATLNHSAGTIGGVIAK 227
           A +  +    S  FG  E +     R+  D ++  +   K++      +  G   G    
Sbjct: 82  APLVGVGACVSCQFGVNEAMKRRFRRMNGDPSKPLSL--KQY------YVCGVASGCANA 133

Query: 228 IITFPLETIRRRMQFMNSKHLEKFSRHSSVYGSYKGYGFARIGLQILKQEGVSSLYRGIL 287
            +  P+E +R R+Q + +K L       S+    K          +LKQ    +L RG  
Sbjct: 134 FLATPIEHVRIRLQ-LQTKSLANAEYQGSLDCMRK----------LLKQ---GALMRGFT 179

Query: 288 VALSKTIPTTFVSFWGYETAI 308
             L +T     + F  YE  I
Sbjct: 180 ATLMRTCHGFGIYFSTYEALI 200

 Score = 47.4 bits (111), Expect = 6e-06,   Method: Compositional matrix adjust.
 Identities = 28/97 (28%), Positives = 51/97 (52%), Gaps = 9/97 (9%)

Query: 12  QNVAAWKTLLAGAVSGLLARSITAPMDTIKIRLQ----LTPANGLKPFGSQVMEVARSMI 67
           +++A WK  + GA SG    ++  P+D +K  +Q    ++P +     G+ V +VA+S+ 
Sbjct: 211 KDIAPWKVCIFGAFSGACYWAMAYPIDVVKSIMQSDRLVSPVH-----GTNVWQVAKSIY 265

Query: 68  KNEGIRSFWKGNIPGSLLYVTYGSAQFSSYSLFNRYL 104
              G R+F KG +P  L  +    A F+++ +  R L
Sbjct: 266 TTRGKRAFIKGFMPAMLRSLPVNGATFATFEMTMRLL 302

>KLLA0B14454g complement(1268709..1269626) highly similar to
           sp|P23641 Saccharomyces cerevisiae YJR077c MIR1
           phosphate transport protein, mitochondrial (MCF), start
           by similarity
          Length = 305

 Score = 52.8 bits (125), Expect = 9e-08,   Method: Compositional matrix adjust.
 Identities = 53/188 (28%), Positives = 81/188 (43%), Gaps = 23/188 (12%)

Query: 122 AGIT-SSIVSYPFDVLRTRLVANNQMHSMSITREVRDIWKLEGLPGFFKGSIASMTTITL 180
            GIT SS+V  P DV++TR+     +++  +    + I   EG      G   ++   +L
Sbjct: 24  CGITHSSMV--PIDVVKTRIQLEPTVYNKGMVSSFKQIISSEGAGALLTGFGPTLLGYSL 81

Query: 181 TASIMFGTYETIR-IYCDENEKTTAAHKKWELATLNHSAGTIGGVIAKIITFPLETIRRR 239
             S  FG YE  + +  D      A + K    T+   +  I    A I   PLE  R R
Sbjct: 82  QGSFKFGGYELFKKLAIDNMGYDNAVNYK---NTIYIGSAAIAEFFADIALCPLEATRIR 138

Query: 240 MQFMNSKHLEKFSRHSSVYGSYKGYGFARIGLQILKQEGVSSLYRGILVALSKTIPTTFV 299
           +       + + +  + ++G     GF+RI    LK+EGV S Y G    L K IP    
Sbjct: 139 L-------VSQPTFANGLFG-----GFSRI----LKEEGVGSFYNGFTPILFKQIPYNIA 182

Query: 300 SFWGYETA 307
            F+ +E A
Sbjct: 183 KFFVFEHA 190

 Score = 44.7 bits (104), Expect = 4e-05,   Method: Compositional matrix adjust.
 Identities = 42/159 (26%), Positives = 70/159 (44%), Gaps = 11/159 (6%)

Query: 18  KTLLAGAVSGLLARSITAPMDTIKIRLQLTPANGLKPFGSQVMEVARSMIKNEGIRSFWK 77
           K  LAGA+   +  S   P+D +K R+QL P      +   ++   + +I +EG  +   
Sbjct: 15  KFALAGAIGCGITHSSMVPIDVVKTRIQLEPTV----YNKGMVSSFKQIISSEGAGALLT 70

Query: 78  GNIPGSLLYVTYGSAQFSSYSLFNRY-LTPFGLEARL---HSLVVG--AFAGITSSIVSY 131
           G  P  L Y   GS +F  Y LF +  +   G +  +   +++ +G  A A   + I   
Sbjct: 71  GFGPTLLGYSLQGSFKFGGYELFKKLAIDNMGYDNAVNYKNTIYIGSAAIAEFFADIALC 130

Query: 132 PFDVLRTRLVANNQMHSMSITREVRDIWKLEGLPGFFKG 170
           P +  R RLV+     +  +      I K EG+  F+ G
Sbjct: 131 PLEATRIRLVSQPTFAN-GLFGGFSRILKEEGVGSFYNG 168

 Score = 39.7 bits (91), Expect = 0.002,   Method: Compositional matrix adjust.
 Identities = 46/185 (24%), Positives = 74/185 (40%), Gaps = 23/185 (12%)

Query: 22  AGAVSGLLARSITAPMDTIKIRL--QLTPANGLKPFGSQVMEVARSMIKNEGIRSFWKGN 79
           + A++   A     P++  +IRL  Q T ANGL  FG         ++K EG+ SF+ G 
Sbjct: 117 SAAIAEFFADIALCPLEATRIRLVSQPTFANGL--FGG-----FSRILKEEGVGSFYNGF 169

Query: 80  IPGSLLYVTYGSAQFSSYS-LFNRYLTPFGLEARLHSLVVGAFAGITSS----------I 128
            P     + Y  A+F  +    N Y   FGL     ++       I  +          +
Sbjct: 170 TPILFKQIPYNIAKFFVFEHAANAY---FGLAGPKETMSETTHTAINLAAGLTAGLAAAV 226

Query: 129 VSYPFDVLRTRLVANNQMHSMSITREVRDIWKLEGLPGFFKGSIASMTTITLTASIMFGT 188
           VS P D L +++    +    S    +  + K  G  G F G    +  +    S+ FG 
Sbjct: 227 VSQPADTLLSKVNKTKKAPGQSTIGLLAQLAKQLGFVGSFTGLPTRLVMVGTLTSLQFGI 286

Query: 189 YETIR 193
           Y T++
Sbjct: 287 YGTLK 291

>YGR257C (MTM1) [2204] chr7 complement(1006210..1007310) Member of
           the mitochondrial carrier family (MCF) of membrane
           transporters [1101 bp, 366 aa]
          Length = 366

 Score = 53.1 bits (126), Expect = 1e-07,   Method: Compositional matrix adjust.
 Identities = 51/200 (25%), Positives = 90/200 (45%), Gaps = 36/200 (18%)

Query: 20  LLAGAVSGLLARSITAPMDTIKIRLQLTPANGLKP----FGSQVMEVARSMIKNEGI-RS 74
           L  GA++ + A +  AP++ +K +LQ  P +            ++   R  +K  G  R+
Sbjct: 162 LFCGAIARVFAATSIAPLELVKTKLQSIPRSSKSTKTWMMVKDLLNETRQEMKMVGPSRA 221

Query: 75  FWKG-------NIPGSLLYVTYGSAQFSSYSLFNRYL----TPFGLEAR-----LHSLVV 118
            +KG       ++P S +Y       +SSY L    L    T F  +       ++S   
Sbjct: 222 LFKGLEITLWRDVPFSAIY-------WSSYELCKERLWLDSTRFASKDANWVHFINSFAS 274

Query: 119 GAFAGITSSIVSYPFDVLRTRL---VANNQ-----MHSMSITREVRDIWKLEGLPGFFKG 170
           G  +G+ ++I ++PFDV +TR    + NN        S ++ + +  IW+ EGL   + G
Sbjct: 275 GCISGMIAAICTHPFDVGKTRWQISMMNNSDPKGGNRSRNMFKFLETIWRTEGLAALYTG 334

Query: 171 SIASMTTITLTASIMFGTYE 190
             A +  I  + +IM  +YE
Sbjct: 335 LAARVIKIRPSCAIMISSYE 354

 Score = 50.1 bits (118), Expect = 9e-07,   Method: Compositional matrix adjust.
 Identities = 58/255 (22%), Positives = 104/255 (40%), Gaps = 35/255 (13%)

Query: 70  EGIRSFWKG-------NIPGSLLYVTYGSAQFSSYSLFNRYLTPFGLE-ARLHSLVVGAF 121
           EGI S W+G        IP +++Y       FS Y  + R ++P       L+ L  GA 
Sbjct: 116 EGITSLWRGISLTLLMAIPANMVY-------FSGYE-YIRDVSPIASTYPTLNPLFCGAI 167

Query: 122 AGITSSIVSYPFDVLRTRLVA--------NNQMHSMSITREVRDIWKLEGLP-GFFKGSI 172
           A + ++    P ++++T+L +           M    +  E R   K+ G     FKG  
Sbjct: 168 ARVFAATSIAPLELVKTKLQSIPRSSKSTKTWMMVKDLLNETRQEMKMVGPSRALFKGLE 227

Query: 173 ASMTTITLTASIMFGTYETI--RIYCDENEKTTAAHKKWELATLNHSAGTIGGVIAKIIT 230
            ++      ++I + +YE    R++ D   +  +    W     + ++G I G+IA I T
Sbjct: 228 ITLWRDVPFSAIYWSSYELCKERLWLDST-RFASKDANWVHFINSFASGCISGMIAAICT 286

Query: 231 FPLETIRRRMQFMNSKHLEKFSRHSSVYGSYKGYGFARIGLQILKQEGVSSLYRGILVAL 290
            P +  + R Q            +S   G  +     +    I + EG+++LY G+   +
Sbjct: 287 HPFDVGKTRWQI-------SMMNNSDPKGGNRSRNMFKFLETIWRTEGLAALYTGLAARV 339

Query: 291 SKTIPTTFVSFWGYE 305
            K  P+  +    YE
Sbjct: 340 IKIRPSCAIMISSYE 354

 Score = 33.5 bits (75), Expect = 0.17,   Method: Compositional matrix adjust.
 Identities = 16/34 (47%), Positives = 21/34 (61%)

Query: 272 QILKQEGVSSLYRGILVALSKTIPTTFVSFWGYE 305
           +I   EG++SL+RGI + L   IP   V F GYE
Sbjct: 111 KIASVEGITSLWRGISLTLLMAIPANMVYFSGYE 144

>AFL196W [2999] [Homologous to ScYMR166C - SH]
           complement(66955..68040) [1086 bp, 361 aa]
          Length = 361

 Score = 52.0 bits (123), Expect = 2e-07,   Method: Compositional matrix adjust.
 Identities = 57/223 (25%), Positives = 95/223 (42%), Gaps = 20/223 (8%)

Query: 32  SITAPMDTIKIRLQLTPANGLKPFGSQVMEVARSMIKNEGIRSFWKGNIPGSLLYVTYGS 91
           S+   +DT+K R Q  P          ++   R++   EG+R    G   G+ +  ++ S
Sbjct: 69  SVMHSLDTVKTRQQGAPGEVKY---RHMISAYRTLALEEGVRRGLYGGY-GAAMLGSFPS 124

Query: 92  AQ--FSSYSLFNRYL-TPFGLEARLHSLVVGAFAGITSSIVSYPFDVLRTRLVAN---NQ 145
           A   F +Y    R +   + +      L  G    + SS+V  P +VL+TRL      N 
Sbjct: 125 AAVFFGTYEWVKRQMINEWQIHETYSHLAAGFLGDLFSSVVYVPSEVLKTRLQLQGCYNN 184

Query: 146 MHSMS------ITREVRDIWKLEGLPGFFKGSIASMTTITLTASIMFGTYETIRIYCDEN 199
            H  S      ++  VR I + EG+   F G  A+++     +++ F  YE  R +    
Sbjct: 185 RHFQSGYNYRGLSDAVRTIVRTEGVSALFFGYKATLSRDLPFSALQFAFYERFRKWAFLL 244

Query: 200 E-KTTAAHKKWELATLNHSAGTIGGVIAKIITFPLETIRRRMQ 241
           E K    H  +    +    G   G +A IIT PL+ ++ R+Q
Sbjct: 245 ERKPVDGHLSFTAEVVT---GASAGGLAGIITTPLDVVKTRIQ 284

 Score = 49.3 bits (116), Expect = 2e-06,   Method: Compositional matrix adjust.
 Identities = 51/201 (25%), Positives = 92/201 (45%), Gaps = 27/201 (13%)

Query: 113 LHSLVVGAFAGITSSIVSYPFDVLRTRLV-ANNQMHSMSITREVRDIWKLEGLP-GFFKG 170
           LH ++ G   G     V +  D ++TR   A  ++    +    R +   EG+  G + G
Sbjct: 54  LHCVLAGGIGGAIGDSVMHSLDTVKTRQQGAPGEVKYRHMISAYRTLALEEGVRRGLYGG 113

Query: 171 SIASMTTITLTASIMFGTYETI-RIYCDENEKTTAAHKKWEL-ATLNH-SAGTIGGVIAK 227
             A+M     +A++ FGTYE + R   +E          W++  T +H +AG +G + + 
Sbjct: 114 YGAAMLGSFPSAAVFFGTYEWVKRQMINE----------WQIHETYSHLAAGFLGDLFSS 163

Query: 228 IITFPLETIRRRMQFM---NSKHLEKFSRHSSVYGSYKGYGFARIGLQILKQEGVSSLYR 284
           ++  P E ++ R+Q     N++H +           Y   G +     I++ EGVS+L+ 
Sbjct: 164 VVYVPSEVLKTRLQLQGCYNNRHFQS---------GYNYRGLSDAVRTIVRTEGVSALFF 214

Query: 285 GILVALSKTIPTTFVSFWGYE 305
           G    LS+ +P + + F  YE
Sbjct: 215 GYKATLSRDLPFSALQFAFYE 235

 Score = 30.4 bits (67), Expect = 1.9,   Method: Compositional matrix adjust.
 Identities = 13/29 (44%), Positives = 19/29 (65%)

Query: 20  LLAGAVSGLLARSITAPMDTIKIRLQLTP 48
           ++ GA +G LA  IT P+D +K R+Q  P
Sbjct: 259 VVTGASAGGLAGIITTPLDVVKTRIQTQP 287

>CAGL0M05225g 563163..564308 highly similar to sp|P38127
           Saccharomyces cerevisiae YBR192w RIM2 mitochondrial
           carrier protein, start by similarity
          Length = 381

 Score = 51.6 bits (122), Expect = 3e-07,   Method: Compositional matrix adjust.
 Identities = 88/358 (24%), Positives = 144/358 (40%), Gaps = 81/358 (22%)

Query: 5   EDSLRKGQNVAAWKTLLAGAVSGLLARSITAPMDTIKIRLQLTPANGLKPFGSQ----VM 60
           +  L   + V  W   LAG + G+    +T P D +K RLQ      +  + SQ    +M
Sbjct: 45  QPKLEVHKTVKPWVHFLAGGIGGMAGAVVTCPFDLVKTRLQSDIYQNM--YKSQAEALMM 102

Query: 61  EVARSMIKN----------------------EGIRSFWKGNIPG--------SLLYVTYG 90
              R  I N                      EG RS +KG  P         S+ + TYG
Sbjct: 103 NTTRPRIVNLTLQAATHFKETVSIIGNVYRQEGFRSLFKGLGPNLVGVIPARSINFFTYG 162

Query: 91  SAQFSSYSLFNRYLTPFGLEARLHSLVVGAFAGITSSIVSYPFDVLRTRLVANNQMHSMS 150
           + +      FN      G EA    L+  A AG  ++  + P  +++TR+    Q+    
Sbjct: 163 TTKDIYSKAFNN-----GQEAPWIHLMAAATAGWATATATNPIWMVKTRV----QLDKAG 213

Query: 151 ITRE-------VRDIWKLEGLPGFFKGSIASMTTITLTASIMFGTYETIRIYC------- 196
            TR        ++ I + EG+ G ++G  AS    ++   + +  YE ++          
Sbjct: 214 KTRTYKNSYDCLKSILRNEGIYGLYRGLSASYLG-SVEGILQWLLYEQLKHLIKKRSIEK 272

Query: 197 ----DENEKTTAAH-KKWELATLNHSAGT-IGGVIAKIITFPLETIRRRMQFMNSKHLEK 250
               DE+  TT    K+W       S G  +   +A I+T+P E +R R++      LE 
Sbjct: 273 FGAHDESTMTTTDKIKQW----CQRSGGAGLAKFMASIVTYPHEVVRTRLR---QSPLEN 325

Query: 251 FSRHSSVYGSYKGYGFARIGLQILKQEGVSSLYRGILVALSKTIPTTFVSFWGYETAI 308
                   G  K  G  +    I+K+EG++S+Y G+   L +T+P + + F  +E  I
Sbjct: 326 --------GKVKYTGLVQSFRVIIKEEGLASMYSGLTPHLMRTVPNSIIMFGTWEVVI 375

>KLLA0A00979g complement(92561..93592) weakly similar to sp|P38152
           Saccharomyces cerevisiae YBR291c CTP1 citrate transport
           protein, mitochondrial (MCF), start by similarity
          Length = 343

 Score = 51.6 bits (122), Expect = 3e-07,   Method: Compositional matrix adjust.
 Identities = 29/140 (20%), Positives = 69/140 (49%), Gaps = 7/140 (5%)

Query: 57  SQVMEVARSMIKNEGIRSFWKGNIPGSLLYVTYGSAQFSSYSLFNRYLTPFGLEARLHSL 116
           + +    R M++  G  +F++G++P     V   + +F++Y+   + ++P    +  ++ 
Sbjct: 191 TNIFTTVREMVQTRGFTTFFQGSMPTIFRQVGNSAVRFTTYTTLKQMISPNKPLSEYYAF 250

Query: 117 VVGAFAGITSSIVSYPFDVLRTRLVANNQMHSMSITRE----VRDIWKLEGLPGFFKGSI 172
            +G F+      ++ P DV++TR+ +    ++ S+ R     V   +  EGL   +KG +
Sbjct: 251 GIGVFSSCAVVALTQPIDVVKTRMQSK---YTWSLYRNSLNCVYRTFIEEGLTSLWKGWV 307

Query: 173 ASMTTITLTASIMFGTYETI 192
             +  + L+  + FG Y+ +
Sbjct: 308 PRLFKVGLSGGVSFGVYQYV 327

 Score = 38.5 bits (88), Expect = 0.005,   Method: Compositional matrix adjust.
 Identities = 30/126 (23%), Positives = 55/126 (43%), Gaps = 10/126 (7%)

Query: 115 SLVVGAFAGITSSIVSYPFDVLRTRLVANNQMHSMSITREVRDIWKLEGLPGFFKGSIAS 174
           +L+ G+ A +  + +S+PF+ L+T      Q+H      E  +++    +  +F G  A 
Sbjct: 11  NLLAGSAAAVFQTTLSHPFEFLKT----GQQLHRSLPNAEAFNMF--HHVKSYFAGCSAL 64

Query: 175 MTTITLTASIMFGTYETIRIYCDENEKTTAAHKKWELATLNHSAGTIGGVIAKIITFPLE 234
              I L  +  F T++       + E   A      L     +AG+I G +  ++  P E
Sbjct: 65  NIGILLKTATRFATFDKACQLLKDPENPEAPVSGLRLI----AAGSITGFMESMLIIPFE 120

Query: 235 TIRRRM 240
            I+ RM
Sbjct: 121 NIKTRM 126

 Score = 34.3 bits (77), Expect = 0.10,   Method: Compositional matrix adjust.
 Identities = 40/160 (25%), Positives = 76/160 (47%), Gaps = 26/160 (16%)

Query: 148 SMSITREVRDIWKLEGLPGFFKGSIASMTTITLTASIMFGTYETIRIYCDENEKTTAAHK 207
           S +I   VR++ +  G   FF+GS+ ++      +++ F TY T++     N K  + + 
Sbjct: 190 STNIFTTVREMVQTRGFTTFFQGSMPTIFRQVGNSAVRFTTYTTLKQMISPN-KPLSEYY 248

Query: 208 KWELATLNHSAGTIGGVIAKIITFPLETIRRRMQFMNSKHLEKFSRHS--SVYGSYKGYG 265
            + +   +  A     V+A  +T P++ ++ RMQ   SK+     R+S   VY ++    
Sbjct: 249 AFGIGVFSSCA-----VVA--LTQPIDVVKTRMQ---SKYTWSLYRNSLNCVYRTF---- 294

Query: 266 FARIGLQILKQEGVSSLYRGILVALSKTIPTTFVSFWGYE 305
                     +EG++SL++G +  L K   +  VSF  Y+
Sbjct: 295 ---------IEEGLTSLWKGWVPRLFKVGLSGGVSFGVYQ 325

 Score = 31.2 bits (69), Expect = 0.92,   Method: Compositional matrix adjust.
 Identities = 19/59 (32%), Positives = 31/59 (52%), Gaps = 3/59 (5%)

Query: 23  GAVSGLLARSITAPMDTIKIRLQLTPANGLKPFGSQVMEVARSMIKNEGIRSFWKGNIP 81
           G  S     ++T P+D +K R+Q      L  + + +  V R+ I+ EG+ S WKG +P
Sbjct: 253 GVFSSCAVVALTQPIDVVKTRMQSKYTWSL--YRNSLNCVYRTFIE-EGLTSLWKGWVP 308

>YDL198C (GGC1) [676] chr4 complement(103650..104552) Member of the
           mitochondrial carrier (MCF) family of membrane
           transporters, overexpression suppresses loss of Abf2p
           [903 bp, 300 aa]
          Length = 300

 Score = 51.2 bits (121), Expect = 3e-07,   Method: Compositional matrix adjust.
 Identities = 52/183 (28%), Positives = 88/183 (48%), Gaps = 21/183 (11%)

Query: 3   KEEDSLRKGQNVAAWKTLLAGAVSGLLARSITAPMDTIKIRLQLTPANGLKPFGSQVMEV 62
           K+ D+L   +   A ++  AG++ G+    +  P+D +KI+ Q  P +  K  G   +++
Sbjct: 106 KDFDNLFGEKTGKAMRSAAAGSLIGI-GEIVLLPLDVLKIKRQTNPES-FK--GRGFIKI 161

Query: 63  ARSMIKNEGIRSFWKG-------NIPGSLLYVTYGSAQFS-SYSLFNRYLTPFGLEARLH 114
            R    +EG+ + ++G       N PGS  +  +G   F+  Y L  +  +         
Sbjct: 162 LR----DEGLFNLYRGWGWTAARNAPGS--FALFGGNAFAKEYILGLKDYSQATWSQNFI 215

Query: 115 SLVVGAFAGITSSIVSYPFDVLRTRLVANNQMHSMSITREVRDIWKLEGLPGFFKGSIAS 174
           S +VGA    +S IVS P DV++TR+   N  +  S  R V++  K EG+  FFKG    
Sbjct: 216 SSIVGA---CSSLIVSAPLDVIKTRIQNRNFDNPESGLRIVKNTLKNEGVTAFFKGLTPK 272

Query: 175 MTT 177
           + T
Sbjct: 273 LLT 275

 Score = 36.2 bits (82), Expect = 0.022,   Method: Compositional matrix adjust.
 Identities = 75/306 (24%), Positives = 116/306 (37%), Gaps = 59/306 (19%)

Query: 20  LLAGAVSGLLARSITAPMDTIKIRLQLTPANGLKPFGSQVMEVARSMIKNE-----GIRS 74
           LL  A +G++  ++  P+DTI  RL    +N  K    Q  E+ R + ++      G R 
Sbjct: 14  LLGSASAGIMEIAVFHPVDTISKRLM---SNHTKITSGQ--ELNRVIFRDHFSEPLGKRL 68

Query: 75  FWKGNIPGSLLYVT----------YGSAQFSSYSLFNRYLTPFG------LEARLHSLVV 118
           F     PG L Y            YG   F++  L   Y   F           + S   
Sbjct: 69  FTL--FPG-LGYAASYKVLQRVYKYGGQPFANEFLNKHYKKDFDNLFGEKTGKAMRSAAA 125

Query: 119 GAFAGITSSIVSYPFDVLRTRLVANNQ-MHSMSITREVRDIWKLEGLPGFFKGSIASMTT 177
           G+  GI   IV  P DVL+ +   N +        + +RD    EGL   ++G   +   
Sbjct: 126 GSLIGI-GEIVLLPLDVLKIKRQTNPESFKGRGFIKILRD----EGLFNLYRGWGWTAAR 180

Query: 178 ITLTASIMFGTYETIRIYCDENEKTTAAHKKWELAT--LNHSAGTIGGVIAKIITFPLET 235
               +  +FG     + Y           K +  AT   N  +  +G   + I++ PL+ 
Sbjct: 181 NAPGSFALFGGNAFAKEYI-------LGLKDYSQATWSQNFISSIVGACSSLIVSAPLDV 233

Query: 236 IRRRMQFMNSKHLEKFSRHSSVYGSYKGYGFARIGLQILKQEGVSSLYRGILVALSKTIP 295
           I+ R+Q  N  + E               G  RI    LK EGV++ ++G+   L  T P
Sbjct: 234 IKTRIQNRNFDNPES--------------GL-RIVKNTLKNEGVTAFFKGLTPKLLTTGP 278

Query: 296 TTFVSF 301
               SF
Sbjct: 279 KLVFSF 284

 Score = 34.3 bits (77), Expect = 0.099,   Method: Compositional matrix adjust.
 Identities = 49/203 (24%), Positives = 90/203 (44%), Gaps = 28/203 (13%)

Query: 110 EARLHSLVVGAFAGITSSIVSYPFDVLRTRLVANNQ--MHSMSITREV-RDIWKL---EG 163
           ++ L  L+  A AGI    V +P D +  RL++N+        + R + RD +     + 
Sbjct: 8   QSGLARLLGSASAGIMEIAVFHPVDTISKRLMSNHTKITSGQELNRVIFRDHFSEPLGKR 67

Query: 164 LPGFFKGSIASMTTITLTASIMFGTYETIRIYCDENEKTTAAH---KKWELATLNHSAGT 220
           L   F G   + +   L     +G       + +++ K    +   +K   A  + +AG+
Sbjct: 68  LFTLFPGLGYAASYKVLQRVYKYGGQPFANEFLNKHYKKDFDNLFGEKTGKAMRSAAAGS 127

Query: 221 IGGVIAKIITFPLETIRRRMQFMNSKHLEKFSRHSSVYGSYKGYGFARIGLQILKQEGVS 280
           + G I +I+  PL+ ++ + Q  N +             S+KG GF    ++IL+ EG+ 
Sbjct: 128 LIG-IGEIVLLPLDVLKIKRQ-TNPE-------------SFKGRGF----IKILRDEGLF 168

Query: 281 SLYRGILVALSKTIPTTFVSFWG 303
           +LYRG     ++  P +F  F G
Sbjct: 169 NLYRGWGWTAARNAPGSFALFGG 191

>Sklu_2127.4 , Contig c2127 6322-7293
          Length = 323

 Score = 51.2 bits (121), Expect = 4e-07,   Method: Compositional matrix adjust.
 Identities = 64/283 (22%), Positives = 115/283 (40%), Gaps = 23/283 (8%)

Query: 32  SITAPMDTIKIRLQLTPANGLKPFGSQVMEVARSMIKNEGIRSFWKGNIPGSLLYVTYGS 91
           ++T P+ TI  +LQ T  N         +E  + + + +G+  F+ G     L    YG 
Sbjct: 29  ALTYPLVTITTKLQ-TQGNDENNQVKSKLETIKEIYRKDGLLGFYAG-----LESAIYGM 82

Query: 92  A-----QFSSYSLFNRYLTPFGLEARLH---SLVVGAFAGITSSIVSYPFDVLRTRLVAN 143
           A      +  Y L +R +       +L+   S++ G  AG  ++I S P  V  TR+   
Sbjct: 83  ALTNFVYYYFYELTSRNVLKVRKHKKLNTLESMLTGCVAGSVTAIASNPIWVANTRMTVT 142

Query: 144 NQMHSMSITREVRDIWKLEGLPGFFKGSIASMTTITLTASIMFGTYETIRIYCDENEKTT 203
               +   T  + +I K +     F G +     + +   + +  +E ++       K  
Sbjct: 143 KSEKTALAT--IIEIVKKDSAKTLFNG-LKPALVLVMNPIVQYTVFEQLKNLVLAWNKQG 199

Query: 204 AAHKKWELATLNHSAGTIGGVIAKIITFPLETIRRRMQFMNS-KHLEKFSRHSSVYGSYK 262
                W         G +G + A   T+P  T++ RM    S KH +  S   +      
Sbjct: 200 ILSPSWAFLL-----GALGKLAATGSTYPYITLKTRMHLSESGKHTDDDSGKKAKGHKAS 254

Query: 263 GYGFARIGLQILKQEGVSSLYRGILVALSKTIPTTFVSFWGYE 305
                 +  +I+K++GVS LYRG+ + L+++I T    F+  E
Sbjct: 255 SKSMLSLITEIVKKDGVSGLYRGVGIKLAQSILTAAFLFFFKE 297

>Sklu_2075.3 , Contig c2075 6414-7451 reverse complement
          Length = 345

 Score = 50.8 bits (120), Expect = 5e-07,   Method: Compositional matrix adjust.
 Identities = 39/164 (23%), Positives = 76/164 (46%), Gaps = 12/164 (7%)

Query: 19  TLLAGAVSGLLARSITAPMDTIKIRLQLTPANGLKPFGSQVMEVARSMIKNEGIRSFWKG 78
            +++G ++G     I AP++  K +LQ+        +   V +V + +  + G+R  +KG
Sbjct: 161 CIISGVMAGWSVSFIAAPVELAKAKLQVQYDAKTTKYTGPV-DVIKKVYSSNGVRGLYKG 219

Query: 79  NIPGSLLYVTYGSAQFSSYSLFNRYLTPFGLEARLHSLVVGAFAGITSS-----IVSYPF 133
            +  +L++ T     + SY L  R+   F     +    +  ++G  S+       +YP 
Sbjct: 220 -LTSTLIFRTNFVFWWGSYELLTRW---FKEHTNMSDTAINFWSGGFSASFGFWTTAYPS 275

Query: 134 DVLRTRLVANNQMHSM--SITREVRDIWKLEGLPGFFKGSIASM 175
           DV++  ++ N++      S     +DIW+  G  GFFKG + S 
Sbjct: 276 DVIKQVVLCNDKYDGTFRSWKLAAKDIWRTRGYRGFFKGFVPSF 319

 Score = 48.5 bits (114), Expect = 3e-06,   Method: Compositional matrix adjust.
 Identities = 50/205 (24%), Positives = 80/205 (39%), Gaps = 35/205 (17%)

Query: 111 ARLHSLVVGAFAGITSSIVSYPFDVLRTRL-VANNQMHSMSITREVRDIWKLEGLPGFFK 169
           +R+   V G F+GI  + V +PFD ++ RL  + +          V   +  +G+ GF+ 
Sbjct: 59  SRIMGFVSGMFSGIAKNAVGHPFDTIKVRLQTSQDSTRFKGPLDCVYKTFTQQGIRGFYL 118

Query: 170 GSIASMTTITLTASIMFGTYETIRI----YCDENEKTTAAHKKWELATLNHSAGTIGGVI 225
           G    +    L  S+M G     R+    Y   NE+            L  S   I GV+
Sbjct: 119 GFTPPLVGWILMDSVMLGCLHNYRMLLKKYVYYNEE-----------KLPLSGCIISGVM 167

Query: 226 A----KIITFPLETIRRRMQFMNSKHLEKFSRHSSVYGSYKGYGFARIGLQILKQEGVSS 281
           A      I  P+E  + ++Q        K++            G   +  ++    GV  
Sbjct: 168 AGWSVSFIAAPVELAKAKLQVQYDAKTTKYT------------GPVDVIKKVYSSNGVRG 215

Query: 282 LYRGILVALSKTIPTTFVSFWG-YE 305
           LY+G+   L     T FV +WG YE
Sbjct: 216 LYKGLTSTL--IFRTNFVFWWGSYE 238

 Score = 42.0 bits (97), Expect = 4e-04,   Method: Compositional matrix adjust.
 Identities = 40/188 (21%), Positives = 79/188 (42%), Gaps = 12/188 (6%)

Query: 20  LLAGAVSGLLARSITAPMDTIKIRLQLTPANGLKPFGSQVMEVARSMIKNEGIRSFWKGN 79
            ++G  SG+   ++  P DTIK+RLQ T  +  +  G   ++        +GIR F+ G 
Sbjct: 64  FVSGMFSGIAKNAVGHPFDTIKVRLQ-TSQDSTRFKGP--LDCVYKTFTQQGIRGFYLGF 120

Query: 80  IPGSLLYVTYGSAQFSSYSLFNRYLTPFGL--EARLH---SLVVGAFAGITSSIVSYPFD 134
            P  + ++   S        +   L  +    E +L     ++ G  AG + S ++ P +
Sbjct: 121 TPPLVGWILMDSVMLGCLHNYRMLLKKYVYYNEEKLPLSGCIISGVMAGWSVSFIAAPVE 180

Query: 135 VLRTRLVANNQMHSMSITREV---RDIWKLEGLPGFFKGSIASMTTITLTASIMFGTYET 191
           + + +L       +   T  V   + ++   G+ G +KG + S           +G+YE 
Sbjct: 181 LAKAKLQVQYDAKTTKYTGPVDVIKKVYSSNGVRGLYKG-LTSTLIFRTNFVFWWGSYEL 239

Query: 192 IRIYCDEN 199
           +  +  E+
Sbjct: 240 LTRWFKEH 247

>CAGL0J09790g complement(957759..958661) highly similar to sp|P38988
           Saccharomyces cerevisiae YDL198c YHM1, start by
           similarity
          Length = 300

 Score = 50.4 bits (119), Expect = 6e-07,   Method: Compositional matrix adjust.
 Identities = 53/183 (28%), Positives = 86/183 (46%), Gaps = 21/183 (11%)

Query: 3   KEEDSLRKGQNVAAWKTLLAGAVSGLLARSITAPMDTIKIRLQLTPANGLKPFGSQVMEV 62
           K+ DS    +   A ++  AG++ G+    +  P+D +KI+ Q  P    K  G   +++
Sbjct: 106 KDFDSAFGDKTGKALRSATAGSLIGI-GEIVLLPLDVLKIKRQTNP-EAFK--GRGFLKI 161

Query: 63  ARSMIKNEGIRSFWKG-------NIPGSLLYVTYGSAQFS-SYSLFNRYLTPFGLEARLH 114
               +K+EGI + ++G       N PGS  +  +G   F+  Y L  +  +         
Sbjct: 162 ----LKDEGIFNLYRGWGWTAARNAPGS--FALFGGNAFAKEYILGLQDYSQATWSQNFI 215

Query: 115 SLVVGAFAGITSSIVSYPFDVLRTRLVANNQMHSMSITREVRDIWKLEGLPGFFKGSIAS 174
           S +VGA A   S IVS P DV++TR+   N  +  S  + V++  K EG   FFKG    
Sbjct: 216 SSIVGASA---SLIVSAPLDVIKTRIQNRNFDNPESGFKIVKNTLKNEGFTAFFKGLTPK 272

Query: 175 MTT 177
           + T
Sbjct: 273 LLT 275

 Score = 36.2 bits (82), Expect = 0.022,   Method: Compositional matrix adjust.
 Identities = 77/313 (24%), Positives = 125/313 (39%), Gaps = 54/313 (17%)

Query: 9   RKGQNVAAWKTLLAGAVSGLLARSITAPMDTIKIRLQLTPANGLK-PFGSQVMEVARSMI 67
           RK   VA    LL  A +G+L   +  P+DTI  RL    +N  K   G+Q+  V   + 
Sbjct: 6   RKQSGVA---RLLGSASAGILEIGVFHPVDTISKRLM---SNHTKITSGAQLNSV---IF 56

Query: 68  KNEGIRSFWKGNI---PG---SLLY------VTYGSAQFSSYSLFNRYL-----TPFGLE 110
           ++    +F K      PG   + +Y        YG   F++    N++      + FG +
Sbjct: 57  RDHAAEAFGKRVFTLFPGLGYAAVYKILQRVYKYGGQPFAN-EFLNKHFKKDFDSAFGDK 115

Query: 111 A--RLHSLVVGAFAGITSSIVSYPFDVLRTRLVANNQMHSMSITREVRDIWKLEGLPGFF 168
               L S   G+  GI   IV  P DVL+ +   N +       R    I K EG+   +
Sbjct: 116 TGKALRSATAGSLIGI-GEIVLLPLDVLKIKRQTNPEAFK---GRGFLKILKDEGIFNLY 171

Query: 169 KGSIASMTTITLTASIMFGTYETIRIYCDENEKTTAAHKKWELATLNHSAGTIGGVIAKI 228
           +G   +       +  +FG     + Y    +  + A   W   + N  +  +G   + I
Sbjct: 172 RGWGWTAARNAPGSFALFGGNAFAKEYILGLQDYSQA--TW---SQNFISSIVGASASLI 226

Query: 229 ITFPLETIRRRMQFMNSKHLEKFSRHSSVYGSYKGYGFARIGLQILKQEGVSSLYRGILV 288
           ++ PL+ I+ R+Q  N  + E               GF +I    LK EG ++ ++G+  
Sbjct: 227 VSAPLDVIKTRIQNRNFDNPES--------------GF-KIVKNTLKNEGFTAFFKGLTP 271

Query: 289 ALSKTIPTTFVSF 301
            L  T P    SF
Sbjct: 272 KLLTTGPKLVFSF 284

 Score = 35.4 bits (80), Expect = 0.042,   Method: Compositional matrix adjust.
 Identities = 27/87 (31%), Positives = 45/87 (51%), Gaps = 19/87 (21%)

Query: 217 SAGTIGGVIAKIITFPLETIRRRMQFMNSKHLEKFSRHSSVYGSYKGYGFARIGLQILKQ 276
           +AG++ G I +I+  PL+ ++ + Q  N +             ++KG GF    L+ILK 
Sbjct: 124 TAGSLIG-IGEIVLLPLDVLKIKRQ-TNPE-------------AFKGRGF----LKILKD 164

Query: 277 EGVSSLYRGILVALSKTIPTTFVSFWG 303
           EG+ +LYRG     ++  P +F  F G
Sbjct: 165 EGIFNLYRGWGWTAARNAPGSFALFGG 191

>CAGL0F00231g 29705..30628 highly similar to sp|P23641 Saccharomyces
           cerevisiae YJR077c MIR1, hypothetical start
          Length = 307

 Score = 50.4 bits (119), Expect = 6e-07,   Method: Compositional matrix adjust.
 Identities = 50/183 (27%), Positives = 78/183 (42%), Gaps = 22/183 (12%)

Query: 126 SSIVSYPFDVLRTRLVANNQMHSMSITREVRDIWKLEGLPGFFKGSIASMTTITLTASIM 185
           SS+V  P DV++TR+     +++  +    R I   EG      G   ++   ++  +  
Sbjct: 29  SSMV--PIDVVKTRIQLEPTVYNKGMVGSFRKIIAEEGAGALLTGFGPTLLGYSIQGAFK 86

Query: 186 FGTYETIR-IYCDENEKTTAAHKKWELATLNHSAGTIGGVIAKIITFPLETIRRRMQFMN 244
           FG YE  +  + D     TAA  K  +   + +A      +A I   PLE  R R+    
Sbjct: 87  FGGYEVFKKFFIDTLGYDTAARYKNSVYIGSAAAAEF---LADIALCPLEATRIRL---- 139

Query: 245 SKHLEKFSRHSSVYGSYKGYGFARIGLQILKQEGVSSLYRGILVALSKTIPTTFVSFWGY 304
              + + +  + + G     GF+RI    LK+EGV S Y G    L K IP     F  +
Sbjct: 140 ---VSQPTFANGLVG-----GFSRI----LKEEGVGSFYSGFTPILFKQIPYNIAKFLVF 187

Query: 305 ETA 307
           E A
Sbjct: 188 ERA 190

 Score = 44.7 bits (104), Expect = 5e-05,   Method: Compositional matrix adjust.
 Identities = 44/159 (27%), Positives = 69/159 (43%), Gaps = 11/159 (6%)

Query: 18  KTLLAGAVSGLLARSITAPMDTIKIRLQLTPANGLKPFGSQVMEVARSMIKNEGIRSFWK 77
           K  LAGA+      S   P+D +K R+QL P      +   ++   R +I  EG  +   
Sbjct: 15  KFALAGAIGCGSTHSSMVPIDVVKTRIQLEPTV----YNKGMVGSFRKIIAEEGAGALLT 70

Query: 78  GNIPGSLLYVTYGSAQFSSYSLFNRYLTP---FGLEARL-HSLVVG--AFAGITSSIVSY 131
           G  P  L Y   G+ +F  Y +F ++      +   AR  +S+ +G  A A   + I   
Sbjct: 71  GFGPTLLGYSIQGAFKFGGYEVFKKFFIDTLGYDTAARYKNSVYIGSAAAAEFLADIALC 130

Query: 132 PFDVLRTRLVANNQMHSMSITREVRDIWKLEGLPGFFKG 170
           P +  R RLV+     +  +    R I K EG+  F+ G
Sbjct: 131 PLEATRIRLVSQPTFANGLVGGFSR-ILKEEGVGSFYSG 168

 Score = 44.3 bits (103), Expect = 6e-05,   Method: Compositional matrix adjust.
 Identities = 47/180 (26%), Positives = 79/180 (43%), Gaps = 17/180 (9%)

Query: 24  AVSGLLARSITAPMDTIKIRL--QLTPANGLKPFGSQVMEVARSMIKNEGIRSFWKGNIP 81
           A +  LA     P++  +IRL  Q T ANGL      V   +R ++K EG+ SF+ G  P
Sbjct: 119 AAAEFLADIALCPLEATRIRLVSQPTFANGL------VGGFSR-ILKEEGVGSFYSGFTP 171

Query: 82  GSLLYVTYGSAQFSSYS----LFNRYLTPFGLEARLH----SLVVGAFAGITSSIVSYPF 133
                + Y  A+F  +     L+     P    ++      +L+ G  AG+ ++IVS P 
Sbjct: 172 ILFKQIPYNIAKFLVFERASELYFSLAPPKDTLSQTSLTAINLLSGLTAGLAAAIVSQPA 231

Query: 134 DVLRTRLVANNQMHSMSITREVRDIWKLEGLPGFFKGSIASMTTITLTASIMFGTYETIR 193
           D L +++   ++    S    +  + K  G  G F G    +  +    S+ FG Y  ++
Sbjct: 232 DTLLSKVNKTSKAPGQSTVGLLFQLAKQLGFVGSFAGLPTRLVMVGTLTSLQFGIYGQLK 291

>Sklu_2260.5 YER053C, Contig c2260 6981-7889 reverse complement
          Length = 302

 Score = 50.1 bits (118), Expect = 7e-07,   Method: Compositional matrix adjust.
 Identities = 50/192 (26%), Positives = 73/192 (38%), Gaps = 27/192 (14%)

Query: 122 AGITSSIVSYPFDVLRTRLVANNQMHSMSITREVRDIWKL----EGLPGFFKGSIASMTT 177
            G T S V+ P D+++ RL  N Q++     R   D WK     EGL   F G  A+   
Sbjct: 26  CGPTHSSVT-PLDLVKCRLQVNPQLY-----RSNLDGWKTIVRSEGLSKVFTGVGATFIG 79

Query: 178 ITLTASIMFGTYETIRIYCDENEKTTAAHKKWELATLNHSAGTIGGVIAKIITFPLETIR 237
            +L  +  +G YE  +           AH+      L  SA      +A I+  P E I+
Sbjct: 80  YSLQGACKYGGYEYFKQTYSNLLSPETAHRHRTAVYLCASAS--AEFLADILLCPWEAIK 137

Query: 238 RRMQFMNSKHLEKFSRHSSVYGSYKGYGFARIGLQILKQEGVSSLYRGILVALSKTIPTT 297
            + Q       + F    S               +I   EG+S LY+GI     + IP T
Sbjct: 138 VKQQTTIPPFCKNFLEGWS---------------KITAAEGLSGLYKGITPLWCRQIPYT 182

Query: 298 FVSFWGYETAIH 309
              F  +E  + 
Sbjct: 183 MCKFTSFERIVE 194

 Score = 49.3 bits (116), Expect = 1e-06,   Method: Compositional matrix adjust.
 Identities = 44/185 (23%), Positives = 78/185 (42%), Gaps = 14/185 (7%)

Query: 20  LLAGAVSGLLARSITAPMDTIKIRLQLTPANGLKPFGSQVMEVARSMIKNEGIRSFWKGN 79
           L A A +  LA  +  P + IK++ Q T    + PF    +E    +   EG+   +KG 
Sbjct: 116 LCASASAEFLADILLCPWEAIKVKQQTT----IPPFCKNFLEGWSKITAAEGLSGLYKGI 171

Query: 80  IPGSLLYVTYGSAQFSS--------YSLFNRYLTPFGLEARLH-SLVVGAFAGITSSIVS 130
            P     + Y   +F+S        Y+   R         ++  S V G  AGI  ++VS
Sbjct: 172 TPLWCRQIPYTMCKFTSFERIVEMIYAKLPRSKQEMSPSQQIGVSFVGGYLAGILCAVVS 231

Query: 131 YPFDVLRTRLVANNQMHSMSITREVRDIWKLEGLPGFFKGSIASMTTITLTASIMFGTYE 190
           +P DV+ +++ A+ +    S+    + I+   G  G + G    +  I    S  +  Y+
Sbjct: 232 HPADVMVSKVNADRK-QGESMVEASKRIYSRIGFGGLWNGLPVRIFMIGTLTSFQWLIYD 290

Query: 191 TIRIY 195
           + + Y
Sbjct: 291 SFKAY 295

 Score = 34.3 bits (77), Expect = 0.11,   Method: Compositional matrix adjust.
 Identities = 31/156 (19%), Positives = 60/156 (38%), Gaps = 11/156 (7%)

Query: 21  LAGAVSGLLARSITAPMDTIKIRLQLTPANGLKPFGSQVMEVARSMIKNEGIRSFWKGNI 80
           L G V+     S   P+D +K RLQ+ P           ++  ++++++EG+   + G  
Sbjct: 20  LGGVVACGPTHSSVTPLDLVKCRLQVNPQ-----LYRSNLDGWKTIVRSEGLSKVFTGVG 74

Query: 81  PGSLLYVTYGSAQFSSYSLFNRYLTPFGLEARLHS------LVVGAFAGITSSIVSYPFD 134
              + Y   G+ ++  Y  F +  +        H       L   A A   + I+  P++
Sbjct: 75  ATFIGYSLQGACKYGGYEYFKQTYSNLLSPETAHRHRTAVYLCASASAEFLADILLCPWE 134

Query: 135 VLRTRLVANNQMHSMSITREVRDIWKLEGLPGFFKG 170
            ++ +          +       I   EGL G +KG
Sbjct: 135 AIKVKQQTTIPPFCKNFLEGWSKITAAEGLSGLYKG 170

>CAGL0F08305g complement(827705..828829) similar to sp|P53320
           Saccharomyces cerevisiae YGR257c, start by similarity
          Length = 374

 Score = 50.4 bits (119), Expect = 8e-07,   Method: Compositional matrix adjust.
 Identities = 60/259 (23%), Positives = 114/259 (44%), Gaps = 18/259 (6%)

Query: 60  MEVARSMIKNEGIRSFWKGNIPGSLLYVTYGSAQFSSYSLFNRYLTPF-GLEARLHSLVV 118
           +E    + K EG+ + W+G     L+ +      F+ Y  + R  +P  GL   ++ L+ 
Sbjct: 114 LEAFEKIAKFEGVTTLWRGISITLLMAIPANVVYFTGYE-YVRDRSPLNGLYPTINPLIC 172

Query: 119 GAFAGITSSIVSYPFDVLRTRL--VANNQMHSMSIT------REVRDIWKLEGLPG-FFK 169
           GAFA   ++    P ++++T+L  + ++ M + S+        E++    + G+    FK
Sbjct: 173 GAFARTLAATSVAPLELIKTKLQSIPSSSMKNGSVIMYRDLFNEIKSEIAMRGVAQTMFK 232

Query: 170 GSIASMTTITLTASIMFGTYETIRIYCDENEKTT--AAHKKWELATLNHSAGTIGGVIAK 227
           G   ++      ++I + +YE  +        +T       W   T +   G I G +A 
Sbjct: 233 GLEITLWRDVPFSAIYWASYEFYKTKVAYLSPSTFDKNSSNWFHFTNSFLGGFISGSLAA 292

Query: 228 IITFPLETIRRRMQFMNSKHLEKFSRHSSVYGSYKG-YGFARIGLQILKQEGVSSLYRGI 286
           I T P +  + R Q ++    +K +  +  YGS    +GF      I K EG+ +LY G+
Sbjct: 293 ICTHPFDVGKTRQQ-ISLVTDKKLANSNLKYGSSNTMFGFLNY---IRKTEGIGALYTGL 348

Query: 287 LVALSKTIPTTFVSFWGYE 305
              ++K  P+  +    YE
Sbjct: 349 APRVAKIAPSCAIMISSYE 367

 Score = 49.7 bits (117), Expect = 1e-06,   Method: Compositional matrix adjust.
 Identities = 53/205 (25%), Positives = 95/205 (46%), Gaps = 41/205 (20%)

Query: 20  LLAGAVSGLLARSITAPMDTIKIRLQLTPANGLKPFGSQVME---------------VAR 64
           L+ GA +  LA +  AP++ IK +LQ  P++ +K  GS +M                VA+
Sbjct: 170 LICGAFARTLAATSVAPLELIKTKLQSIPSSSMKN-GSVIMYRDLFNEIKSEIAMRGVAQ 228

Query: 65  SMIKNEGIRSFWKGNIPGSLLYVTYGSAQFSSYSLFNRYLTPFGLEAR-------LHSLV 117
           +M K   I + W+ ++P S +Y  + S +F  Y     YL+P   +          +S +
Sbjct: 229 TMFKGLEI-TLWR-DVPFSAIY--WASYEF--YKTKVAYLSPSTFDKNSSNWFHFTNSFL 282

Query: 118 VGAFAGITSSIVSYPFDVLRTR----LVANNQMHSMSITREVRD--------IWKLEGLP 165
            G  +G  ++I ++PFDV +TR    LV + ++ + ++     +        I K EG+ 
Sbjct: 283 GGFISGSLAAICTHPFDVGKTRQQISLVTDKKLANSNLKYGSSNTMFGFLNYIRKTEGIG 342

Query: 166 GFFKGSIASMTTITLTASIMFGTYE 190
             + G    +  I  + +IM  +YE
Sbjct: 343 ALYTGLAPRVAKIAPSCAIMISSYE 367

>AGL064W [4247] [Homologous to ScYBR291C (CTP1) - SH]
           complement(587623..588513) [891 bp, 296 aa]
          Length = 296

 Score = 50.1 bits (118), Expect = 8e-07,   Method: Compositional matrix adjust.
 Identities = 29/86 (33%), Positives = 48/86 (55%), Gaps = 4/86 (4%)

Query: 12  QNVAAWKTLLAGAVSGLLARSITAPMDTIKIRLQLTPANGLKPFGSQVMEVARSMIKNEG 71
           Q + + +T L GA+SG++    T P+DT+K R+Q   A     +GS V    R++++ EG
Sbjct: 207 QPLGSGQTFLVGALSGIVTVYATMPVDTVKTRMQALDA---ARYGSTV-GCFRAVVREEG 262

Query: 72  IRSFWKGNIPGSLLYVTYGSAQFSSY 97
           +R+ W+G  P     V  G   F++Y
Sbjct: 263 VRALWRGATPRLGRLVLSGGIVFTAY 288

 Score = 41.6 bits (96), Expect = 4e-04,   Method: Compositional matrix adjust.
 Identities = 20/79 (25%), Positives = 40/79 (50%)

Query: 114 HSLVVGAFAGITSSIVSYPFDVLRTRLVANNQMHSMSITREVRDIWKLEGLPGFFKGSIA 173
            + +VGA +GI +   + P D ++TR+ A +     S     R + + EG+   ++G+  
Sbjct: 213 QTFLVGALSGIVTVYATMPVDTVKTRMQALDAARYGSTVGCFRAVVREEGVRALWRGATP 272

Query: 174 SMTTITLTASIMFGTYETI 192
            +  + L+  I+F  YE +
Sbjct: 273 RLGRLVLSGGIVFTAYEKL 291

 Score = 38.1 bits (87), Expect = 0.005,   Method: Compositional matrix adjust.
 Identities = 58/288 (20%), Positives = 108/288 (37%), Gaps = 38/288 (13%)

Query: 32  SITAPMDTIKIRLQLTPANGLKPFGSQVM--EVARSMIKNE---GIRSFWKGNIPGSLLY 86
            +T P +  K RLQL      +     V+    AR+        G  +F  GN       
Sbjct: 26  CVTYPFEFAKTRLQLAQQGSGESRNPLVLLYRTARTQGAGALYVGCPAFVVGN------- 78

Query: 87  VTYGSAQFSSYSLFNRYLTP-FGLEARLHSLVVGAFAGITSSIVSY-PFDVLRTRLVANN 144
                 +F  +    R L    G  +    ++ G  AG+  S+++  PF+ ++T L+ + 
Sbjct: 79  TCKAGVRFLGFDALRRALQDERGALSGPRGMLAGLGAGLLESVLAVTPFEAVKTALIDDR 138

Query: 145 QMHSMSITREVRDIWKLEGLPGFFKGSIASMTTITLTA-------SIMFGTYETIRIYCD 197
           Q          R   +   L     G       +   A       ++ FG Y  ++    
Sbjct: 139 QAARPRYQHNGRGAARNYALLLRELGLRGLYGGLVPVALRQASNQAVRFGCYTQLKQAVQ 198

Query: 198 ENEKTTAAHKKWELATLNHSAGTIGGVIAKIITFPLETIRRRMQFMNSKHLEKFSRHSSV 257
               T A        T     G + G++    T P++T++ RMQ +++      +R+ S 
Sbjct: 199 RYAGTPADQPLGSGQTF--LVGALSGIVTVYATMPVDTVKTRMQALDA------ARYGST 250

Query: 258 YGSYKGYGFARIGLQILKQEGVSSLYRGILVALSKTIPTTFVSFWGYE 305
            G ++          ++++EGV +L+RG    L + + +  + F  YE
Sbjct: 251 VGCFRA---------VVREEGVRALWRGATPRLGRLVLSGGIVFTAYE 289

>YJR077C (MIR1) [2970] chr10 complement(577169..578104) Phosphate
           transporter of the mitochondrial carrier (MCF) family
           [936 bp, 311 aa]
          Length = 311

 Score = 50.1 bits (118), Expect = 8e-07,   Method: Compositional matrix adjust.
 Identities = 49/180 (27%), Positives = 81/180 (45%), Gaps = 17/180 (9%)

Query: 24  AVSGLLARSITAPMDTIKIRLQLTP--ANGLKPFGSQVMEVARSMIKNEGIRSFWKGNIP 81
           A++  LA     P++  +IRL   P  ANGL      V   +R ++K EGI SF+ G  P
Sbjct: 123 AMAEFLADIALCPLEATRIRLVSQPQFANGL------VGGFSR-ILKEEGIGSFYSGFTP 175

Query: 82  GSLLYVTYGSAQFSSYSLFNRYLTPF-GLEARLHS-------LVVGAFAGITSSIVSYPF 133
                + Y  A+F  +   + +   F G + +L S       L+ G  AG+ ++IVS P 
Sbjct: 176 ILFKQIPYNIAKFLVFERASEFYYGFAGPKEKLSSTSTTLLNLLSGLTAGLAAAIVSQPA 235

Query: 134 DVLRTRLVANNQMHSMSITREVRDIWKLEGLPGFFKGSIASMTTITLTASIMFGTYETIR 193
           D L +++    +    S    +  + K  G  G F G    +  +    S+ FG Y +++
Sbjct: 236 DTLLSKVNKTKKAPGQSTVGLLAQLAKQLGFFGSFAGLPTRLVMVGTLTSLQFGIYGSLK 295

 Score = 48.9 bits (115), Expect = 2e-06,   Method: Compositional matrix adjust.
 Identities = 48/186 (25%), Positives = 76/186 (40%), Gaps = 28/186 (15%)

Query: 126 SSIVSYPFDVLRTRLVANNQMHSMSITREVRDIWKLEGLPGFFKGSIASMTTITLTASIM 185
           SS+V  P DV++TR+     +++  +    + I   EG      G   ++   ++  +  
Sbjct: 33  SSMV--PIDVVKTRIQLEPTVYNKGMVGSFKQIIAGEGAGALLTGFGPTLLGYSIQGAFK 90

Query: 186 FGTYETIRIYCDENEKTTAAHKKWELATLNHSAGTIGGVIAKIITFPLETIRRRM----Q 241
           FG YE  + +  +N     A +      +  +A  +   +A I   PLE  R R+    Q
Sbjct: 91  FGGYEVFKKFFIDNLGYDTASRYKNSVYMGSAA--MAEFLADIALCPLEATRIRLVSQPQ 148

Query: 242 FMNSKHLEKFSRHSSVYGSYKGYGFARIGLQILKQEGVSSLYRGILVALSKTIPTTFVSF 301
           F N            + G     GF+RI    LK+EG+ S Y G    L K IP     F
Sbjct: 149 FANG-----------LVG-----GFSRI----LKEEGIGSFYSGFTPILFKQIPYNIAKF 188

Query: 302 WGYETA 307
             +E A
Sbjct: 189 LVFERA 194

 Score = 46.2 bits (108), Expect = 2e-05,   Method: Compositional matrix adjust.
 Identities = 60/271 (22%), Positives = 106/271 (39%), Gaps = 40/271 (14%)

Query: 17  WKTLLAGAVSGLLARSITAPMDTIKIRLQLTPANGLKPFGSQVMEVARSMIKNEGIRSFW 76
            K  LAGA+      S   P+D +K R+QL P      +   ++   + +I  EG  +  
Sbjct: 18  MKFALAGAIGCGSTHSSMVPIDVVKTRIQLEPTV----YNKGMVGSFKQIIAGEGAGALL 73

Query: 77  KGNIPGSLLYVTYGSAQFSSYSLFNRYLTP---FGLEARL-HSLVVG--AFAGITSSIVS 130
            G  P  L Y   G+ +F  Y +F ++      +   +R  +S+ +G  A A   + I  
Sbjct: 74  TGFGPTLLGYSIQGAFKFGGYEVFKKFFIDNLGYDTASRYKNSVYMGSAAMAEFLADIAL 133

Query: 131 YPFDVLRTRLVANNQMHSMSITREVRDIWKLEGLPGFFKG-----------SIASMTTIT 179
            P +  R RLV+  Q  +  +    R I K EG+  F+ G           +IA      
Sbjct: 134 CPLEATRIRLVSQPQFANGLVGGFSR-ILKEEGIGSFYSGFTPILFKQIPYNIAKFLVFE 192

Query: 180 LTASIMFGTYETIRIYCDENEKTTAAHKKWELATLNHSAGTIGGVIAKIITFPLETIRRR 239
             +   +G       +    EK ++         LN  +G   G+ A I++ P +T+  +
Sbjct: 193 RASEFYYG-------FAGPKEKLSSTSTTL----LNLLSGLTAGLAAAIVSQPADTLLSK 241

Query: 240 MQFMNSKH-------LEKFSRHSSVYGSYKG 263
           +              L + ++    +GS+ G
Sbjct: 242 VNKTKKAPGQSTVGLLAQLAKQLGFFGSFAG 272

>Scas_687.15*
          Length = 328

 Score = 50.1 bits (118), Expect = 8e-07,   Method: Compositional matrix adjust.
 Identities = 33/155 (21%), Positives = 74/155 (47%), Gaps = 8/155 (5%)

Query: 57  SQVMEVARSMIKNEGIRSFWKGNIPGSLLYVTYGSAQFSSYSLFNRYLTPFGLEARLHSL 116
           S +  V + +    G+R F +G +P     V+  + +F++Y+   + ++P      +++ 
Sbjct: 178 SNIFSVVKEIYLTRGLRGFAQGAMPTVFRQVSNSTVRFTAYTTLKQLISPTQPLNEVYAF 237

Query: 117 VVGAFAGITSSIVSYPFDVLRTRLVAN--NQMHSMSITREVRDIWKLEGLPGFFKGSIAS 174
            +G F+      ++ P DV++TR+ +   +  +  S+    R ++  EG+   +KG +  
Sbjct: 238 GIGLFSSCAVVALTQPIDVVKTRMQSKTAHYFYKNSLNCAYR-VFVEEGMVSLWKGWLPR 296

Query: 175 MTTITLTASIMFGTYETIRIYCDENEKTTAAHKKW 209
           +  + L+  I FG Y+ +     EN   T   +K+
Sbjct: 297 LFKVGLSGGISFGVYQYV-----ENLSHTLKKEKY 326

 Score = 35.0 bits (79), Expect = 0.052,   Method: Compositional matrix adjust.
 Identities = 32/141 (22%), Positives = 59/141 (41%), Gaps = 16/141 (11%)

Query: 116 LVVGAFAGITSSIVSYPFDVLRTRLVANNQMHSMSITREVRDIWKLEGLPGFFKGSIASM 175
           ++ G+ A +  + ++YPF+ L+T      Q+H  ++    +    L  +  +F G  A  
Sbjct: 12  ILAGSAAAVFETTLTYPFEFLKTGF----QLHRRTVG--AKPFEALRPIKVYFAGCTALN 65

Query: 176 TTITLTASIMFGTYE-TIRIYCDENEKTTAAHKKWELATLNHSAGTIGGVIAKIITFPLE 234
            +  +  S+ F T++   +I  D N    +  K   L      AG + G +  +   P E
Sbjct: 66  LSAIVKTSVRFATFDKACQILRDPNLPKDSLLKGPRLLL----AGILTGAVESLCIIPFE 121

Query: 235 TIRRRM-----QFMNSKHLEK 250
            ++  M     Q   SK  EK
Sbjct: 122 NVKVTMIENSLQLSESKPTEK 142

 Score = 32.3 bits (72), Expect = 0.42,   Method: Compositional matrix adjust.
 Identities = 63/334 (18%), Positives = 120/334 (35%), Gaps = 81/334 (24%)

Query: 20  LLAGAVSGLLARSITAPMDTIKIRLQLTPAN-GLKPFGSQVMEVARSMIKNEGIRSFWKG 78
           +LAG+ + +   ++T P + +K   QL     G KPF     E  R       I+ ++ G
Sbjct: 12  ILAGSAAAVFETTLTYPFEFLKTGFQLHRRTVGAKPF-----EALRP------IKVYFAG 60

Query: 79  NIPGSLLYVTYGSAQFSSYS-----LFNRYLTPFGLEARLHSLVVGAFAGITSSIVSYPF 133
               +L  +   S +F+++      L +  L    L      L+ G   G   S+   PF
Sbjct: 61  CTALNLSAIVKTSVRFATFDKACQILRDPNLPKDSLLKGPRLLLAGILTGAVESLCIIPF 120

Query: 134 DVLRTRLVANNQMHSMSITRE--------------------------------------- 154
           + ++  ++ N+   S S   E                                       
Sbjct: 121 ENVKVTMIENSLQLSESKPTEKEIAGTLKKKVTFHVAKPKQLSPQEQWRQVYSKYPSSNI 180

Query: 155 ---VRDIWKLEGLPGFFKGSIASMTTITLTASIMFGTYETIRIYCDENEKTTAAHKKWEL 211
              V++I+   GL GF +G++ ++      +++ F  Y T++      +     +     
Sbjct: 181 FSVVKEIYLTRGLRGFAQGAMPTVFRQVSNSTVRFTAYTTLKQLISPTQPLNEVYA---- 236

Query: 212 ATLNHSAGTIGGVIAKIITFPLETIRRRMQFMNSKHLEKFSRHSSVYGSYKGYGFARIGL 271
                  G         +T P++ ++ RMQ   SK    F ++S                
Sbjct: 237 ----FGIGLFSSCAVVALTQPIDVVKTRMQ---SKTAHYFYKNS-----------LNCAY 278

Query: 272 QILKQEGVSSLYRGILVALSKTIPTTFVSFWGYE 305
           ++  +EG+ SL++G L  L K   +  +SF  Y+
Sbjct: 279 RVFVEEGMVSLWKGWLPRLFKVGLSGGISFGVYQ 312

>Scas_705.9
          Length = 323

 Score = 49.7 bits (117), Expect = 1e-06,   Method: Compositional matrix adjust.
 Identities = 65/300 (21%), Positives = 122/300 (40%), Gaps = 45/300 (15%)

Query: 21  LAGAVSGLLARSITAPMDTIKIRLQ----LTPANGLKPFGSQVM---EVARSMIK---NE 70
           + GA++  +A  I  P+D  K  +Q        + L     +++    V R +I+     
Sbjct: 8   ITGAIASTMANVIVYPLDVAKTVIQSETKAKETDELSEKDKRILRQENVIRCLIRIFRKR 67

Query: 71  GIRSFWKG-------NIPGSLLYVTYGS----AQFSSYSLFNRYLTPFGLEARLHSLVVG 119
           G+R  ++G           S  Y  + S      FS   L N    P    + +  L+VG
Sbjct: 68  GLRGLYQGMSTSVFSKFVQSFCYFFWYSFLRRKYFSLKLLRNTQARPINSISTVEELIVG 127

Query: 120 AFAGITSSIVSYPFDVLRTRLVANNQMHSMSITREVRDIWKLEG--LPGFFKGSIASMTT 177
             A   + +V+ P +V+ T+    +   ++     ++ I+      L  ++KG   S+  
Sbjct: 128 VGAAALTQVVNNPIEVILTKQQTTDDKDNVDFYSVLKQIYVESNGKLSSYWKGFKVSLI- 186

Query: 178 ITLTASIMFGTYETIR-IYCDENEKTTAAHKKWELATLNHSAGTIGGVIAKIITFPLETI 236
           +T+  SI F  Y+  + I   +   +  ++        N   G +  +I+ IIT PL   
Sbjct: 187 LTVNPSITFAAYQRFKDILLKQVSNSEKSYSGQLTVNQNFILGALAKIISTIITQPLIVA 246

Query: 237 RRRMQFMNS--KHLEKFSRHSSVYGSYKGYGFARIGLQILKQEGVSSLYRGILVALSKTI 294
           +  +Q  NS  KH E+  R+                  + K+EGV +L++G+   L+K +
Sbjct: 247 KVSLQRSNSKFKHFEEVLRY------------------LYKEEGVLALWKGVGPQLTKGV 288

 Score = 33.1 bits (74), Expect = 0.23,   Method: Compositional matrix adjust.
 Identities = 20/64 (31%), Positives = 34/64 (53%), Gaps = 5/64 (7%)

Query: 18  KTLLAGAVSGLLARSITAPMDTIKIRLQLTPANGLKPFGSQVMEVARSMIKNEGIRSFWK 77
           +  + GA++ +++  IT P+   K+ LQ + +   K F     EV R + K EG+ + WK
Sbjct: 224 QNFILGALAKIISTIITQPLIVAKVSLQRSNSK-FKHFE----EVLRYLYKEEGVLALWK 278

Query: 78  GNIP 81
           G  P
Sbjct: 279 GVGP 282

>Sklu_2433.8 YFR045W, Contig c2433 11995-13257 reverse complement
          Length = 420

 Score = 50.1 bits (118), Expect = 1e-06,   Method: Compositional matrix adjust.
 Identities = 35/156 (22%), Positives = 71/156 (45%), Gaps = 12/156 (7%)

Query: 57  SQVMEVARSMIKNEGIRSFWKGNIPGSLLYVTYGSAQFSSYSLFNRYLTPFGLEARLHSL 116
           S+     + +    G+R F +G  P     +   + +F++Y+   + ++P       ++ 
Sbjct: 268 SRFFSTVKEIYLTRGLRGFVQGTAPTIFRQMGNSAVRFTTYTSLKQLISPNKPLNEYYAF 327

Query: 117 VVGAFAGITSSIVSYPFDVLRTRLVAN----NQMHSMSITREVRDIWKLEGLPGFFKGSI 172
           V+G  +      V+ P DV++TR+ +     N  +S++       I+  EG+P F+KG  
Sbjct: 328 VLGFISSCAVVAVTQPIDVIKTRMQSKYAWANYKNSLNCAYR---IFVEEGIPKFWKGWA 384

Query: 173 ASMTTITLTASIMFGTYETIRIYCDENEKTTAAHKK 208
             +  + L+  + FG Y+ +     EN     AH+K
Sbjct: 385 PRLMKVGLSGGVSFGVYQYV-----ENLIKLMAHEK 415

 Score = 31.6 bits (70), Expect = 0.76,   Method: Compositional matrix adjust.
 Identities = 19/62 (30%), Positives = 27/62 (43%), Gaps = 3/62 (4%)

Query: 20  LLAGAVSGLLARSITAPMDTIKIRLQLTPANGLKPFGSQVMEVARSMIKNEGIRSFWKGN 79
            + G +S     ++T P+D IK R+Q   A          +  A  +   EGI  FWKG 
Sbjct: 327 FVLGFISSCAVVAVTQPIDVIKTRMQSKYAWANY---KNSLNCAYRIFVEEGIPKFWKGW 383

Query: 80  IP 81
            P
Sbjct: 384 AP 385

>Kwal_47.19228
          Length = 281

 Score = 49.3 bits (116), Expect = 1e-06,   Method: Compositional matrix adjust.
 Identities = 29/139 (20%), Positives = 67/139 (48%), Gaps = 7/139 (5%)

Query: 58  QVMEVARSMIKNEGIRSFWKGNIPGSLLYVTYGSAQFSSYSLFNRYLTPFGLEARLHSLV 117
           Q +   + + ++ GIR F +G +P  +   +  + +F++Y+   + ++P       ++  
Sbjct: 130 QFLTTVQEIYRSRGIRGFLQGTMPTIIRQTSNSAVRFTTYTSLKQMISPNKPLNEYYAFA 189

Query: 118 VGAFAGITSSIVSYPFDVLRTRLVA----NNQMHSMSITREVRDIWKLEGLPGFFKGSIA 173
           +G  +      V+ P DV++TR+ +    +N  +S++       I+  EG   F+KG   
Sbjct: 190 LGFISSCAVVAVTQPIDVIKTRMQSKYTWSNYKNSLNCAYR---IFVEEGFTKFWKGWAP 246

Query: 174 SMTTITLTASIMFGTYETI 192
            +  + L+  + FG Y+ +
Sbjct: 247 RLMKVGLSGGVSFGVYQYV 265

 Score = 35.0 bits (79), Expect = 0.049,   Method: Compositional matrix adjust.
 Identities = 33/151 (21%), Positives = 66/151 (43%), Gaps = 22/151 (14%)

Query: 155 VRDIWKLEGLPGFFKGSIASMTTITLTASIMFGTYETIRIYCDENEKTTAAHKKWELATL 214
           V++I++  G+ GF +G++ ++   T  +++ F TY +++     N+     +        
Sbjct: 135 VQEIYRSRGIRGFLQGTMPTIIRQTSNSAVRFTTYTSLKQMISPNKPLNEYYA------- 187

Query: 215 NHSAGTIGGVIAKIITFPLETIRRRMQFMNSKHLEKFSRHSSVYGSYKGYGFARIGLQIL 274
             + G I       +T P++ I+ RMQ   SK+          + +YK         +I 
Sbjct: 188 -FALGFISSCAVVAVTQPIDVIKTRMQ---SKY---------TWSNYKNS--LNCAYRIF 232

Query: 275 KQEGVSSLYRGILVALSKTIPTTFVSFWGYE 305
            +EG +  ++G    L K   +  VSF  Y+
Sbjct: 233 VEEGFTKFWKGWAPRLMKVGLSGGVSFGVYQ 263

 Score = 29.3 bits (64), Expect = 3.8,   Method: Compositional matrix adjust.
 Identities = 22/84 (26%), Positives = 33/84 (39%), Gaps = 7/84 (8%)

Query: 23  GAVSGLLARSITAPMDTIKIRLQ--LTPANGLKPFGSQVMEVARSMIKNEGIRSFWKGNI 80
           G +S     ++T P+D IK R+Q   T +N         +  A  +   EG   FWKG  
Sbjct: 191 GFISSCAVVAVTQPIDVIKTRMQSKYTWSN-----YKNSLNCAYRIFVEEGFTKFWKGWA 245

Query: 81  PGSLLYVTYGSAQFSSYSLFNRYL 104
           P  +     G   F  Y   +  +
Sbjct: 246 PRLMKVGLSGGVSFGVYQYVDNLM 269

>Kwal_33.15597
          Length = 305

 Score = 49.3 bits (116), Expect = 1e-06,   Method: Compositional matrix adjust.
 Identities = 49/192 (25%), Positives = 79/192 (41%), Gaps = 20/192 (10%)

Query: 117 VVGAFAGITSSIVSYPFDVLRTRLVANNQMHSMSITREVRDIWKLEGLPGFFKGSIASMT 176
           + GA    T+     P DV++TR+     +++  +    + I   EG      G   ++ 
Sbjct: 18  LAGAIGCGTTHSAMVPIDVVKTRIQLEPTVYNKGMISSFKQIISSEGAGALLTGFGPTLL 77

Query: 177 TITLTASIMFGTYETIR-IYCDENEKTTAAHKKWELATLNHSAGTIGGVIAKIITFPLET 235
             +L  S  FG YE  + ++ D      A + K    ++   +  I    A I   PLE 
Sbjct: 78  GYSLQGSFKFGGYEVFKKLFIDTLGYDQAVNYK---NSIYIGSAAIAEFFADIALCPLEA 134

Query: 236 IRRRMQFMNSKHLEKFSRHSSVYGSYKGYGFARIGLQILKQEGVSSLYRGILVALSKTIP 295
            R R+       + + +  + + G     GF+RI    LK+EG+SS Y G    L K IP
Sbjct: 135 TRIRL-------VSQPTFANGLVG-----GFSRI----LKEEGLSSFYNGFTPILFKQIP 178

Query: 296 TTFVSFWGYETA 307
                F  +E A
Sbjct: 179 YNIAKFLVFERA 190

 Score = 48.5 bits (114), Expect = 2e-06,   Method: Compositional matrix adjust.
 Identities = 44/159 (27%), Positives = 71/159 (44%), Gaps = 11/159 (6%)

Query: 18  KTLLAGAVSGLLARSITAPMDTIKIRLQLTPANGLKPFGSQVMEVARSMIKNEGIRSFWK 77
           K  LAGA+      S   P+D +K R+QL P      +   ++   + +I +EG  +   
Sbjct: 15  KFALAGAIGCGTTHSAMVPIDVVKTRIQLEPTV----YNKGMISSFKQIISSEGAGALLT 70

Query: 78  GNIPGSLLYVTYGSAQFSSYSLFNR-YLTPFGLEARL---HSLVVG--AFAGITSSIVSY 131
           G  P  L Y   GS +F  Y +F + ++   G +  +   +S+ +G  A A   + I   
Sbjct: 71  GFGPTLLGYSLQGSFKFGGYEVFKKLFIDTLGYDQAVNYKNSIYIGSAAIAEFFADIALC 130

Query: 132 PFDVLRTRLVANNQMHSMSITREVRDIWKLEGLPGFFKG 170
           P +  R RLV+     +  +    R I K EGL  F+ G
Sbjct: 131 PLEATRIRLVSQPTFANGLVGGFSR-ILKEEGLSSFYNG 168

 Score = 44.7 bits (104), Expect = 4e-05,   Method: Compositional matrix adjust.
 Identities = 57/223 (25%), Positives = 93/223 (41%), Gaps = 32/223 (14%)

Query: 6   DSLRKGQNVAAWKTLLAG--AVSGLLARSITAPMDTIKIRL--QLTPANGLKPFGSQVME 61
           D+L   Q V    ++  G  A++   A     P++  +IRL  Q T ANGL      V  
Sbjct: 99  DTLGYDQAVNYKNSIYIGSAAIAEFFADIALCPLEATRIRLVSQPTFANGL------VGG 152

Query: 62  VARSMIKNEGIRSFWKGNIPGSLLYVTYGSAQFSSYSLFNRYLTP-FGLEA--------- 111
            +R ++K EG+ SF+ G  P     + Y  A+F    +F R     FG+           
Sbjct: 153 FSR-ILKEEGLSSFYNGFTPILFKQIPYNIAKFL---VFERAAEVYFGMAGPKETLSTST 208

Query: 112 -RLHSLVVGAFAGITSSIVSYPFDVLRTRLVANNQMHSMSITREVRDIWKLEGLPGFFKG 170
               +L+ G  AG+ ++IVS P D L +++    +    S    +  + K  G  G F G
Sbjct: 209 TTGLNLLSGLTAGLAAAIVSQPADTLLSKVNKAKKAPGQSTIGLLGQLAKELGFVGSFAG 268

Query: 171 SIASMTTITLTASIMFGTYETIRIYCDENEKTTAAHKKWELAT 213
               +  +    S+ FG Y +++       KT       E+A+
Sbjct: 269 LPTRLVMVGTLTSLQFGIYGSLK-------KTLGCAPAIEIAS 304

>CAGL0H03839g 359987..360835 highly similar to sp|P38921
           Saccharomyces cerevisiae YNL003c PET8, start by
           similarity
          Length = 282

 Score = 48.9 bits (115), Expect = 1e-06,   Method: Compositional matrix adjust.
 Identities = 62/243 (25%), Positives = 103/243 (42%), Gaps = 46/243 (18%)

Query: 19  TLLAGAVSGLLARSITAPMDTIKIRLQLTPANGLKPFGSQVMEVARSMIKNEGIRSFWKG 78
           +LL+GA +G     +  P+DT+K RLQ   A G                +N G R  ++G
Sbjct: 8   SLLSGAAAGTSTDLVFFPIDTLKTRLQ---AKG-------------GFFRNGGYRGVYRG 51

Query: 79  -------NIPG-SLLYVTYGSAQFSSYSLFNRYLTPFGLEARLHSLVVGAFAGITSSIVS 130
                  + PG SL ++TY + +  +   F   L    +   +  +   +   I + +V 
Sbjct: 52  LGSAVVASAPGASLFFITYDTCKAETRGFFRGLLPSSNVADVVTHMFSSSMGEIAACMVR 111

Query: 131 YPFDVLRTRLVANNQMH-SMSITREVRDIWKLEGLPG----FFKG-SIASMTTITLTASI 184
            P +V++ R    +Q H S S    +R+I K E   G     ++G S   M  I  T  I
Sbjct: 112 VPAEVVKQR----SQTHASHSSWETLREILKNENGEGVRRNLYRGWSTTIMREIPFTC-I 166

Query: 185 MFGTYETIR---IYCDENEKTTAAHKKWELATLNHSAGTIGGVIAKIITFPLETIRRRMQ 241
            F  YE ++      DE+++     + W+ A      G+I G IA   T PL+ ++ R+ 
Sbjct: 167 QFPLYEYMKKVWAELDESDRV----EPWKGAV----CGSIAGGIAAATTTPLDFLKTRLM 218

Query: 242 FMN 244
              
Sbjct: 219 LCK 221

 Score = 47.8 bits (112), Expect = 4e-06,   Method: Compositional matrix adjust.
 Identities = 50/204 (24%), Positives = 85/204 (41%), Gaps = 17/204 (8%)

Query: 8   LRKGQNVAAWKT-LLAGAVSGLLARSITAPMDTIKIRLQLTPANGLKPFGSQVMEVARSM 66
           L    NVA   T + + ++  + A  +  P + +K R Q   ++          E  R +
Sbjct: 84  LLPSSNVADVVTHMFSSSMGEIAACMVRVPAEVVKQRSQTHASH-------SSWETLREI 136

Query: 67  IKNE---GIR-SFWKGNIPGSLLYVTYGSAQFSSYSLFNRYLTPFGLEARLH---SLVVG 119
           +KNE   G+R + ++G     +  + +   QF  Y    +         R+      V G
Sbjct: 137 LKNENGEGVRRNLYRGWSTTIMREIPFTCIQFPLYEYMKKVWAELDESDRVEPWKGAVCG 196

Query: 120 AFAGITSSIVSYPFDVLRTRLVANNQMHSMSITREVRDIWKLEGLPGFFKGSIASMTTIT 179
           + AG  ++  + P D L+TRL+   +  S+ +   V  I+K EG   FF G       I+
Sbjct: 197 SIAGGIAAATTTPLDFLKTRLMLCKK--SIPLGTLVSTIYKEEGFKVFFSGVGPRTMWIS 254

Query: 180 LTASIMFGTYETIRIYCDENEKTT 203
              +I  G YET+      N+K T
Sbjct: 255 AGGAIFLGIYETVHSLLSTNKKPT 278

 Score = 45.1 bits (105), Expect = 3e-05,   Method: Compositional matrix adjust.
 Identities = 47/198 (23%), Positives = 82/198 (41%), Gaps = 28/198 (14%)

Query: 109 LEARLHSLVVGAFAGITSSIVSYPFDVLRTRLVANNQMHSMSITREVRDIWKLEGLPGFF 168
           L   L SL+ GA AG ++ +V +P D L+TRL A                ++  G  G +
Sbjct: 2   LNGFLISLLSGAAAGTSTDLVFFPIDTLKTRLQAKG------------GFFRNGGYRGVY 49

Query: 169 KGSIASMTTITLTASIMFGTYETIRIYCDENEKTTAAHKKWELATLNHSAGTIGGVIAKI 228
           +G  +++      AS+ F TY+T +       +             +  + ++G + A +
Sbjct: 50  RGLGSAVVASAPGASLFFITYDTCKAETRGFFRGLLPSSNVADVVTHMFSSSMGEIAACM 109

Query: 229 ITFPLETIRRRMQFMNSKHLEKFSRHSSVYGSYKGYGFARIGLQILKQEGV-SSLYRGIL 287
           +  P E +++R Q                + S+  +   R  L+    EGV  +LYRG  
Sbjct: 110 VRVPAEVVKQRSQ---------------THASHSSWETLREILKNENGEGVRRNLYRGWS 154

Query: 288 VALSKTIPTTFVSFWGYE 305
             + + IP T + F  YE
Sbjct: 155 TTIMREIPFTCIQFPLYE 172

>AER450C [2950] [Homologous to ScYJR077C (MIR1) - SH]
           (1500683..1501609) [927 bp, 308 aa]
          Length = 308

 Score = 49.3 bits (116), Expect = 2e-06,   Method: Compositional matrix adjust.
 Identities = 56/205 (27%), Positives = 84/205 (40%), Gaps = 27/205 (13%)

Query: 18  KTLLAGAVSGLLARSITAPMDTIKIRLQLTPANGLKPFGSQVMEVARSMIKNEGIRSFWK 77
           K  LAGA+      S   P+D +K R+QL P   LK + S ++   R ++  EG  +   
Sbjct: 17  KFALAGAIGCGATHSAMVPIDVVKTRIQLEP---LK-YSSGMVGSFRKIVGEEGAAALLT 72

Query: 78  GNIPGSLLYVTYGSAQFSSYSLFNR-YLTPFGLEARLH---SLVVG--AFAGITSSIVSY 131
           G  P  L Y   G+ +F  Y +F + ++   G E        + +G  A A   + I   
Sbjct: 73  GFGPTLLGYSMQGAFKFGGYEVFKKAFVDALGYETACQYRTPIYIGSAAIAEFFADIALC 132

Query: 132 PFDVLRTRLVANNQMHSMSITREVRDIWKLEGLPGFFKG-----------SIASMTTITL 180
           P +  R RLV+     +  +    R I K EG+  F+ G           +IA       
Sbjct: 133 PLEATRIRLVSQPTFANGLVGGFAR-ILKEEGIGSFYNGFTPILFKQIPYNIAKFVVFEH 191

Query: 181 TASIMFGTYETIRIYCDENEKTTAA 205
            A+  FG   +      EN  TTAA
Sbjct: 192 AANAYFGLAGS-----KENLSTTAA 211

 Score = 48.5 bits (114), Expect = 3e-06,   Method: Compositional matrix adjust.
 Identities = 46/179 (25%), Positives = 71/179 (39%), Gaps = 20/179 (11%)

Query: 132 PFDVLRTRLVANNQMHSMSITREVRDIWKLEGLPGFFKGSIASMTTITLTASIMFGTYET 191
           P DV++TR+      +S  +    R I   EG      G   ++   ++  +  FG YE 
Sbjct: 35  PIDVVKTRIQLEPLKYSSGMVGSFRKIVGEEGAAALLTGFGPTLLGYSMQGAFKFGGYEV 94

Query: 192 IR-IYCDENEKTTAAHKKWELATLNHSAGTIGGVIAKIITFPLETIRRRMQFMNSKHLEK 250
            +  + D     TA   +  +      +  I    A I   PLE  R R+       + +
Sbjct: 95  FKKAFVDALGYETACQYRTPIYI---GSAAIAEFFADIALCPLEATRIRL-------VSQ 144

Query: 251 FSRHSSVYGSYKGYGFARIGLQILKQEGVSSLYRGILVALSKTIPTTFVSFWGYETAIH 309
            +  + + G     GFARI    LK+EG+ S Y G    L K IP     F  +E A +
Sbjct: 145 PTFANGLVG-----GFARI----LKEEGIGSFYNGFTPILFKQIPYNIAKFVVFEHAAN 194

 Score = 43.9 bits (102), Expect = 9e-05,   Method: Compositional matrix adjust.
 Identities = 49/183 (26%), Positives = 74/183 (40%), Gaps = 23/183 (12%)

Query: 24  AVSGLLARSITAPMDTIKIRL--QLTPANGLKPFGSQVMEVARSMIKNEGIRSFWKGNIP 81
           A++   A     P++  +IRL  Q T ANGL      V   AR ++K EGI SF+ G  P
Sbjct: 121 AIAEFFADIALCPLEATRIRLVSQPTFANGL------VGGFAR-ILKEEGIGSFYNGFTP 173

Query: 82  GSLLYVTYGSAQFSSYS-LFNRYLTPFGLEARLHSLVVGAFAGITSS----------IVS 130
                + Y  A+F  +    N Y   FGL     +L   A  GI             ++S
Sbjct: 174 ILFKQIPYNIAKFVVFEHAANAY---FGLAGSKENLSTTAATGINLLAGLTAGLAAAVIS 230

Query: 131 YPFDVLRTRLVANNQMHSMSITREVRDIWKLEGLPGFFKGSIASMTTITLTASIMFGTYE 190
            P D L +++    +    S    +  + K  G  G F G    +  +    S+ FG Y 
Sbjct: 231 QPADTLLSKVNKTKKAPGQSTFGLLMQLAKQLGFVGSFAGLPTRLVMVGTLTSLQFGIYG 290

Query: 191 TIR 193
            ++
Sbjct: 291 KLK 293

>AFR253W [3445] [Homologous to ScYFR045W - SH]
           complement(892939..892986,893047..894033) [1035 bp, 344
           aa]
          Length = 344

 Score = 49.3 bits (116), Expect = 2e-06,   Method: Compositional matrix adjust.
 Identities = 53/249 (21%), Positives = 97/249 (38%), Gaps = 55/249 (22%)

Query: 6   DSLRKGQNVAAWKTLLAGAVSGLLARSITAPMDTIKI-----------RLQLTP------ 48
           D     Q +A  + LLAGA++G L      P ++IK            R+Q  P      
Sbjct: 100 DPEHADQPIAGPRLLLAGAITGFLESLWVVPFESIKTTAVENALELSRRVQGEPETRAAA 159

Query: 49  -ANGLKP----------------------------FGSQVMEVARSMIKNEGIRSFWKGN 79
            + G  P                            F   V+E+ R+     G+R F +G 
Sbjct: 160 VSKGPAPKATFHAARPVQTAHERWLLHYERQPSSHFAGTVLEIYRT----RGVRGFLQGA 215

Query: 80  IPGSLLYVTYGSAQFSSYSLFNRYLTPFGLEARLHSLVVGAFAGITSSIVSYPFDVLRTR 139
           +P     +     +F++Y+   + L+P        +   GA +      ++ P DV++TR
Sbjct: 216 MPTIFRQLGNSVVRFTTYAWIVQSLSPHKALDEYQAFAAGALSSAAVVALTQPIDVIKTR 275

Query: 140 LVANNQ--MHSMSITREVRDIWKLEGLPGFFKGSIASMTTITLTASIMFGTYETIR--IY 195
           + +      +  S+    R I+  EG    +KG +  +  ++L+  I FG Y+ +   + 
Sbjct: 276 MQSKTAWFTYKSSLNCAYR-IFVEEGFRYMWKGWVPRLFKVSLSGGISFGVYQYVENLVL 334

Query: 196 CDENEKTTA 204
             E+E++ A
Sbjct: 335 LWEHERSLA 343

 Score = 31.6 bits (70), Expect = 0.71,   Method: Compositional matrix adjust.
 Identities = 28/123 (22%), Positives = 48/123 (39%), Gaps = 10/123 (8%)

Query: 115 SLVVGAFAGITSSIVSYPFDVLRTRLVANNQMHSMSITREVRDIWKLEGLPGFFKGSIAS 174
           S++ GA A +  + +S+PF+ L+T      Q+H         ++  L     +F G  A 
Sbjct: 23  SVIAGAAAAVFQTTMSHPFEFLKT----GQQLHRALPGAAAFNM--LHPFKYYFSGCAAL 76

Query: 175 MTTITLTASIMFGTYETIRIYCDENEKTTAAHKKWELATLNHSAGTIGGVIAKIITFPLE 234
                L     F T+E   ++  + E          L      AG I G +  +   P E
Sbjct: 77  NVGTLLKTGTRFATFEQACVWLRDPEHADQPIAGPRLLL----AGAITGFLESLWVVPFE 132

Query: 235 TIR 237
           +I+
Sbjct: 133 SIK 135

 Score = 29.3 bits (64), Expect = 3.7,   Method: Compositional matrix adjust.
 Identities = 33/151 (21%), Positives = 67/151 (44%), Gaps = 22/151 (14%)

Query: 155 VRDIWKLEGLPGFFKGSIASMTTITLTASIMFGTYETIRIYCDENEKTTAAHKKWELATL 214
           V +I++  G+ GF +G++ ++      + + F TY  I        ++ + HK  +    
Sbjct: 199 VLEIYRTRGVRGFLQGAMPTIFRQLGNSVVRFTTYAWI-------VQSLSPHKALD-EYQ 250

Query: 215 NHSAGTIGGVIAKIITFPLETIRRRMQFMNSKHLEKFSRHSSVYGSYKGYGFARIGLQIL 274
             +AG +       +T P++ I+ RMQ   +     F+  SS+  +Y+          I 
Sbjct: 251 AFAAGALSSAAVVALTQPIDVIKTRMQSKTA----WFTYKSSLNCAYR----------IF 296

Query: 275 KQEGVSSLYRGILVALSKTIPTTFVSFWGYE 305
            +EG   +++G +  L K   +  +SF  Y+
Sbjct: 297 VEEGFRYMWKGWVPRLFKVSLSGGISFGVYQ 327

>Kwal_0.232
          Length = 274

 Score = 48.9 bits (115), Expect = 2e-06,   Method: Compositional matrix adjust.
 Identities = 53/200 (26%), Positives = 86/200 (43%), Gaps = 43/200 (21%)

Query: 115 SLVVGAFAGITSSIVSYPFDVLRTRLVANNQMHSMSITREVRDIWKLEGLPGFFKGSIAS 174
           SL+ GA AG ++ +  +P D L+TRL A     +              G  G ++G  ++
Sbjct: 9   SLLAGAAAGTSTDLFFFPIDTLKTRLQAAGGFFANG------------GYLGVYRGLGSA 56

Query: 175 MTTITLTASIMFGTYETIRIYCDE--NEKTTAAHKKWELAT--LNHSAGTIGGVIAKIIT 230
           +     +AS+ F TY+ ++ Y     N   T++ +  E AT   + SAG I   + ++  
Sbjct: 57  VVASAPSASLFFVTYDGMKSYSRPIFNNLITSSDQVAETATHMFSSSAGEIAACMVRV-- 114

Query: 231 FPLETIRRRMQFMNS----KHLEKFSRHSSVYGSYKGYGFARIGLQILKQEGV-SSLYRG 285
            P E I++R Q   S    + L+K                    LQ    EG+  +LYRG
Sbjct: 115 -PAEVIKQRTQTHKSDSSLQTLKKL-------------------LQNENGEGIRRNLYRG 154

Query: 286 ILVALSKTIPTTFVSFWGYE 305
               + + IP T + F  YE
Sbjct: 155 WSTTVMREIPFTCIQFPLYE 174

 Score = 45.4 bits (106), Expect = 2e-05,   Method: Compositional matrix adjust.
 Identities = 44/178 (24%), Positives = 77/178 (43%), Gaps = 19/178 (10%)

Query: 22  AGAVSGLLARSITAPMDTIKIRLQLTPANGLKPFGSQVMEVARSMIKNE---GIR-SFWK 77
           AG ++  + R    P + IK R Q   ++         ++  + +++NE   GIR + ++
Sbjct: 104 AGEIAACMVR---VPAEVIKQRTQTHKSD-------SSLQTLKKLLQNENGEGIRRNLYR 153

Query: 78  GNIPGSLLYVTYGSAQFSSYSLFNR-YLTPFGLE--ARLHSLVVGAFAGITSSIVSYPFD 134
           G     +  + +   QF  Y    + +    G E  A       G  AG  ++  + P D
Sbjct: 154 GWSTTVMREIPFTCIQFPLYEFLKKQWAISGGREQVAPWQGAFCGCVAGGIAAATTTPLD 213

Query: 135 VLRTRLVANNQMHSMSITREVRDIWKLEGLPGFFKGSIASMTTITLTASIMFGTYETI 192
           VL+TRL+ ++   S+ +    R I+  EG   FF G       I+   +I  G YET+
Sbjct: 214 VLKTRLMLSHT--SVPVLHLARQIYATEGWKVFFSGVGPRTVWISAGGAIFLGVYETV 269

 Score = 43.9 bits (102), Expect = 7e-05,   Method: Compositional matrix adjust.
 Identities = 60/241 (24%), Positives = 96/241 (39%), Gaps = 49/241 (20%)

Query: 19  TLLAGAVSGLLARSITAPMDTIKIRLQLTP---ANG-----LKPFGSQVMEVARSMIKNE 70
           +LLAGA +G        P+DT+K RLQ      ANG      +  GS V+  A S     
Sbjct: 9   SLLAGAAAGTSTDLFFFPIDTLKTRLQAAGGFFANGGYLGVYRGLGSAVVASAPS----- 63

Query: 71  GIRSFWKGNIPGSLLYVTYGSAQFSSYSLFNRYLTPFGLEARLHSLVVGAFAG-ITSSIV 129
                       SL +VTY   +  S  +FN  +T     A   + +  + AG I + +V
Sbjct: 64  -----------ASLFFVTYDGMKSYSRPIFNNLITSSDQVAETATHMFSSSAGEIAACMV 112

Query: 130 SYPFDVLRTRLVANNQMHSMSITREVRDIWKLEGL-PGFFKG-SIASMTTITLTASIMFG 187
             P +V++ R   +    S+   +++      EG+    ++G S   M  I  T  I F 
Sbjct: 113 RVPAEVIKQRTQTHKSDSSLQTLKKLLQNENGEGIRRNLYRGWSTTVMREIPFTC-IQFP 171

Query: 188 TYETIRIYCDENEKTTAAHKKWELATLNHS--------AGTIGGVIAKIITFPLETIRRR 239
            YE ++             K+W ++              G + G IA   T PL+ ++ R
Sbjct: 172 LYEFLK-------------KQWAISGGREQVAPWQGAFCGCVAGGIAAATTTPLDVLKTR 218

Query: 240 M 240
           +
Sbjct: 219 L 219

 Score = 43.1 bits (100), Expect = 1e-04,   Method: Compositional matrix adjust.
 Identities = 25/83 (30%), Positives = 44/83 (53%), Gaps = 7/83 (8%)

Query: 12  QNVAAWKTLLAGAVSGLLARSITAPMDTIKIRLQLTPANGLKPFGSQVMEVARSMIKNEG 71
           + VA W+    G V+G +A + T P+D +K RL L+  +        V+ +AR +   EG
Sbjct: 187 EQVAPWQGAFCGCVAGGIAAATTTPLDVLKTRLMLSHTS------VPVLHLARQIYATEG 240

Query: 72  IRSFWKGNIPGSLLYVTYGSAQF 94
            + F+ G  P + ++++ G A F
Sbjct: 241 WKVFFSGVGPRT-VWISAGGAIF 262

>Sklu_2435.2 YPR128C, Contig c2435 2489-3523 reverse complement
          Length = 344

 Score = 48.9 bits (115), Expect = 2e-06,   Method: Compositional matrix adjust.
 Identities = 69/335 (20%), Positives = 135/335 (40%), Gaps = 79/335 (23%)

Query: 14  VAAWKTLLAGAVSGLLARSITAPMDTIK--IRLQLTPANGLKPFGSQ------------- 58
           +A++++ L+GAV+  +A ++  P+D +K  ++ QL     LK   ++             
Sbjct: 1   MASFESALSGAVASAMANTVVYPLDLVKTLVQTQLKQDEQLKQLETEPQSQDKDEPVKDI 60

Query: 59  -----------------VMEVARSMIKNEGIRSFWKGNIPGSL----------LYVTYGS 91
                              +    + K EGIR  ++G     +           + ++  
Sbjct: 61  PPVPIKLNENNYLQYNSTFDAIYKIYKQEGIRGLYQGLTTSVMAGFFQTFSYFFWYSFVR 120

Query: 92  AQFSSYSLFNRYLTPFGLEARLHSLVVGAFAGITSSIVSYPFDVL----RTRLVANNQMH 147
             +    L NR  T F     +  L++G  A  TS I + P  ++    +TR   +    
Sbjct: 121 KCYFRVKLINRKNTKF---TTIEELLLGIVAAATSQIFTNPISLISARQQTRQGIDGDND 177

Query: 148 SMSITREVRDIWKLEGLPGFFKGSIASMTTITLTASIMFGTYETIRIYCDENEKTTAAHK 207
            +++ +E+    +   + GF+KG   S+  +T+  SI + +YE ++   D    T   + 
Sbjct: 178 FLTVAKEIYK--EQRSIKGFWKGLKVSL-MLTINPSITYTSYEKLK---DALFTTDTMNL 231

Query: 208 KWELAT--------LNHSAGTIGGVIAKIITFPLETIRRRMQFMNSKHLEKFSRHSSVYG 259
           K EL           N + G +  +I+ IIT PL   +  +Q           R+ S + 
Sbjct: 232 KKELVDSSSQLSPYQNFTLGVLSKMISAIITMPLIISKAWLQ-----------RNGSNFS 280

Query: 260 SYKGYGFARIGLQILKQEGVSSLYRGILVALSKTI 294
           S     F ++   + K EG+ S ++G+   L+K +
Sbjct: 281 S-----FQQVLYYLYKNEGLRSWWKGLSPQLAKGV 310

 Score = 34.3 bits (77), Expect = 0.11,   Method: Compositional matrix adjust.
 Identities = 21/69 (30%), Positives = 35/69 (50%), Gaps = 5/69 (7%)

Query: 13  NVAAWKTLLAGAVSGLLARSITAPMDTIKIRLQLTPANGLKPFGSQVMEVARSMIKNEGI 72
            ++ ++    G +S +++  IT P+   K  LQ   +N      S   +V   + KNEG+
Sbjct: 241 QLSPYQNFTLGVLSKMISAIITMPLIISKAWLQRNGSNF-----SSFQQVLYYLYKNEGL 295

Query: 73  RSFWKGNIP 81
           RS+WKG  P
Sbjct: 296 RSWWKGLSP 304

 Score = 28.9 bits (63), Expect = 5.5,   Method: Compositional matrix adjust.
 Identities = 50/241 (20%), Positives = 85/241 (35%), Gaps = 71/241 (29%)

Query: 111 ARLHSLVVGAFAGITSSIVSYPFDVLRT-------------------------------- 138
           A   S + GA A   ++ V YP D+++T                                
Sbjct: 2   ASFESALSGAVASAMANTVVYPLDLVKTLVQTQLKQDEQLKQLETEPQSQDKDEPVKDIP 61

Query: 139 ----RLVANNQMHSMSITREVRDIWKLEGLPGFFKGSIASMTTITLTASIMFGTYETIRI 194
               +L  NN +   S    +  I+K EG+ G ++G         LT S+M G ++T   
Sbjct: 62  PVPIKLNENNYLQYNSTFDAIYKIYKQEGIRGLYQG---------LTTSVMAGFFQTFSY 112

Query: 195 Y--------CDENEKTTAAHKKWELATLNH-SAGTIGGVIAKIITFPLETIRRRMQFMNS 245
           +        C    K     K  +  T+     G +    ++I T P+  I  R Q    
Sbjct: 113 FFWYSFVRKCYFRVKLI-NRKNTKFTTIEELLLGIVAAATSQIFTNPISLISARQQ---- 167

Query: 246 KHLEKFSRHSSVYGSYKGYGFARIGLQILK-QEGVSSLYRGILVALSKTIPTTFVSFWGY 304
                 +R     G      F  +  +I K Q  +   ++G+ V+L  TI  + +++  Y
Sbjct: 168 ------TRQ----GIDGDNDFLTVAKEIYKEQRSIKGFWKGLKVSLMLTINPS-ITYTSY 216

Query: 305 E 305
           E
Sbjct: 217 E 217

>Sklu_2115.4 YDL119C, Contig c2115 2906-3805
          Length = 299

 Score = 48.5 bits (114), Expect = 2e-06,   Method: Compositional matrix adjust.
 Identities = 74/311 (23%), Positives = 136/311 (43%), Gaps = 50/311 (16%)

Query: 20  LLAGAVSGLLARSITAPMDTIKIRLQLTPANGLKPFGSQVMEVARSMIKNEGIRSFWKGN 79
           L+ G V GL +  +  P D +K RLQ      L  +G+  ++  RS       +  W+G 
Sbjct: 11  LIGGFVGGLTSAIVLQPFDLLKTRLQQNKDTTL--WGT--LKEIRS------PKQLWRGA 60

Query: 80  IPGSLLYVTYGSAQF-SSYSLF--------NRYLTP---FGLEARLH-SLVVGAFAGITS 126
           +P S L  + GSA + S+ ++F         + L P   F  +  ++ +L  GAF     
Sbjct: 61  LPSS-LRTSIGSALYLSTLNVFRTAMAKGKTQTLNPGSSFLPQLTMYENLASGAFTRGVV 119

Query: 127 SIVSYPFDVLRTRLVANNQMHSM-SITREVRDIWKLEGLPGFFKGSIASMTTITLTASIM 185
             ++ P  +++ R    + M+S  S+    R I+  EG+ GFF G  A++      A + 
Sbjct: 120 GFITMPITIIKVRY--ESTMYSYKSLGEATRHIYSTEGIRGFFNGCGATVMRDAPYAGLY 177

Query: 186 FGTYETIRIYCDEN-EKTTAAHKKWELAT------LNHSAGTIGGVIAKIITFPLETIRR 238
              YE  ++        +T ++ +  + T      +N  +  +   +A  IT P +TI+ 
Sbjct: 178 VLLYEKAKLLVPMMLPSSTISYDEAGMFTTYTSTVVNSISAFMSASLATTITSPFDTIKT 237

Query: 239 RMQFMNSKHLEKFSRHSSVYGSYKGYGFARIGLQILKQEGVSSLYRGILVALSKTIPTTF 298
           RMQ   +    KFS            GF +  + I+ +E   +L+ G+ + L++   +  
Sbjct: 238 RMQLDPT----KFS------------GFYKTLVLIVSKEKFKNLFDGLTLRLTRKAFSAG 281

Query: 299 VSFWGYETAIH 309
           +++  YE  I 
Sbjct: 282 IAWGIYEELIK 292

 Score = 34.3 bits (77), Expect = 0.092,   Method: Compositional matrix adjust.
 Identities = 47/195 (24%), Positives = 79/195 (40%), Gaps = 21/195 (10%)

Query: 13  NVAAWKTLLAGAVSGLLARSITAPMDTIKIRLQLTPANGLKPFGSQVMEVARSMIKNEGI 72
            +  ++ L +GA +  +   IT P+  IK+R + T     K  G    E  R +   EGI
Sbjct: 102 QLTMYENLASGAFTRGVVGFITMPITIIKVRYEST-MYSYKSLG----EATRHIYSTEGI 156

Query: 73  RSFWKG-------NIPGSLLYV-TYGSAQFSSYSLFNRYLTPF---GLEARLHSLVVGAF 121
           R F+ G       + P + LYV  Y  A+     +       +   G+     S VV + 
Sbjct: 157 RGFFNGCGATVMRDAPYAGLYVLLYEKAKLLVPMMLPSSTISYDEAGMFTTYTSTVVNSI 216

Query: 122 AGITS----SIVSYPFDVLRTRLVANNQMHSMSITREVRDIWKLEGLPGFFKGSIASMTT 177
           +   S    + ++ PFD ++TR+  +    S    + +  I   E     F G    +T 
Sbjct: 217 SAFMSASLATTITSPFDTIKTRMQLDPTKFS-GFYKTLVLIVSKEKFKNLFDGLTLRLTR 275

Query: 178 ITLTASIMFGTYETI 192
              +A I +G YE +
Sbjct: 276 KAFSAGIAWGIYEEL 290

>Kwal_55.21106
          Length = 328

 Score = 48.5 bits (114), Expect = 2e-06,   Method: Compositional matrix adjust.
 Identities = 77/310 (24%), Positives = 127/310 (40%), Gaps = 58/310 (18%)

Query: 21  LAGAVSGLLARSITAPMDTIKIRLQ-------LTPANGLKPFG--SQVMEVARS------ 65
           + GAV+  LA  +  P+D +K  +Q       +    G+KP    S+V E+         
Sbjct: 8   ITGAVASSLANVVVYPLDLVKTLIQTQNKEPNIGSEAGVKPQAKKSRVQEIRYKHSLDAL 67

Query: 66  --MIKNEGI----RSFWKGNIPGSLLYVTYGSAQFSSYSLFNRYLTPFGL-EARL----- 113
             + K +G+    +  W   I G L   +Y    F  YS+  +    + L   RL     
Sbjct: 68  IKIFKTKGVLGLYQGLWTSIIAGFLQSFSY----FFWYSIVRKSFFRYKLLRGRLGKFST 123

Query: 114 -HSLVVGAFAGITSSIVSYPFDVLRTRLVANNQMHSMSITREVRDIWKLEG-LPGFFKGS 171
              L++G  A   S I + P  V+ TR   +           +  I+  +  + GF++G 
Sbjct: 124 PEELLLGIVAAAVSQIFTSPIGVISTRQQTSTSGSKGGFREVLHQIYSEQNNITGFWRGF 183

Query: 172 IASMTTITLTASIMFGTYETIR-IY------CDENEKTTAAHKKWELATLNHSAGTIGGV 224
             S+  +T+  SI F +YE ++ I+       DEN +      +      N   G    V
Sbjct: 184 KVSLI-LTVNPSITFASYEKLQDIFITSKRAVDENGQLLETSGQLS-PRQNFLLGVFSKV 241

Query: 225 IAKIITFPLETIRRRMQFMNSKHLEKFSRHSSVYGSYKGYGFARIGLQILKQEGVSSLYR 284
           I+ +IT PL   +  +Q           R  S + S     F ++ L + KQEG+ SL++
Sbjct: 242 ISTLITQPLIVSKAYLQ-----------RTGSNFQS-----FQQVLLYLYKQEGLISLWK 285

Query: 285 GILVALSKTI 294
           G+   LSK I
Sbjct: 286 GLAPQLSKGI 295

>KLLA0D04312g 367160..367471 highly similar to sgd|S0006215
           Saccharomyces cerevisiae YPR011c, hypothetical start
          Length = 103

 Score = 45.8 bits (107), Expect = 2e-06,   Method: Compositional matrix adjust.
 Identities = 27/89 (30%), Positives = 48/89 (53%), Gaps = 6/89 (6%)

Query: 111 ARLHSLVVGAFAGITSSIVSYPFDVLRTRL----VANNQM--HSMSITREVRDIWKLEGL 164
           A L+ L +GA +G  +  + YPFD+LR R     +  N++     S++  +  I K EG 
Sbjct: 9   ANLYKLAMGAISGGVAQTLVYPFDLLRRRFQVLAMGGNELGFRYKSVSDALITIGKTEGP 68

Query: 165 PGFFKGSIASMTTITLTASIMFGTYETIR 193
            G++KG  A++  +  + ++ +  YE IR
Sbjct: 69  KGYYKGLTANLFKVIPSTAVSWLVYEVIR 97

 Score = 43.5 bits (101), Expect = 2e-05,   Method: Compositional matrix adjust.
 Identities = 28/90 (31%), Positives = 43/90 (47%), Gaps = 9/90 (10%)

Query: 217 SAGTIGGVIAKIITFPLETIRRRMQFMNSKHLEKFSRHSSVYGSYKGYGFARIGLQILKQ 276
           + G I G +A+ + +P + +RRR Q +     E   R+ SV  +          + I K 
Sbjct: 15  AMGAISGGVAQTLVYPFDLLRRRFQVLAMGGNELGFRYKSVSDAL---------ITIGKT 65

Query: 277 EGVSSLYRGILVALSKTIPTTFVSFWGYET 306
           EG    Y+G+   L K IP+T VS+  YE 
Sbjct: 66  EGPKGYYKGLTANLFKVIPSTAVSWLVYEV 95

 Score = 33.5 bits (75), Expect = 0.043,   Method: Compositional matrix adjust.
 Identities = 22/69 (31%), Positives = 38/69 (55%), Gaps = 4/69 (5%)

Query: 13 NVAAWKTLLAGAVSGLLARSITAPMDTIKIRLQLTPANGLKPFGSQVMEVARSMI---KN 69
          N+A    L  GA+SG +A+++  P D ++ R Q+  A G    G +   V+ ++I   K 
Sbjct: 7  NLANLYKLAMGAISGGVAQTLVYPFDLLRRRFQVL-AMGGNELGFRYKSVSDALITIGKT 65

Query: 70 EGIRSFWKG 78
          EG + ++KG
Sbjct: 66 EGPKGYYKG 74

>Scas_673.17
          Length = 314

 Score = 47.8 bits (112), Expect = 4e-06,   Method: Compositional matrix adjust.
 Identities = 44/160 (27%), Positives = 71/160 (44%), Gaps = 11/160 (6%)

Query: 17  WKTLLAGAVSGLLARSITAPMDTIKIRLQLTPANGLKPFGSQVMEVARSMIKNEGIRSFW 76
           +K  LAGA+      S   P+D +K R+QL P      +   ++   + +I +EG  +  
Sbjct: 21  FKFALAGAIGCGTTHSSLVPVDVVKTRIQLEPT----VYNKGMVGSFKKIIADEGAGALL 76

Query: 77  KGNIPGSLLYVTYGSAQFSSYSLFNRY-LTPFGLEARLH---SLVVG--AFAGITSSIVS 130
            G  P  L Y   G+ +F  Y +F +  +   G E  +H   S+ +G  A A   + I  
Sbjct: 77  TGFGPTLLGYSVQGAFKFGGYEVFKKLSIDTIGYENAVHYKNSVYMGSAAVAEFLADIAL 136

Query: 131 YPFDVLRTRLVANNQMHSMSITREVRDIWKLEGLPGFFKG 170
            P +  R RLV+     +  +    R I K EG+  F+ G
Sbjct: 137 CPLEATRIRLVSQPTFANGLVGGFSR-ILKEEGVGSFYSG 175

 Score = 46.6 bits (109), Expect = 1e-05,   Method: Compositional matrix adjust.
 Identities = 47/183 (25%), Positives = 77/183 (42%), Gaps = 22/183 (12%)

Query: 126 SSIVSYPFDVLRTRLVANNQMHSMSITREVRDIWKLEGLPGFFKGSIASMTTITLTASIM 185
           SS+V  P DV++TR+     +++  +    + I   EG      G   ++   ++  +  
Sbjct: 36  SSLV--PVDVVKTRIQLEPTVYNKGMVGSFKKIIADEGAGALLTGFGPTLLGYSVQGAFK 93

Query: 186 FGTYETIR-IYCDENEKTTAAHKKWELATLNHSAGTIGGVIAKIITFPLETIRRRMQFMN 244
           FG YE  + +  D      A H K    ++   +  +   +A I   PLE  R R+    
Sbjct: 94  FGGYEVFKKLSIDTIGYENAVHYK---NSVYMGSAAVAEFLADIALCPLEATRIRL---- 146

Query: 245 SKHLEKFSRHSSVYGSYKGYGFARIGLQILKQEGVSSLYRGILVALSKTIPTTFVSFWGY 304
              + + +  + + G     GF+RI    LK+EGV S Y G    L K IP     F  +
Sbjct: 147 ---VSQPTFANGLVG-----GFSRI----LKEEGVGSFYSGFTPILFKQIPYNIAKFLVF 194

Query: 305 ETA 307
           E A
Sbjct: 195 ERA 197

 Score = 42.7 bits (99), Expect = 2e-04,   Method: Compositional matrix adjust.
 Identities = 49/183 (26%), Positives = 79/183 (43%), Gaps = 23/183 (12%)

Query: 24  AVSGLLARSITAPMDTIKIRL--QLTPANGLKPFGSQVMEVARSMIKNEGIRSFWKGNIP 81
           AV+  LA     P++  +IRL  Q T ANGL      V   +R ++K EG+ SF+ G  P
Sbjct: 126 AVAEFLADIALCPLEATRIRLVSQPTFANGL------VGGFSR-ILKEEGVGSFYSGFTP 178

Query: 82  GSLLYVTYGSAQFSSYSLFNR----YLTPFGLEARLH-------SLVVGAFAGITSSIVS 130
                + Y  A+F    +F R    Y    G +  L        +L+ G  AG  ++ VS
Sbjct: 179 ILFKQIPYNIAKFL---VFERASEVYYGIVGAKETLSDMTNTGINLLSGLTAGFAAAFVS 235

Query: 131 YPFDVLRTRLVANNQMHSMSITREVRDIWKLEGLPGFFKGSIASMTTITLTASIMFGTYE 190
            P D L +++    +    S    +  + K  G+ G F G    +  +    S+ F  Y 
Sbjct: 236 QPADTLLSKVNKTKKAPGQSTIGLLAQLAKQLGVIGSFAGLPTRLIMVGTLTSLQFAIYG 295

Query: 191 TIR 193
           +++
Sbjct: 296 SLK 298

>YFR045W (YFR045W) [1727] chr6 (242129..242986) Member of the
           mitochondrial carrier family (MCF) family of membrane
           transporters [858 bp, 285 aa]
          Length = 285

 Score = 47.8 bits (112), Expect = 4e-06,   Method: Compositional matrix adjust.
 Identities = 44/209 (21%), Positives = 83/209 (39%), Gaps = 28/209 (13%)

Query: 12  QNVAAWKTLLAGAVSGLLARSITAPMDTIKIRL------------QLTPANGLK------ 53
           Q +  +  L+AG ++G++      P + IK  L            +  P    K      
Sbjct: 71  QRLTGYNLLIAGTLTGIVESLFIIPFENIKTTLIQSAMIDHKKLEKNQPVVNAKATFHKV 130

Query: 54  -----PFG--SQVMEVARSMIKNEGIRSFWKGNIPGSLLYVTYGSAQFSSYSLFNRYLTP 106
                P     +++   + M +  G  +F +G        +   S QF++Y+ F R L  
Sbjct: 131 ATKSTPVARIEKLLPAVKHMYQTRGPAAFVQGTTATIFRQIANTSIQFTAYTAFKRLLQ- 189

Query: 107 FGLEARLHSLVVGAFAGITSSIVSYPFDVLRTRLVANNQMHSMSITREVR-DIWKLEGLP 165
                +  S++ G     T   ++ P DV++TR+++ N       T      I+  EG+ 
Sbjct: 190 -ARNDKASSVITGLATSFTLVAMTQPIDVVKTRMMSQNAKTEYKNTLNCMYRIFVQEGMA 248

Query: 166 GFFKGSIASMTTITLTASIMFGTYETIRI 194
            F+KGSI     + ++  + F  YE + +
Sbjct: 249 TFWKGSIFRFMKVGISGGLTFTVYEQVSL 277

>CAGL0C02013g complement(209930..210919) weakly similar to sp|P38152
           Saccharomyces cerevisiae YBR291c CTP1, hypothetical
           start
          Length = 329

 Score = 47.8 bits (112), Expect = 5e-06,   Method: Compositional matrix adjust.
 Identities = 44/223 (19%), Positives = 93/223 (41%), Gaps = 40/223 (17%)

Query: 7   SLRKGQNVAAWKTLLAGAVSGLLARSITAPMDTIKI-----------RLQLTPAN----- 50
           +L K   ++  + L+AGA++G +      P + +K+           RL  T +N     
Sbjct: 92  ALAKDAPLSGVQLLMAGALTGTMESLCIIPFENVKVAMIQNSLLSHERLNTTTSNVQGQV 151

Query: 51  -------------------GLKP--FGSQVMEVARSMIKNEGIRSFWKGNIPGSLLYVTY 89
                               L P    + V+  A  + +  G+R+++KG +P  +  V  
Sbjct: 152 ANEVKKTFHKKPTLRSSYEALFPEKLPTNVLTTAAELYRQHGLRAYFKGTMPTLMRQVGN 211

Query: 90  GSAQFSSYSLFNRYLTPFGLEARLHSLVVGAFAGITSSIVSYPFDVLRTRLVANNQ--MH 147
              +F+++++  ++           + ++G  +       + P DV++TR+ A +   ++
Sbjct: 212 SVVRFTTFTMLKQFAPKEYQNNEYFATLLGLISSCAVVGATQPLDVIKTRMQAKDSVLLY 271

Query: 148 SMSITREVRDIWKLEGLPGFFKGSIASMTTITLTASIMFGTYE 190
             SI    R I+  EG    +KG +  +  + L+ S+ FG Y+
Sbjct: 272 RNSINCAYR-IFVEEGFAMLWKGWLPRLMKVGLSGSVSFGIYQ 313

 Score = 44.3 bits (103), Expect = 5e-05,   Method: Compositional matrix adjust.
 Identities = 71/334 (21%), Positives = 130/334 (38%), Gaps = 85/334 (25%)

Query: 22  AGAVSGLLARSITAPMDTIKIRLQL-TPANGLKPF---GSQVMEVARSMIKNEGIRSFWK 77
           AG+VSGL + +IT P + +K  LQL       KPF   G QV             R+++ 
Sbjct: 15  AGSVSGLFSATITYPFEFLKTGLQLHRNVVAAKPFEVLGYQV-------------RTYFA 61

Query: 78  GNIPGSLLYVTYGSAQFSSYSLFNRYLTPFGLEAR-----LHSLVVGAFAGITSSIVSYP 132
           G    ++  V   S +F ++   + +L P  L        +  L+ GA  G   S+   P
Sbjct: 62  GCSAVNIGVVMKTSLRFLAFDKASEWLRPPALAKDAPLSGVQLLMAGALTGTMESLCIIP 121

Query: 133 FDVLRTRLVANNQMHSM-----------SITREVR------------------------- 156
           F+ ++  ++ N+ +               +  EV+                         
Sbjct: 122 FENVKVAMIQNSLLSHERLNTTTSNVQGQVANEVKKTFHKKPTLRSSYEALFPEKLPTNV 181

Query: 157 -----DIWKLEGLPGFFKGSIASMTTITLTASIMFGTYETIRIYCDENEKTTAAHKKWEL 211
                ++++  GL  +FKG++ ++      + + F T+  ++ +  +  +         L
Sbjct: 182 LTTAAELYRQHGLRAYFKGTMPTLMRQVGNSVVRFTTFTMLKQFAPKEYQNNEYFAT--L 239

Query: 212 ATLNHSAGTIGGVIAKIITFPLETIRRRMQFMNSKHLEKFSRHSSVYGSYKGYGFARIGL 271
             L  S   +G       T PL+ I+ RMQ  +S  L +    +S+  +Y+         
Sbjct: 240 LGLISSCAVVGA------TQPLDVIKTRMQAKDSVLLYR----NSINCAYR--------- 280

Query: 272 QILKQEGVSSLYRGILVALSKTIPTTFVSFWGYE 305
            I  +EG + L++G L  L K   +  VSF  Y+
Sbjct: 281 -IFVEEGFAMLWKGWLPRLMKVGLSGSVSFGIYQ 313

>KLLA0E08877g complement(791157..792041) similar to sgd|S0002277
           Saccharomyces cerevisiae YDL119c, start by similarity
          Length = 294

 Score = 47.4 bits (111), Expect = 6e-06,   Method: Compositional matrix adjust.
 Identities = 68/300 (22%), Positives = 118/300 (39%), Gaps = 63/300 (21%)

Query: 20  LLAGAVSGLLARSITAPMDTIKIRLQLTPANGLKPFGSQVMEVARSMIKNEGIRSFWKGN 79
           L+ G   GL++  I  P D +K RLQ    + L           +++   E     W+G 
Sbjct: 11  LIGGFSGGLVSAIILQPFDLLKTRLQQDKTSTL----------WKTLKSIETPSQLWRGA 60

Query: 80  IPGSLLYVTYGSAQF---------------SSYSLFNRYLTPFGLEARLHSLVVGAFAGI 124
           +P S +  + GSA +               ++ S  + YL    +   + S   GA    
Sbjct: 61  LP-SCIRTSVGSAMYLTMLNSIRQAISKGKNTGSTGSSYLPQLNMYENMFS---GAVTRA 116

Query: 125 TSSIVSYPFDVLRTRLVANNQMHSMSITREVRDIWKLEGLPGFFKGSIASMTTITLTASI 184
            + +++ P  V++ R  +    ++ S+      I++ EGL GFF+G  A+       A +
Sbjct: 117 LTGLITMPITVIKVRYESTLYQYT-SLRYATSHIFRTEGLRGFFRGFGATALRDAPYAGL 175

Query: 185 MFGTYETIRIYC------------DENEKTTAAHKKWELATLNHSAGTIGGVIAKIITFP 232
               Y+ +++               +N  +T A        +N S+     VIA  IT P
Sbjct: 176 YMLFYDRMKVLVPTLLPSNVVKLNSDNRYSTYAS-----TLINGSSAFSAAVIATSITAP 230

Query: 233 LETIRRRMQFMNSKHLEKFSRHSSVYGSYKGYGFARIGLQILKQEGVSSLYRGILVALSK 292
            +T++ RMQ      LE    HS          F      I  +E V +L+ GI + L++
Sbjct: 231 FDTVKTRMQ------LEPAKFHS----------FTSTFWHIATKESVRNLFAGISLRLTR 274

 Score = 37.4 bits (85), Expect = 0.009,   Method: Compositional matrix adjust.
 Identities = 51/196 (26%), Positives = 90/196 (45%), Gaps = 31/196 (15%)

Query: 17  WKTLLAGAVSGLLARSITAPMDTIKIRLQLTPANGLKPFGSQVMEVARSMI-KNEGIRSF 75
           ++ + +GAV+  L   IT P+  IK+R + T    L  + S  +  A S I + EG+R F
Sbjct: 105 YENMFSGAVTRALTGLITMPITVIKVRYEST----LYQYTS--LRYATSHIFRTEGLRGF 158

Query: 76  WKG-------NIPGSLLYVT-YGSAQFSSYSLFNRYLTPFGLEARL----HSLVVG--AF 121
           ++G       + P + LY+  Y   +    +L    +     + R      +L+ G  AF
Sbjct: 159 FRGFGATALRDAPYAGLYMLFYDRMKVLVPTLLPSNVVKLNSDNRYSTYASTLINGSSAF 218

Query: 122 -AGITSSIVSYPFDVLRTRL-VANNQMHSMSITREVRDIWKL---EGLPGFFKGSIASMT 176
            A + ++ ++ PFD ++TR+ +   + HS + T      W +   E +   F G    +T
Sbjct: 219 SAAVIATSITAPFDTVKTRMQLEPAKFHSFTST-----FWHIATKESVRNLFAGISLRLT 273

Query: 177 TITLTASIMFGTYETI 192
               +A I +G YE I
Sbjct: 274 RKAFSAGIAWGIYEEI 289

 Score = 35.4 bits (80), Expect = 0.047,   Method: Compositional matrix adjust.
 Identities = 30/137 (21%), Positives = 66/137 (48%), Gaps = 12/137 (8%)

Query: 110 EARLHSLVVGAFAG-ITSSIVSYPFDVLRTRLVANNQMHSMSITREVRDIWKLEGLPGFF 168
           + R  + ++G F+G + S+I+  PFD+L+TRL    Q  + ++ + ++ I   E     +
Sbjct: 4   QRRATTHLIGGFSGGLVSAIILQPFDLLKTRL---QQDKTSTLWKTLKSI---ETPSQLW 57

Query: 169 KGSIASMTTITLTASIMFGTYETIRIYCDENEKTTAAHKKWELATLNHSAGTIGGVIAK- 227
           +G++ S    ++ +++      +IR    + + T +    + L  LN       G + + 
Sbjct: 58  RGALPSCIRTSVGSAMYLTMLNSIRQAISKGKNTGSTGSSY-LPQLNMYENMFSGAVTRA 116

Query: 228 ---IITFPLETIRRRMQ 241
              +IT P+  I+ R +
Sbjct: 117 LTGLITMPITVIKVRYE 133

>Sklu_1119.1 YJR077C, Contig c1119 366-1289
          Length = 307

 Score = 47.0 bits (110), Expect = 7e-06,   Method: Compositional matrix adjust.
 Identities = 59/246 (23%), Positives = 98/246 (39%), Gaps = 43/246 (17%)

Query: 18  KTLLAGAVSGLLARSITAPMDTIKIRLQLTPANGLKPFGSQVMEVARSMIKNEGIRSFWK 77
           K  LAGA+      S   P+D +K R+QL P      +   ++   + +I +EG  +   
Sbjct: 15  KFALAGAIGCGTTHSAMVPIDVVKTRIQLEPTV----YNKGMISSFKQIISSEGAGALLT 70

Query: 78  GNIPGSLLYVTYGSAQFSSYSLFNR-YLTPFGLEARL---HSLVVG--AFAGITSSIVSY 131
           G  P  L Y   GS +F  Y +F + ++   G +  +   +S+ +G  A A   + I   
Sbjct: 71  GFGPTLLGYSLQGSFKFGGYEVFKKLFIDVLGYDQAVNYKNSIYIGSAAIAEFFADIALC 130

Query: 132 PFDVLRTRLVANNQMHSMSITREVRDIWKLEGLPGFFKG-----------SIASMTTITL 180
           P +  R RLV+     +  +    R I K EG   F+ G           +IA       
Sbjct: 131 PLEATRIRLVSQPTFANGLVGGFSR-ILKEEGAGSFYNGFTPILFKQIPYNIAKFLVFER 189

Query: 181 TASIMFGTYETIRIYCDENEKTTAAHKKWELAT-----LNHSAGTIGGVIAKIITFPLET 235
            A + FG                 A  K  L+T     +N  +G   G+ A I++ P +T
Sbjct: 190 AAEVYFGM----------------AGPKESLSTASTTGINLLSGLTAGLAAAIVSQPADT 233

Query: 236 IRRRMQ 241
           +  ++ 
Sbjct: 234 LLSKVN 239

 Score = 46.6 bits (109), Expect = 1e-05,   Method: Compositional matrix adjust.
 Identities = 48/192 (25%), Positives = 77/192 (40%), Gaps = 20/192 (10%)

Query: 117 VVGAFAGITSSIVSYPFDVLRTRLVANNQMHSMSITREVRDIWKLEGLPGFFKGSIASMT 176
           + GA    T+     P DV++TR+     +++  +    + I   EG      G   ++ 
Sbjct: 18  LAGAIGCGTTHSAMVPIDVVKTRIQLEPTVYNKGMISSFKQIISSEGAGALLTGFGPTLL 77

Query: 177 TITLTASIMFGTYETI-RIYCDENEKTTAAHKKWELATLNHSAGTIGGVIAKIITFPLET 235
             +L  S  FG YE   +++ D      A + K    ++   +  I    A I   PLE 
Sbjct: 78  GYSLQGSFKFGGYEVFKKLFIDVLGYDQAVNYK---NSIYIGSAAIAEFFADIALCPLEA 134

Query: 236 IRRRMQFMNSKHLEKFSRHSSVYGSYKGYGFARIGLQILKQEGVSSLYRGILVALSKTIP 295
            R R+       + + +  + + G     GF+R    ILK+EG  S Y G    L K IP
Sbjct: 135 TRIRL-------VSQPTFANGLVG-----GFSR----ILKEEGAGSFYNGFTPILFKQIP 178

Query: 296 TTFVSFWGYETA 307
                F  +E A
Sbjct: 179 YNIAKFLVFERA 190

 Score = 44.3 bits (103), Expect = 6e-05,   Method: Compositional matrix adjust.
 Identities = 49/183 (26%), Positives = 79/183 (43%), Gaps = 23/183 (12%)

Query: 24  AVSGLLARSITAPMDTIKIRL--QLTPANGLKPFGSQVMEVARSMIKNEGIRSFWKGNIP 81
           A++   A     P++  +IRL  Q T ANGL      V   +R ++K EG  SF+ G  P
Sbjct: 119 AIAEFFADIALCPLEATRIRLVSQPTFANGL------VGGFSR-ILKEEGAGSFYNGFTP 171

Query: 82  GSLLYVTYGSAQFSSYSLFNR----YLTPFGLEARLHS-------LVVGAFAGITSSIVS 130
                + Y  A+F    +F R    Y    G +  L +       L+ G  AG+ ++IVS
Sbjct: 172 ILFKQIPYNIAKFL---VFERAAEVYFGMAGPKESLSTASTTGINLLSGLTAGLAAAIVS 228

Query: 131 YPFDVLRTRLVANNQMHSMSITREVRDIWKLEGLPGFFKGSIASMTTITLTASIMFGTYE 190
            P D L +++    +    S    +  + K  G  G F G    +  +    S+ FG Y 
Sbjct: 229 QPADTLLSKVNKTKKAPGQSTIGLLAQLAKQLGFVGSFAGLPTRLVMVGTLTSLQFGIYG 288

Query: 191 TIR 193
           +++
Sbjct: 289 SLK 291

>AAL014C [173] [Homologous to ScYNL003C (PET8) - SH]
           (317388..318203) [816 bp, 271 aa]
          Length = 271

 Score = 46.2 bits (108), Expect = 1e-05,   Method: Compositional matrix adjust.
 Identities = 53/195 (27%), Positives = 90/195 (46%), Gaps = 30/195 (15%)

Query: 113 LHSLVVGAFAGITSSIVSYPFDVLRTRLVANNQMHSMSITREVRDIWKLEGLPGFFKGSI 172
           L SLV GA AG ++ +V +P D L+TRL A                +   G  G ++G  
Sbjct: 6   LASLVSGAAAGTSTDVVFFPIDTLKTRLQAKG------------GFFHNGGYRGIYRGLG 53

Query: 173 ASMTTITLTASIMFGTYETIRIYCDE-NEKTTAAHKKWELATLNHSAGTIGGVIAKIITF 231
           +++      AS+ F TY++++        + TA+ +  E+ T   S+ ++G + A ++  
Sbjct: 54  SAVVASAPGASLFFVTYDSMKQQLRPVMGRWTASEQLAEVLTHMLSS-SLGEMSACLVRV 112

Query: 232 PLETIRRRMQFMNSKHLEKFSRHSSVYGSYKGYGFARIGLQILKQEG-VSSLYRGILVAL 290
           P E I++R Q  ++        +SS+          R+ L+    EG V  LYRG    +
Sbjct: 113 PAEVIKQRTQTHHT--------NSSLQT-------LRLILRDPTGEGVVRGLYRGWWTTI 157

Query: 291 SKTIPTTFVSFWGYE 305
            + IP T + F  YE
Sbjct: 158 MREIPFTCIQFPLYE 172

 Score = 41.6 bits (96), Expect = 4e-04,   Method: Compositional matrix adjust.
 Identities = 56/239 (23%), Positives = 100/239 (41%), Gaps = 34/239 (14%)

Query: 19  TLLAGAVSGLLARSITAPMDTIKIRLQLTPANGLKPFGSQVMEVARSMIKNEGIRSFWKG 78
           +L++GA +G     +  P+DT+K RLQ   A G                 N G R  ++G
Sbjct: 8   SLVSGAAAGTSTDVVFFPIDTLKTRLQ---AKG-------------GFFHNGGYRGIYRG 51

Query: 79  -------NIPG-SLLYVTYGSAQFSSYSLFNRYLTPFGLEARLHSLVVGAFAGITSSIVS 130
                  + PG SL +VTY S +     +  R+     L   L  ++  +   +++ +V 
Sbjct: 52  LGSAVVASAPGASLFFVTYDSMKQQLRPVMGRWTASEQLAEVLTHMLSSSLGEMSACLVR 111

Query: 131 YPFDVLRTRLVANNQMHSMSITREV-RDIWKLEGLPGFFKGSIASMTTITLTASIMFGTY 189
            P +V++ R   ++   S+   R + RD      + G ++G   ++        I F  Y
Sbjct: 112 VPAEVIKQRTQTHHTNSSLQTLRLILRDPTGEGVVRGLYRGWWTTIMREIPFTCIQFPLY 171

Query: 190 ETIRIYCDENEKTTAAHKKWELATLNHSA--GTIGGVIAKIITFPLETIRRRMQFMNSK 246
           E ++       K  AA+ + E  +    A  G++ G IA   T PL+ ++ RM     +
Sbjct: 172 EYLK-------KKWAAYAEIERVSAWQGAVCGSLAGGIAAAATTPLDVLKTRMMLHERR 223

 Score = 37.0 bits (84), Expect = 0.011,   Method: Compositional matrix adjust.
 Identities = 23/83 (27%), Positives = 48/83 (57%), Gaps = 7/83 (8%)

Query: 12  QNVAAWKTLLAGAVSGLLARSITAPMDTIKIRLQLTPANGLKPFGSQVMEVARSMIKNEG 71
           + V+AW+  + G+++G +A + T P+D +K R+ L            ++ +AR++ + EG
Sbjct: 185 ERVSAWQGAVCGSLAGGIAAAATTPLDVLKTRMMLHERR------VPMLHLARTLFREEG 238

Query: 72  IRSFWKGNIPGSLLYVTYGSAQF 94
            R F++G  P + ++++ G A F
Sbjct: 239 ARVFFRGIGPRT-MWISAGGAIF 260

 Score = 36.6 bits (83), Expect = 0.017,   Method: Compositional matrix adjust.
 Identities = 40/177 (22%), Positives = 75/177 (42%), Gaps = 19/177 (10%)

Query: 23  GAVSGLLARSITAPMDTIKIRLQLTPANGLKPFGSQVMEVARSMIKN---EGI-RSFWKG 78
           G +S  L R    P + IK R Q    N         ++  R ++++   EG+ R  ++G
Sbjct: 103 GEMSACLVR---VPAEVIKQRTQTHHTN-------SSLQTLRLILRDPTGEGVVRGLYRG 152

Query: 79  NIPGSLLYVTYGSAQFSSYSLFNRYLTPFGLEARL---HSLVVGAFAGITSSIVSYPFDV 135
                +  + +   QF  Y    +    +    R+      V G+ AG  ++  + P DV
Sbjct: 153 WWTTIMREIPFTCIQFPLYEYLKKKWAAYAEIERVSAWQGAVCGSLAGGIAAAATTPLDV 212

Query: 136 LRTRLVANNQMHSMSITREVRDIWKLEGLPGFFKGSIASMTTITLTASIMFGTYETI 192
           L+TR++ + +   + +    R +++ EG   FF+G       I+   +I  G YE +
Sbjct: 213 LKTRMMLHER--RVPMLHLARTLFREEGARVFFRGIGPRTMWISAGGAIFLGVYEAV 267

>KLLA0D09889g complement(834904..835998) similar to sp|Q03829
           Saccharomyces cerevisiae YMR166c, start by similarity
          Length = 364

 Score = 46.2 bits (108), Expect = 1e-05,   Method: Compositional matrix adjust.
 Identities = 68/270 (25%), Positives = 119/270 (44%), Gaps = 36/270 (13%)

Query: 37  MDTIKIRLQLTPANGLKPFGSQVMEVARSMIKNEGIRSFWKGNIPGSLLYVTYGSAQ--F 94
           +DT+K R Q  P+         ++   R++I  EG+R    G   G++L  ++ SA   F
Sbjct: 76  LDTVKTRQQGAPSTVKY---KNMIGAYRTIILEEGLRKGLYGGYSGAML-GSFPSAAIFF 131

Query: 95  SSYSLFNRYLT-PFGLEARLHSLVVGAFAGITSSIVSYPFDVLRTRLVANNQMHS----- 148
           ++Y    R +   +G+      L  G      SS V  P +VL+TRL    + ++     
Sbjct: 132 ATYEYTKRKMIGEWGINETFSHLTAGFLGDFISSFVYVPSEVLKTRLQLQGRYNNPFFRS 191

Query: 149 ----MSITREVRDIWKLEGLPGFFKGSIASMTTITLTASIMFGTYETIRIYCDENEKTTA 204
                ++T  V  I + EG P  F G  A+++     + + F  YE  R      E  T 
Sbjct: 192 GYNYKNLTDAVTTIVRREGWPTLFFGYKATLSRDLPFSGLQFAFYEKFRQLAFAVENKTF 251

Query: 205 AHKKWELATLNH-SAGTIGGVIAKIITFPLETIRRRMQFM-------NSKHLEKFSRHSS 256
                +L+  N    G   G +A IIT PL+ ++ R+Q         +S++L++ +  +S
Sbjct: 252 DE---DLSLSNEIITGAAAGGLAGIITTPLDVVKTRIQTQLPDIPENSSQNLKQQTLTNS 308

Query: 257 VYGSYKGYGFARIGLQILKQEGVSSLYRGI 286
           +    KG       + + K EG++ L+ G+
Sbjct: 309 I---TKGM------MTVYKTEGLAGLFSGV 329

 Score = 37.7 bits (86), Expect = 0.010,   Method: Compositional matrix adjust.
 Identities = 45/197 (22%), Positives = 85/197 (43%), Gaps = 28/197 (14%)

Query: 20  LLAGAVSGLLARSITAPMDTIKIRLQLTPANGLKPFGS-----QVMEVARSMIKNEGIRS 74
           L AG +   ++  +  P + +K RLQL        F S      + +   ++++ EG  +
Sbjct: 154 LTAGFLGDFISSFVYVPSEVLKTRLQLQGRYNNPFFRSGYNYKNLTDAVTTIVRREGWPT 213

Query: 75  FWKGNIPGSLLYVTYGSAQFSSYSLFNRYLTPFGLEARL--------HSLVVGAFAGITS 126
            + G        + +   QF+ Y  F +    F +E +         + ++ GA AG  +
Sbjct: 214 LFFGYKATLSRDLPFSGLQFAFYEKFRQLA--FAVENKTFDEDLSLSNEIITGAAAGGLA 271

Query: 127 SIVSYPFDVLRTRL------VANNQMHSM-------SITREVRDIWKLEGLPGFFKGSIA 173
            I++ P DV++TR+      +  N   ++       SIT+ +  ++K EGL G F G   
Sbjct: 272 GIITTPLDVVKTRIQTQLPDIPENSSQNLKQQTLTNSITKGMMTVYKTEGLAGLFSGVGP 331

Query: 174 SMTTITLTASIMFGTYE 190
                ++ +SIM   Y+
Sbjct: 332 RFIWTSIQSSIMLLLYQ 348

 Score = 37.4 bits (85), Expect = 0.012,   Method: Compositional matrix adjust.
 Identities = 43/157 (27%), Positives = 70/157 (44%), Gaps = 26/157 (16%)

Query: 156 RDIWKLEGL-PGFFKGSIASMTTITLTASIMFGTYE-TIRIYCDENEKTTAAHKKWEL-A 212
           R I   EGL  G + G   +M     +A+I F TYE T R    E          W +  
Sbjct: 100 RTIILEEGLRKGLYGGYSGAMLGSFPSAAIFFATYEYTKRKMIGE----------WGINE 149

Query: 213 TLNH-SAGTIGGVIAKIITFPLETIRRRMQFMNSKHLEKFSRHSSVYGSYKGYGFARIG- 270
           T +H +AG +G  I+  +  P E ++ R+Q +  ++   F R         GY +  +  
Sbjct: 150 TFSHLTAGFLGDFISSFVYVPSEVLKTRLQ-LQGRYNNPFFR--------SGYNYKNLTD 200

Query: 271 --LQILKQEGVSSLYRGILVALSKTIPTTFVSFWGYE 305
               I+++EG  +L+ G    LS+ +P + + F  YE
Sbjct: 201 AVTTIVRREGWPTLFFGYKATLSRDLPFSGLQFAFYE 237

>CAGL0J04114g complement(384321..385232) similar to sp|Q99297
           Saccharomyces cerevisiae YOR222w ODC2 or sp|Q03028
           Saccharomyces cerevisiae YPL134c ODC1, start by
           similarity
          Length = 303

 Score = 45.8 bits (107), Expect = 2e-05,   Method: Compositional matrix adjust.
 Identities = 49/212 (23%), Positives = 92/212 (43%), Gaps = 18/212 (8%)

Query: 20  LLAGAVSGLLARSITAPMDTIKIRLQLTPANGLKPFGS-----QVMEVARSMIKNEGIRS 74
            ++GA +G+    +  P+D +K R+QL   +G    GS      V++    ++K EG   
Sbjct: 12  FVSGAAAGVSELLVMYPLDVVKTRMQLQVGSGT---GSGVAYNGVIDCLGQIVKREGFSR 68

Query: 75  FWKGNIPGSLLYVTYGSAQFSSYSLFNRYLTP-FGLEARLH--SLVVGAFAGITSSIVSY 131
            +KG     L+     + +F+    + +     +G++      S++ G+ AG+T + V  
Sbjct: 69  LYKGISSPMLMEAPKRATKFACNDSYQKMFKDLYGVDKLTQQISILSGSLAGVTEACVIV 128

Query: 132 PFDVLRTRLVANNQMHSMSITREVRDIWKLEGLPGFFKGSIASMTTITLTASIMFGTYET 191
           PF++++ RL   N   +  +    + I +  G+   + G  ++M          FG    
Sbjct: 129 PFELVKIRLQDVNSKFNGPMEVVFKTI-RETGILSLYNGLESTMWRNAFWNGGYFGVIFQ 187

Query: 192 IRIYCDENEKTTAAHKKWELATLNHSAGTIGG 223
           IR    + +  T      E  T +  AGTIGG
Sbjct: 188 IRALLPKAKTNT------EKTTNDLIAGTIGG 213

 Score = 41.2 bits (95), Expect = 6e-04,   Method: Compositional matrix adjust.
 Identities = 43/188 (22%), Positives = 77/188 (40%), Gaps = 43/188 (22%)

Query: 113 LHSLVVGAFAGITSSIVSYPFDVLRTRL-----------VANNQMHSMSITREVRDIWKL 161
           ++  V GA AG++  +V YP DV++TR+           VA N      +   +  I K 
Sbjct: 9   IYQFVSGAAAGVSELLVMYPLDVVKTRMQLQVGSGTGSGVAYN-----GVIDCLGQIVKR 63

Query: 162 EGLPGFFKGSIASMTTITLTASIMFGTYETIRIYCDEN-EKTTAAHKKWELATLNHS--A 218
           EG    +KG  + M        +M       +  C+++ +K        +  T   S  +
Sbjct: 64  EGFSRLYKGISSPM--------LMEAPKRATKFACNDSYQKMFKDLYGVDKLTQQISILS 115

Query: 219 GTIGGVIAKIITFPLETIRRRMQFMNSKHLEKFSRHSSVYGSYKGYGFARIGLQILKQEG 278
           G++ GV    +  P E ++ R+Q +NSK                  G   +  + +++ G
Sbjct: 116 GSLAGVTEACVIVPFELVKIRLQDVNSKF----------------NGPMEVVFKTIRETG 159

Query: 279 VSSLYRGI 286
           + SLY G+
Sbjct: 160 ILSLYNGL 167

 Score = 32.3 bits (72), Expect = 0.37,   Method: Compositional matrix adjust.
 Identities = 18/60 (30%), Positives = 31/60 (51%), Gaps = 5/60 (8%)

Query: 19  TLLAGAVSGLLARSITAPMDTIKIRLQLTPANGLKPFGSQVMEVARSMIKNEGIRSFWKG 78
           ++L+G+++G+    +  P + +KIRLQ   +    P     MEV    I+  GI S + G
Sbjct: 112 SILSGSLAGVTEACVIVPFELVKIRLQDVNSKFNGP-----MEVVFKTIRETGILSLYNG 166

>YPR128C (ANT1) [5547] chr16 complement(791212..792198)
           Peroxisome-localized protein involved in adenine
           nucleotide transport, medium-chain fatty acid
           metabolism, and peroxisome proliferation, has similarity
           to ADP/ATP carrier proteins [987 bp, 328 aa]
          Length = 328

 Score = 45.8 bits (107), Expect = 2e-05,   Method: Compositional matrix adjust.
 Identities = 70/305 (22%), Positives = 125/305 (40%), Gaps = 55/305 (18%)

Query: 21  LAGAVSGLLARSITAPMDTIK--IRLQLTPANGLKPFGSQVM------EVARSMI---KN 69
           L GAV+  +A     P+D  K  I+ Q++P++       +V+       V   MI   K 
Sbjct: 8   LTGAVASAMANIAVYPLDLSKTIIQSQVSPSSSEDSNEGKVLPNRRYKNVVDCMINIFKE 67

Query: 70  EGIRSFWKG-------NIPGSLLYVTYGSAQFSSY---------SLFNRY--LTPFGLEA 111
           +GI   ++G           + +Y  + +    SY         SL NR   +TP  +E 
Sbjct: 68  KGILGLYQGMTVTTVATFVQNFVYFFWYTFIRKSYMKHKLLGLQSLKNRDGPITPSTIE- 126

Query: 112 RLHSLVVGAFAGITSSIVSYPFDVLRTRLVANNQMHSMSITREVRDIWKLEG--LPGFFK 169
               LV+G  A   S + + P  V+ TR    +   S   T  ++DI++     +  F+K
Sbjct: 127 ---ELVLGVAAASISQLFTSPMAVVATRQQTVHSAESAKFTNVIKDIYRENNGDITAFWK 183

Query: 170 GSIASMTTITLTASIMFGTYETIRIYCDENEKTTAAHKKWELATLNHSAGTIGGVIAKII 229
           G + +   +T+  SI + +++ ++     +    A       A  N   G +  +I+ ++
Sbjct: 184 G-LRTGLALTINPSITYASFQRLKEVFFHDHSNDAGSLS---AVQNFILGVLSKMISTLV 239

Query: 230 TFPLETIRRRMQFMNSKHLEKFSRHSSVYGSYKGYGFARIGLQILKQEGVSSLYRGILVA 289
           T PL   +  +Q   SK                   F    L + K EG+ SL++G+L  
Sbjct: 240 TQPLIVAKAMLQSAGSKFTT----------------FQEALLYLYKNEGLKSLWKGVLPQ 283

Query: 290 LSKTI 294
           L+K +
Sbjct: 284 LTKGV 288

 Score = 43.9 bits (102), Expect = 9e-05,   Method: Compositional matrix adjust.
 Identities = 37/172 (21%), Positives = 76/172 (44%), Gaps = 7/172 (4%)

Query: 20  LLAGAVSGLLARSITAPMDTIKIRLQLTPANGLKPFGSQVMEVARSMIKNEGIRSFWKGN 79
           L+ G  +  +++  T+PM  +  R Q   +     F + + ++ R    N  I +FWKG 
Sbjct: 128 LVLGVAAASISQLFTSPMAVVATRQQTVHSAESAKFTNVIKDIYRE--NNGDITAFWKGL 185

Query: 80  IPGSLLYV----TYGSAQFSSYSLFNRYLTPFGLEARLHSLVVGAFAGITSSIVSYPFDV 135
             G  L +    TY S Q      F+ +    G  + + + ++G  + + S++V+ P  V
Sbjct: 186 RTGLALTINPSITYASFQRLKEVFFHDHSNDAGSLSAVQNFILGVLSKMISTLVTQPLIV 245

Query: 136 LRTRLVANNQMHSMSITREVRDIWKLEGLPGFFKGSIASMTTITLTASIMFG 187
            +  L +     + +    +  ++K EGL   +KG +  +T   +   ++F 
Sbjct: 246 AKAMLQSAGSKFT-TFQEALLYLYKNEGLKSLWKGVLPQLTKGVIVQGLLFA 296

 Score = 33.9 bits (76), Expect = 0.15,   Method: Compositional matrix adjust.
 Identities = 20/77 (25%), Positives = 37/77 (48%), Gaps = 5/77 (6%)

Query: 5   EDSLRKGQNVAAWKTLLAGAVSGLLARSITAPMDTIKIRLQLTPANGLKPFGSQVMEVAR 64
            D      +++A +  + G +S +++  +T P+   K  LQ +  +    F     E   
Sbjct: 211 HDHSNDAGSLSAVQNFILGVLSKMISTLVTQPLIVAKAMLQ-SAGSKFTTF----QEALL 265

Query: 65  SMIKNEGIRSFWKGNIP 81
            + KNEG++S WKG +P
Sbjct: 266 YLYKNEGLKSLWKGVLP 282

>KLLA0D04950g 424550..425374 similar to sp|P38921 Saccharomyces
           cerevisiae YNL003c PET8 member of the mitochondrial
           carrier (MCF) family, start by similarity
          Length = 274

 Score = 45.4 bits (106), Expect = 2e-05,   Method: Compositional matrix adjust.
 Identities = 47/200 (23%), Positives = 82/200 (41%), Gaps = 42/200 (21%)

Query: 115 SLVVGAFAGITSSIVSYPFDVLRTRLVANNQMHSMSITREVRDIWKLEGLPGFFKGSIAS 174
           SLV GA AG ++ +  +P D L+TRL A     +              G  G ++G  ++
Sbjct: 9   SLVSGAAAGTSTDLAFFPIDTLKTRLQAKGGFFANG------------GYKGVYRGLGSA 56

Query: 175 MTTITLTASIMFGTYETIRIYC--------DENEKTTAAHKKWELATLNHS-AGTIGGVI 225
           +     +AS+ F  Y++++ +          + E  TA        TL+H  + + G + 
Sbjct: 57  VVASAPSASLFFVAYDSMKCWSRPVIGQLLPKGEDQTA-------DTLSHMVSSSFGEIS 109

Query: 226 AKIITFPLETIRRRMQFMNSKHLEKFSRHSSVYGSYKGYGFARIGLQILKQEGVSSLYRG 285
           A ++  P E I++R Q   +          ++  +  G G  R            +LYRG
Sbjct: 110 ACMVRVPAEVIKQRTQTHRTN--SSLQTLQALLRNENGEGLRR------------NLYRG 155

Query: 286 ILVALSKTIPTTFVSFWGYE 305
               + + IP T + F  YE
Sbjct: 156 WSTTIMREIPFTCIQFPLYE 175

 Score = 34.7 bits (78), Expect = 0.070,   Method: Compositional matrix adjust.
 Identities = 44/177 (24%), Positives = 80/177 (45%), Gaps = 19/177 (10%)

Query: 23  GAVSGLLARSITAPMDTIKIRLQLTPANGLKPFGSQVMEVARSMIKNE---GIR-SFWKG 78
           G +S  + R    P + IK R Q    N         ++  +++++NE   G+R + ++G
Sbjct: 106 GEISACMVR---VPAEVIKQRTQTHRTN-------SSLQTLQALLRNENGEGLRRNLYRG 155

Query: 79  NIPGSLLYVTYGSAQFSSYS-LFNRYLTPFGLE--ARLHSLVVGAFAGITSSIVSYPFDV 135
                +  + +   QF  Y  +  R+    G E  A     V G  AG  ++  + P DV
Sbjct: 156 WSTTIMREIPFTCIQFPLYEYMKKRWAEVQGKERAAPWQGSVCGCIAGGIAAAATTPLDV 215

Query: 136 LRTRLVANNQMHSMSITREVRDIWKLEGLPGFFKGSIASMTTITLTASIMFGTYETI 192
           L+TR++ +++  S+S     + + + EG+  FF G       I+   +I  G YET+
Sbjct: 216 LKTRIMLHHK--SVSALHLAKTMLQEEGVKVFFSGVGPRTMWISAGGAIFLGVYETV 270

 Score = 32.7 bits (73), Expect = 0.33,   Method: Compositional matrix adjust.
 Identities = 49/188 (26%), Positives = 78/188 (41%), Gaps = 31/188 (16%)

Query: 19  TLLAGAVSGLLARSITAPMDTIKIRLQLTP---ANG-----LKPFGSQVMEVARSMIKNE 70
           +L++GA +G        P+DT+K RLQ      ANG      +  GS V+  A S     
Sbjct: 9   SLVSGAAAGTSTDLAFFPIDTLKTRLQAKGGFFANGGYKGVYRGLGSAVVASAPS----- 63

Query: 71  GIRSFWKGNIPGSLLYVTYGSAQFSSYSLFNRYLTPFGLEA---RLHSLVVGAFAGITSS 127
                       SL +V Y S +  S  +  + L P G +     L  +V  +F  I++ 
Sbjct: 64  -----------ASLFFVAYDSMKCWSRPVIGQLL-PKGEDQTADTLSHMVSSSFGEISAC 111

Query: 128 IVSYPFDVLRTRLVANNQMHSMSITREVRDIWKLEGL-PGFFKG-SIASMTTITLTASIM 185
           +V  P +V++ R   +    S+   + +      EGL    ++G S   M  I  T  I 
Sbjct: 112 MVRVPAEVIKQRTQTHRTNSSLQTLQALLRNENGEGLRRNLYRGWSTTIMREIPFTC-IQ 170

Query: 186 FGTYETIR 193
           F  YE ++
Sbjct: 171 FPLYEYMK 178

 Score = 31.2 bits (69), Expect = 0.89,   Method: Compositional matrix adjust.
 Identities = 23/94 (24%), Positives = 50/94 (53%), Gaps = 7/94 (7%)

Query: 1   MFKEEDSLRKGQNVAAWKTLLAGAVSGLLARSITAPMDTIKIRLQLTPANGLKPFGSQVM 60
           M K    ++  +  A W+  + G ++G +A + T P+D +K R+ L   +         +
Sbjct: 177 MKKRWAEVQGKERAAPWQGSVCGCIAGGIAAAATTPLDVLKTRIMLHHKS------VSAL 230

Query: 61  EVARSMIKNEGIRSFWKGNIPGSLLYVTYGSAQF 94
            +A++M++ EG++ F+ G  P + ++++ G A F
Sbjct: 231 HLAKTMLQEEGVKVFFSGVGPRT-MWISAGGAIF 263

>Scas_562.12
          Length = 300

 Score = 45.4 bits (106), Expect = 3e-05,   Method: Compositional matrix adjust.
 Identities = 50/183 (27%), Positives = 85/183 (46%), Gaps = 21/183 (11%)

Query: 3   KEEDSLRKGQNVAAWKTLLAGAVSGLLARSITAPMDTIKIRLQLTPANGLKPFGSQVMEV 62
           K+ DS    +   A ++  AG++ G+    +  P+D +KI+ Q  P    K  G   +++
Sbjct: 106 KDFDSAFGEKTGKAMRSATAGSLIGI-GEIVLLPLDVLKIKRQTNP-EAFK--GRGFVKI 161

Query: 63  ARSMIKNEGIRSFWKG-------NIPGSLLYVTYGSAQFS-SYSLFNRYLTPFGLEARLH 114
               +K+EGI + ++G       N PGS  +  +G   F+  Y L     +         
Sbjct: 162 ----LKDEGIFNLYRGWGWTAARNAPGS--FALFGGNAFAKEYILGLEDYSQASWSQNFI 215

Query: 115 SLVVGAFAGITSSIVSYPFDVLRTRLVANNQMHSMSITREVRDIWKLEGLPGFFKGSIAS 174
           S +VGA     S IVS P DV++TR+   +  +  +    V++ +K EG+  FFKG    
Sbjct: 216 SSIVGA---SCSLIVSAPLDVIKTRIQNRSFDNPETGLTIVKNTFKNEGITAFFKGLTPK 272

Query: 175 MTT 177
           + T
Sbjct: 273 LLT 275

 Score = 35.0 bits (79), Expect = 0.052,   Method: Compositional matrix adjust.
 Identities = 50/197 (25%), Positives = 88/197 (44%), Gaps = 28/197 (14%)

Query: 116 LVVGAFAGITSSIVSYPFDVLRTRLVANN----QMHSMS--ITREVRDIWKLEGLPGFFK 169
           L+  A AGI    V +P D +  RL++N+      H ++  I RE       + L   F 
Sbjct: 14  LLGSASAGILEIGVFHPVDTISKRLMSNHTKIGNSHELNRVIFREHFSEPLGKRLFTLFP 73

Query: 170 GSIASMTTITLTASIMFGTYETIRIYCDENEK---TTAAHKKWELATLNHSAGTIGGVIA 226
           G   + +   L     +G       + +++ K    +A  +K   A  + +AG++ G I 
Sbjct: 74  GLGYAASYKVLQRVYKYGGQPFANEFLNKHYKKDFDSAFGEKTGKAMRSATAGSLIG-IG 132

Query: 227 KIITFPLETIRRRMQFMNSKHLEKFSRHSSVYGSYKGYGFARIGLQILKQEGVSSLYRGI 286
           +I+  PL+ ++ + Q  N +             ++KG GF    ++ILK EG+ +LYRG 
Sbjct: 133 EIVLLPLDVLKIKRQ-TNPE-------------AFKGRGF----VKILKDEGIFNLYRGW 174

Query: 287 LVALSKTIPTTFVSFWG 303
               ++  P +F  F G
Sbjct: 175 GWTAARNAPGSFALFGG 191

 Score = 32.3 bits (72), Expect = 0.36,   Method: Compositional matrix adjust.
 Identities = 76/318 (23%), Positives = 117/318 (36%), Gaps = 64/318 (20%)

Query: 9   RKGQNVAAWKTLLAGAVSGLLARSITAPMDTIKIRLQLTPANGLKPFGSQVMEVARSMIK 68
           RK   VA    LL  A +G+L   +  P+DTI  RL    +N  K   S   E+ R + +
Sbjct: 6   RKQSGVA---RLLGSASAGILEIGVFHPVDTISKRLM---SNHTKIGNSH--ELNRVIFR 57

Query: 69  NE-----GIRSFWKGNIPGSLLYVT----------YGSAQFSSYSLFNRYLTPFGLE--- 110
                  G R F     PG L Y            YG   F++  L   Y   F      
Sbjct: 58  EHFSEPLGKRLFTL--FPG-LGYAASYKVLQRVYKYGGQPFANEFLNKHYKKDFDSAFGE 114

Query: 111 ---ARLHSLVVGAFAGITSSIVSYPFDVLRTRLVANNQMHSMSITREVRDIWKLEGLPGF 167
                + S   G+  GI   IV  P DVL+ +   N +       R    I K EG+   
Sbjct: 115 KTGKAMRSATAGSLIGI-GEIVLLPLDVLKIKRQTNPEAFK---GRGFVKILKDEGIFNL 170

Query: 168 FKGSIASMTTITLTASIMFGTYETIRIYCDENEKTTAAHKKWELATLNHSAGTIGGVIAK 227
           ++G   +       +  +FG     + Y    E  + A   W   + N  +  +G   + 
Sbjct: 171 YRGWGWTAARNAPGSFALFGGNAFAKEYILGLEDYSQA--SW---SQNFISSIVGASCSL 225

Query: 228 IITFPLETIRRRMQFMNSKHLEKFSRHSSVYGSYKGYGFARIGLQILKQ----EGVSSLY 283
           I++ PL+ I+ R+Q                    + +     GL I+K     EG+++ +
Sbjct: 226 IVSAPLDVIKTRIQ-------------------NRSFDNPETGLTIVKNTFKNEGITAFF 266

Query: 284 RGILVALSKTIPTTFVSF 301
           +G+   L  T P    SF
Sbjct: 267 KGLTPKLLTTGPKLVFSF 284

>KLLA0F13464g 1246646..1247548 highly similar to sp|P38988
           Saccharomyces cerevisiae YDL198c YHM1 member of the
           mitochondrial carrier family (MCF), start by similarity
          Length = 300

 Score = 44.7 bits (104), Expect = 4e-05,   Method: Compositional matrix adjust.
 Identities = 45/169 (26%), Positives = 76/169 (44%), Gaps = 20/169 (11%)

Query: 16  AWKTLLAGAVSGLLARSITAPMDTIKIRLQLTPANGLKPFGSQVMEVARSMIKNEGIRSF 75
           A ++  AG++ G+    +  P+D +KI+ Q  P +  K  G   +++    IK+EG    
Sbjct: 119 ALRSATAGSLIGI-GEIVLLPLDVLKIKRQTNPES-FK--GRGFLKI----IKDEGF-GL 169

Query: 76  WKG-------NIPGSLLYVTYGSAQFSSYSLFNRYLTPFGLEARLHSLVVGAFAGITSSI 128
           ++G       N PGS  +  +G   F+   +    L  +G      + V        S I
Sbjct: 170 YRGWGWTAARNAPGS--FALFGGNAFAKEYILG--LKDYGQATWSQNFVSSIVGASASLI 225

Query: 129 VSYPFDVLRTRLVANNQMHSMSITREVRDIWKLEGLPGFFKGSIASMTT 177
           VS P DV++TR+   N  +  S  + +++  K EG   FFKG    + T
Sbjct: 226 VSAPLDVIKTRIQNRNFDNPESGFKIIKNTLKNEGFTAFFKGLTPKLLT 274

 Score = 33.1 bits (74), Expect = 0.22,   Method: Compositional matrix adjust.
 Identities = 50/198 (25%), Positives = 77/198 (38%), Gaps = 29/198 (14%)

Query: 113 LHSLVVGAFAGITSSIVSYPFDVLRTRLVANNQMHSMSITREVRDIWKLEGLPGFFKGSI 172
           L S   G+  GI   IV  P DVL+ +   N +       R    I K EG  G ++G  
Sbjct: 120 LRSATAGSLIGI-GEIVLLPLDVLKIKRQTNPESFK---GRGFLKIIKDEGF-GLYRGWG 174

Query: 173 ASMTTITLTASIMFGTYETIRIYCDENEKTTAAHKKWELAT--LNHSAGTIGGVIAKIIT 230
            +       +  +FG     + Y           K +  AT   N  +  +G   + I++
Sbjct: 175 WTAARNAPGSFALFGGNAFAKEYI-------LGLKDYGQATWSQNFVSSIVGASASLIVS 227

Query: 231 FPLETIRRRMQFMNSKHLEKFSRHSSVYGSYKGYGFARIGLQILKQEGVSSLYRGILVAL 290
            PL+ I+ R+Q  N  + E               GF +I    LK EG ++ ++G+   L
Sbjct: 228 APLDVIKTRIQNRNFDNPES--------------GF-KIIKNTLKNEGFTAFFKGLTPKL 272

Query: 291 SKTIPTTFVSFWGYETAI 308
             T P    SF   +T I
Sbjct: 273 LTTGPKLVFSFALAQTLI 290

 Score = 32.3 bits (72), Expect = 0.40,   Method: Compositional matrix adjust.
 Identities = 52/204 (25%), Positives = 88/204 (43%), Gaps = 31/204 (15%)

Query: 110 EARLHSLVVGAFAGITSSIVSYPFDVLRTRLVANN-------QMHSMSITREVRDIWKLE 162
           ++ L  ++  A AGI    V +P D +  RL++N+       Q++S+ I R+        
Sbjct: 8   QSGLARVLGSASAGILEIGVFHPVDTISKRLMSNHTKIASTSQLNSV-IFRDFASEPLGR 66

Query: 163 GLPGFFKGSIASMTTITLTASIMFGTYETIRIYCDENEK---TTAAHKKWELATLNHSAG 219
            L   F G   +     L     +G       + ++N K     A  +K   A  + +AG
Sbjct: 67  RLLSLFPGLGYAAAYKILQRVYKYGGQPFANEFLNKNFKGDFDQAFGEKTGKALRSATAG 126

Query: 220 TIGGVIAKIITFPLETIRRRMQFMNSKHLEKFSRHSSVYGSYKGYGFARIGLQILKQEGV 279
           ++ G I +I+  PL+ ++ + Q  N +             S+KG GF    L+I+K EG 
Sbjct: 127 SLIG-IGEIVLLPLDVLKIKRQ-TNPE-------------SFKGRGF----LKIIKDEGF 167

Query: 280 SSLYRGILVALSKTIPTTFVSFWG 303
             LYRG     ++  P +F  F G
Sbjct: 168 -GLYRGWGWTAARNAPGSFALFGG 190

>CAGL0H10538g 1027739..1028632 highly similar to tr|Q07534
           Saccharomyces cerevisiae YDL119c, hypothetical start
          Length = 297

 Score = 44.7 bits (104), Expect = 5e-05,   Method: Compositional matrix adjust.
 Identities = 58/256 (22%), Positives = 102/256 (39%), Gaps = 45/256 (17%)

Query: 20  LLAGAVSGLLARSITAPMDTIKIRLQLTPANGLKPFGSQVMEVARSMIKNEGIRSFWKGN 79
           L+ G   GL +     P+D +K R Q T        G  + +  +S+   +     W+G 
Sbjct: 8   LIGGFAGGLSSAVALQPLDLLKTRFQQTK-------GGTLWQTVKSL---DTPWQLWRGT 57

Query: 80  IPGSLLYVTYGSAQF-SSYSLFNRYLTP-----------FGLEARL------HSLVVGAF 121
           +P S +  + GSA + SS +L    L              G  + L       +LV GAF
Sbjct: 58  LP-SAIRTSVGSALYLSSLNLMRTALAKRKQFDTADSVVTGKSSNLPQLSMYENLVTGAF 116

Query: 122 AGITSSIVSYPFDVLRTRLVANNQMHSMSITREVRDIWKLEGLPGFFKGSIASMTTITLT 181
           A  T   ++ P  +++ R   +   +  SI    + I   EG+ GFF+G   +       
Sbjct: 117 ARGTVGYITMPITIIKVR-YESTLYNYKSIAEAAKSIAAQEGIRGFFRGFGPTCLRDAPY 175

Query: 182 ASIMFGTYETIR-----------IYCDENEKTTAAHKKWELATLNHSAGTIGGVIAKIIT 230
           + +    YE ++           +  D   + TA    +    +N ++  +   +A  +T
Sbjct: 176 SGLYVLLYEKLKHTLPTILPKSLLQLDSEGRYTA----YTSTAINSTSAILSASMATTVT 231

Query: 231 FPLETIRRRMQFMNSK 246
            P +TI+ RMQ   +K
Sbjct: 232 APFDTIKTRMQLEPTK 247

 Score = 40.8 bits (94), Expect = 7e-04,   Method: Compositional matrix adjust.
 Identities = 53/211 (25%), Positives = 90/211 (42%), Gaps = 26/211 (12%)

Query: 2   FKEEDSLRKGQN-----VAAWKTLLAGAVSGLLARSITAPMDTIKIRLQLTPANGLKPFG 56
           F   DS+  G++     ++ ++ L+ GA +      IT P+  IK+R + T  N      
Sbjct: 88  FDTADSVVTGKSSNLPQLSMYENLVTGAFARGTVGYITMPITIIKVRYESTLYNY----- 142

Query: 57  SQVMEVARSMIKNEGIRSFWKG-------NIPGSLLYV-TYGSAQFSSYSLFNRYLTPFG 108
             + E A+S+   EGIR F++G       + P S LYV  Y   + +  ++  + L    
Sbjct: 143 KSIAEAAKSIAAQEGIRGFFRGFGPTCLRDAPYSGLYVLLYEKLKHTLPTILPKSLLQLD 202

Query: 109 LEAR---LHSLVVGAFAGITS----SIVSYPFDVLRTRLVANNQMHSMSITREVRDIWKL 161
            E R     S  + + + I S    + V+ PFD ++TR+         +    +  I   
Sbjct: 203 SEGRYTAYTSTAINSTSAILSASMATTVTAPFDTIKTRMQLEPTKFK-TFWSTLTTIVTQ 261

Query: 162 EGLPGFFKGSIASMTTITLTASIMFGTYETI 192
           E     F G    +T   L+A I +G YE +
Sbjct: 262 EHPIKIFSGLSMRLTRKALSAGIAWGIYEEL 292

>KLLA0B11319g 988293..989360 similar to sgd|S0006332 Saccharomyces
           cerevisiae YPR128c, start by similarity
          Length = 355

 Score = 44.3 bits (103), Expect = 7e-05,   Method: Compositional matrix adjust.
 Identities = 57/262 (21%), Positives = 110/262 (41%), Gaps = 56/262 (21%)

Query: 58  QVMEVARSMIKNEGIRSFWKGNIPGSLLYVTYGS-AQFSSYSLFNRYLTPF----GLEAR 112
             ++V   + +NEG    + G +  SLL     S + F  Y+L  R+        G  AR
Sbjct: 89  HALDVIVKVYRNEGFGGLYHG-LSASLLGTFIQSFSYFFWYTLIRRHYFRVKKVKGEAAR 147

Query: 113 ---LHSLVVGAFAGITSSIVSYPFDVLRTR------LVANNQMHSMSITREVRDIWKLEG 163
              +  L++   A  TS + + P +++ T+      L  +N   +++     ++++  +G
Sbjct: 148 FSTIEELLLSMLAAATSQLFTNPINIVSTKQQTRRGLEGDNSFKAIA-----KEVYDEDG 202

Query: 164 LPGFFKGSIASMTTITLTASIMFGTYETIRIYCDENEKTTAAHKKWELATLNHSA----- 218
           + GF+K    S+  +T+  SI + + E +        K    H +W    LN S+     
Sbjct: 203 ITGFWKSLKVSLV-LTINPSITYASAEKL--------KDILYHVEWNAKDLNDSSLQLKP 253

Query: 219 ------GTIGGVIAKIITFPLETIRRRMQFMNSKHLEKFSRHSSVYGSYKGYGFARIGLQ 272
                 G +  +I+  +T PL   +  +Q           R SS + S     F  +   
Sbjct: 254 GQNFLIGVLSKIISTCLTHPLIVAKASLQ-----------RSSSKFTS-----FQEVLTY 297

Query: 273 ILKQEGVSSLYRGILVALSKTI 294
           + + EG  +L++G+L  L+K +
Sbjct: 298 LYRHEGAHALWKGLLPQLTKGV 319

 Score = 31.6 bits (70), Expect = 0.81,   Method: Compositional matrix adjust.
 Identities = 22/74 (29%), Positives = 36/74 (48%), Gaps = 11/74 (14%)

Query: 8   LRKGQNVAAWKTLLAGAVSGLLARSITAPMDTIKIRLQLTPANGLKPFGSQVMEVARSMI 67
           L+ GQN       L G +S +++  +T P+   K  LQ + +     F S   EV   + 
Sbjct: 251 LKPGQN------FLIGVLSKIISTCLTHPLIVAKASLQRSSSK----FTS-FQEVLTYLY 299

Query: 68  KNEGIRSFWKGNIP 81
           ++EG  + WKG +P
Sbjct: 300 RHEGAHALWKGLLP 313

>Scas_660.17
          Length = 497

 Score = 43.9 bits (102), Expect = 9e-05,   Method: Compositional matrix adjust.
 Identities = 57/221 (25%), Positives = 93/221 (42%), Gaps = 41/221 (18%)

Query: 50  NGLKPFGSQVMEVARSMIKNEGIRSFWKGNIPG---SLLYVTYGSAQ------------F 94
           N + P   + M++   +I  EG++  W+ N      + L V+  S              F
Sbjct: 221 NLISPASLKTMDILNVLIDKEGLKGLWRANHTTFILNFLGVSINSWLVSLLSSLVSNYFF 280

Query: 95  SSYSLFNRYLTPFGLE--ARLHSLV-VGAFAGITSSIVSYPFDVLRTRLVANNQMHSMSI 151
           SS         P  L   +   SL+ +   A I +++V  P D+++ RL+  + M S + 
Sbjct: 281 SSPHSSISTSLPLALPITSSFKSLILINLTAAILTNLVLIPMDLIKLRLIVTSTMESSNK 340

Query: 152 TREVRDI-----WKLEG--LP--GFFKGSIASMTTITLTASIMFGTYETIRIYCDEN-EK 201
            R +R +     W+ +G  LP   +F   + S+ T+T      FGT   I IY   N +K
Sbjct: 341 RRSLRRLITKWSWRNDGPNLPISIWFNSILKSIVTVT------FGTNFDILIYSKFNLDK 394

Query: 202 TTAAHKKWELATLNHSAGTIGGVIAKIITFPLETIRRRMQF 242
            T     W++    +S   I   +   I  P+ETI RR Q 
Sbjct: 395 FT----NWKIF---YSFKFISKCVELFIKLPIETILRRSQL 428

>YNL003C (PET8) [4582] chr14 complement(624974..625828) Protein of
           the mitochondrial carrier (MCF) family of membrane
           transporters, has similarity to Mrs4p and Mrs3p [855 bp,
           284 aa]
          Length = 284

 Score = 43.1 bits (100), Expect = 1e-04,   Method: Compositional matrix adjust.
 Identities = 43/197 (21%), Positives = 83/197 (42%), Gaps = 36/197 (18%)

Query: 115 SLVVGAFAGITSSIVSYPFDVLRTRLVANNQMHSMSITREVRDIWKLEGLPGFFKGSIAS 174
           SL+ GA AG ++ +V +P D ++TRL A     +              G  G ++G  ++
Sbjct: 7   SLLSGAAAGTSTDLVFFPIDTIKTRLQAKGGFFANG------------GYKGIYRGLGSA 54

Query: 175 MTTITLTASIMFGTYETIRIYCDENEKTTAAHKKWEL--ATLNHSAGTIGGVIAKIITFP 232
           +      AS+ F +Y+ +++          +    +L   T +  + +IG + A ++  P
Sbjct: 55  VVASAPGASLFFISYDYMKVKSRPYISKLYSQGSEQLIDTTTHMLSSSIGEICACLVRVP 114

Query: 233 LETIRRRMQFMNS----KHLEKFSRHSSVYGSYKGYGFARIGLQILKQEGVSSLYRGILV 288
            E +++R Q  ++    + L+   R+ +  G  K                  +LYRG   
Sbjct: 115 AEVVKQRTQVHSTNSSWQTLQSILRNDNKEGLRK------------------NLYRGWST 156

Query: 289 ALSKTIPTTFVSFWGYE 305
            + + IP T + F  YE
Sbjct: 157 TIMREIPFTCIQFPLYE 173

 Score = 42.7 bits (99), Expect = 2e-04,   Method: Compositional matrix adjust.
 Identities = 39/180 (21%), Positives = 79/180 (43%), Gaps = 16/180 (8%)

Query: 20  LLAGAVSGLLARSITAPMDTIKIRLQLTPANGLKPFGSQVMEVARSMIKN---EGIR-SF 75
           +L+ ++  + A  +  P + +K R Q+   N          +  +S+++N   EG+R + 
Sbjct: 98  MLSSSIGEICACLVRVPAEVVKQRTQVHSTN-------SSWQTLQSILRNDNKEGLRKNL 150

Query: 76  WKGNIPGSLLYVTYGSAQFSSYSLFNRYLTPFGLEARLH---SLVVGAFAGITSSIVSYP 132
           ++G     +  + +   QF  Y    +       ++++      + G+ AG  ++  + P
Sbjct: 151 YRGWSTTIMREIPFTCIQFPLYEYLKKTWAKANGQSQVEPWKGAICGSIAGGIAAATTTP 210

Query: 133 FDVLRTRLVANNQMHSMSITREVRDIWKLEGLPGFFKGSIASMTTITLTASIMFGTYETI 192
            D L+TRL+ N    S+     +  I++ EG   FF G       I+   +I  G YET+
Sbjct: 211 LDFLKTRLMLNKTTASLGSV--IIRIYREEGPAVFFSGVGPRTMWISAGGAIFLGMYETV 268

 Score = 37.7 bits (86), Expect = 0.007,   Method: Compositional matrix adjust.
 Identities = 57/236 (24%), Positives = 100/236 (42%), Gaps = 38/236 (16%)

Query: 19  TLLAGAVSGLLARSITAPMDTIKIRLQLTPANGLKPFGSQVMEVARSMIKNEGIRSFWKG 78
           +LL+GA +G     +  P+DTIK RLQ   A G                 N G +  ++G
Sbjct: 7   SLLSGAAAGTSTDLVFFPIDTIKTRLQ---AKG-------------GFFANGGYKGIYRG 50

Query: 79  -------NIPG-SLLYVTYGSAQFSSYSLFNRYLTPFGLEARLHS---LVVGAFAGITSS 127
                  + PG SL +++Y   +  S    ++ L   G E  + +   ++  +   I + 
Sbjct: 51  LGSAVVASAPGASLFFISYDYMKVKSRPYISK-LYSQGSEQLIDTTTHMLSSSIGEICAC 109

Query: 128 IVSYPFDVLRTRLVANNQMHSMSITREVRDIWKLEGL-PGFFKG-SIASMTTITLTASIM 185
           +V  P +V++ R   ++   S    + +      EGL    ++G S   M  I  T  I 
Sbjct: 110 LVRVPAEVVKQRTQVHSTNSSWQTLQSILRNDNKEGLRKNLYRGWSTTIMREIPFTC-IQ 168

Query: 186 FGTYETI-RIYCDENEKTTAAHKKWELATLNHSAGTIGGVIAKIITFPLETIRRRM 240
           F  YE + + +   N ++    + W+ A      G+I G IA   T PL+ ++ R+
Sbjct: 169 FPLYEYLKKTWAKANGQSQV--EPWKGAI----CGSIAGGIAAATTTPLDFLKTRL 218

 Score = 37.0 bits (84), Expect = 0.012,   Method: Compositional matrix adjust.
 Identities = 29/109 (26%), Positives = 50/109 (45%), Gaps = 19/109 (17%)

Query: 13  NVAAWKTLLAGAVSGLLARSITAPMDTIKIRLQLTPANGLKPFGSQVMEVARSMIKNEGI 72
            V  WK  + G+++G +A + T P+D +K RL L         GS ++ + R     EG 
Sbjct: 187 QVEPWKGAICGSIAGGIAAATTTPLDFLKTRLMLNKTTA--SLGSVIIRIYR----EEGP 240

Query: 73  RSFWKGNIPGSLLYVTYGSAQFSSYSLFNRYLTPFGLEARLHSLVVGAF 121
             F+ G  P + ++++ G A F             G+   +HSL+  +F
Sbjct: 241 AVFFSGVGPRT-MWISAGGAIF------------LGMYETVHSLLSKSF 276

>Scas_613.24
          Length = 177

 Score = 42.0 bits (97), Expect = 2e-04,   Method: Compositional matrix adjust.
 Identities = 40/164 (24%), Positives = 72/164 (43%), Gaps = 25/164 (15%)

Query: 20  LLAGAVSGLLARSITAPMDTIKIRLQLTPANGLKPFGSQVMEVARSMIKNEGIRSFWKGN 79
           L++G + GL +     P+D +K R+Q      L    S + ++   +        FW+G 
Sbjct: 12  LVSGFIGGLSSAVTLQPLDLLKTRIQQHKGATL---WSAIKDIKDPI-------QFWRGT 61

Query: 80  IPGSLLYVTYGSAQF-SSYSLFNRYLTPFGLEARL------------HSLVVGAFAGITS 126
           +P S L  + GSA + S  ++    L      +               +L+ GA A    
Sbjct: 62  LP-SALRTSIGSALYLSCLNIMRTQLVHGKKGSAASKSSSLPQLTMYENLLTGAMARGLV 120

Query: 127 SIVSYPFDVLRTRLVANNQMHSMSITREVRDIWKLEGLPGFFKG 170
             ++ P  +L+ R  +    +  S+   ++DI+K+EG+ GFFKG
Sbjct: 121 GYITMPITILKVRYESTYYSYK-SMNEAIKDIYKMEGISGFFKG 163

 Score = 27.7 bits (60), Expect = 9.7,   Method: Compositional matrix adjust.
 Identities = 20/69 (28%), Positives = 34/69 (49%), Gaps = 5/69 (7%)

Query: 13  NVAAWKTLLAGAVSGLLARSITAPMDTIKIRLQLTPANGLKPFGSQVMEVARSMIKNEGI 72
            +  ++ LL GA++  L   IT P+  +K+R + T  +        + E  + + K EGI
Sbjct: 103 QLTMYENLLTGAMARGLVGYITMPITILKVRYESTYYS-----YKSMNEAIKDIYKMEGI 157

Query: 73  RSFWKGNIP 81
             F+KG  P
Sbjct: 158 SGFFKGFGP 166

>Kwal_27.11626
          Length = 299

 Score = 42.4 bits (98), Expect = 2e-04,   Method: Compositional matrix adjust.
 Identities = 49/170 (28%), Positives = 81/170 (47%), Gaps = 22/170 (12%)

Query: 16  AWKTLLAGAVSGLLARSITAPMDTIKIRLQLTPANGLKPFGSQVMEVARSMIKNEGIRSF 75
           A ++  AG++ G+    +  P+D +KI+ Q  P +  K  G   +++    +K+EG    
Sbjct: 118 ALRSATAGSLIGI-GEIVLLPLDVLKIKRQTNPES-FK--GRGFIKI----LKDEGF-GL 168

Query: 76  WKG-------NIPGSLLYVTYGSAQFS-SYSLFNRYLTPFGLEARLHSLVVGAFAGITSS 127
           ++G       N PGS  +  +G   F+  Y L  +  +         S +VGA A   S 
Sbjct: 169 YRGWGWTAARNAPGS--FALFGGNAFAKEYILGLKDYSSATWSQNFVSSIVGASA---SL 223

Query: 128 IVSYPFDVLRTRLVANNQMHSMSITREVRDIWKLEGLPGFFKGSIASMTT 177
           IVS P DV++TR+   +  +  S  R V++  K EG+  FFKG    + T
Sbjct: 224 IVSAPLDVIKTRIQNRHFDNPESGFRIVQNTLKNEGITAFFKGLTPKLLT 273

 Score = 35.4 bits (80), Expect = 0.040,   Method: Compositional matrix adjust.
 Identities = 70/306 (22%), Positives = 114/306 (37%), Gaps = 60/306 (19%)

Query: 20  LLAGAVSGLLARSITAPMDTIKIRLQLTPANGLKPFGSQVMEVARSMIKNEGIRSFWKGN 79
           +L  A +G+L   +  P+DT+  RL            S   +++ S   N  I     G 
Sbjct: 13  VLGSASAGILEIGVFHPVDTVSKRLM-----------SNHTKISSSAQLNSVIFREHAGE 61

Query: 80  IPGSLLYVTY-GSAQFSSYSLFNRYL----TPFGLE-------------------ARLHS 115
             G  L+  + G    +SY +  R       PF  E                     L S
Sbjct: 62  ALGKRLFTLFPGLGYAASYKILQRVYKYGGQPFANEFLNKNFKADFDNAFGEKTGKALRS 121

Query: 116 LVVGAFAGITSSIVSYPFDVLRTRLVANNQMHSMSITREVRDIWKLEGLPGFFKGSIASM 175
              G+  GI   IV  P DVL+ +   N +       R    I K EG  G ++G   + 
Sbjct: 122 ATAGSLIGI-GEIVLLPLDVLKIKRQTNPESFK---GRGFIKILKDEGF-GLYRGWGWTA 176

Query: 176 TTITLTASIMFGTYETIRIYCDENEKTTAAHKKWELATLNHSAGTIGGVIAKIITFPLET 235
                 +  +FG     + Y    +  ++A   W   + N  +  +G   + I++ PL+ 
Sbjct: 177 ARNAPGSFALFGGNAFAKEYILGLKDYSSA--TW---SQNFVSSIVGASASLIVSAPLDV 231

Query: 236 IRRRMQFMNSKHLEKFSRHSSVYGSYKGYGFARIGLQILKQEGVSSLYRGILVALSKTIP 295
           I+ R+Q   ++H +               GF RI    LK EG+++ ++G+   L  T P
Sbjct: 232 IKTRIQ---NRHFDNPES-----------GF-RIVQNTLKNEGITAFFKGLTPKLLTTGP 276

Query: 296 TTFVSF 301
               SF
Sbjct: 277 KLVFSF 282

>ABL023W [569] [Homologous to ScYKL120W (OAC1) - SH]
           complement(355977..356906) [930 bp, 309 aa]
          Length = 309

 Score = 42.4 bits (98), Expect = 3e-04,   Method: Compositional matrix adjust.
 Identities = 42/172 (24%), Positives = 74/172 (43%), Gaps = 20/172 (11%)

Query: 35  APMDTIKIRLQLTPANGLKPFGSQVMEVARSMIKNEGIRSFWKGNIPGSLLYVTYGSA-Q 93
           +P+  +K R+Q      + P   ++     ++ K+ G+R  ++G +  +LL    GSA Q
Sbjct: 136 SPLQLVKTRMQALAPRRVPPLPGRMGRRLVALFKDRGVRGLYQG-VDAALLRTGVGSAVQ 194

Query: 94  FSSYSLFNRYLT---PFGLEARLHSLVVGAFAGITSSIVSYPFDVLRTRLVANNQMHSMS 150
            + YS     L+   P G+   L++L   A + +   I   PFDV  TR+      H   
Sbjct: 195 LAVYSHAKEALSRHVPDGMA--LYTL-ASALSSVAVCIAMNPFDVAMTRMY----HHRGG 247

Query: 151 ITREVRDIW----KLEGLPGFFKGSIASMTTIT----LTASIMFGTYETIRI 194
           + R   D      + EG    +KG +A +  I     L  ++M      +R+
Sbjct: 248 LYRGPLDCLCKTVRQEGFSALYKGHLAQLLRIAPHTILCLTLMEQALRVVRL 299

 Score = 28.9 bits (63), Expect = 5.6,   Method: Compositional matrix adjust.
 Identities = 57/291 (19%), Positives = 110/291 (37%), Gaps = 37/291 (12%)

Query: 32  SITAPMDTIKIRLQLTP--ANGLKPFGSQVMEVARSMIKNEGIRSFWKGNIPGSLLYVTY 89
           + T P++T+K RLQL      G+    S   +    + + EG+R   +G        +  
Sbjct: 27  TFTNPIETVKTRLQLQGELVAGVSRLYSGPAQAVSLIYRTEGLRGLQQGLACAYAYQILL 86

Query: 90  GSAQFSSYSLFNRYL--------TPFGLEARLHSLVVGAFAGITSSIVSYPFDVLRTRL- 140
             ++   Y      L          +G  A   +   GA AG+  + +  P  +++TR+ 
Sbjct: 87  NGSRLGLYDPLRAALGGCVLSDRRTYGTAALAVNATAGAAAGMIGAALGSPLQLVKTRMQ 146

Query: 141 -VANNQMHSMS--ITREVRDIWKLEGLPGFFKGSIASMTTITLTASIMFGTYETIRIYCD 197
            +A  ++  +   + R +  ++K  G+ G ++G  A++    + +++    Y        
Sbjct: 147 ALAPRRVPPLPGRMGRRLVALFKDRGVRGLYQGVDAALLRTGVGSAVQLAVYS------- 199

Query: 198 ENEKTTAAHKKWELATLNHSAGTIGGVIAKIITFPLETIRRRMQFMNSKHLEKFSRHSSV 257
            + K   +    +   L   A  +  V   I   P +    RM                 
Sbjct: 200 -HAKEALSRHVPDGMALYTLASALSSVAVCIAMNPFDVAMTRMYHHRG------------ 246

Query: 258 YGSYKGYGFARIGLQILKQEGVSSLYRGILVALSKTIPTTFVSFWGYETAI 308
            G Y+G        + ++QEG S+LY+G L  L +  P T +     E A+
Sbjct: 247 -GLYRGP--LDCLCKTVRQEGFSALYKGHLAQLLRIAPHTILCLTLMEQAL 294

>Scas_328.1
          Length = 227

 Score = 41.6 bits (96), Expect = 3e-04,   Method: Compositional matrix adjust.
 Identities = 49/216 (22%), Positives = 86/216 (39%), Gaps = 37/216 (17%)

Query: 87  VTYGSAQFSSYSLFNRYLTPFGLEA---RLHSLVVGAFAGITSSIVSYPFDVLRTRLVAN 143
           + Y   Q  +++  ++    FG +    RL+ +V G          S+P   L  RL  N
Sbjct: 3   IRYFPTQALNFAFKDKIKAMFGFQQGKRRLYQMVYGECGIRWMCRCSFPIVCLFLRLCKN 62

Query: 144 NQMHSMSITRE--------VRDIWK----LEGLPGFFKGSIASMTTITLTASIMFGTYET 191
                    +         + D++K     +G+ G ++G + S+  I +   + FG Y++
Sbjct: 63  EIGSDAKSIKSGAPRKFNGILDVYKKTLFTDGVLGLYRGFLPSVVGIMVYRGLYFGLYDS 122

Query: 192 IRIYCDENEKTTAAHKKWELATL-NHSAGTIGGVIAKIITFPLETIRRRMQFMNSKHLEK 250
           +        K       +E A L +   G    + A   ++PL+T+RRRM  M S    K
Sbjct: 123 L--------KPVLLTGSFENAFLPSFLLGWAVTISASTTSYPLDTVRRRMM-MTSGQAVK 173

Query: 251 FSRHSSVYGSYKGYGFARIGLQILKQEGVSSLYRGI 286
           +      +             QI+ QEGV SL++G 
Sbjct: 174 YKGAIDCFQ------------QIVSQEGVYSLFKGC 197

 Score = 35.8 bits (81), Expect = 0.025,   Method: Compositional matrix adjust.
 Identities = 28/120 (23%), Positives = 53/120 (44%), Gaps = 3/120 (2%)

Query: 59  VMEVARSMIKNEGIRSFWKGNIPGSLLYVTYGSAQFSSYSLFNRYLTPFGLE-ARLHSLV 117
           +++V +  +  +G+   ++G +P  +  + Y    F  Y      L     E A L S +
Sbjct: 82  ILDVYKKTLFTDGVLGLYRGFLPSVVGIMVYRGLYFGLYDSLKPVLLTGSFENAFLPSFL 141

Query: 118 VGAFAGITSSIVSYPFDVLRTRLV--ANNQMHSMSITREVRDIWKLEGLPGFFKGSIASM 175
           +G    I++S  SYP D +R R++  +   +         + I   EG+   FKG  A++
Sbjct: 142 LGWAVTISASTTSYPLDTVRRRMMMTSGQAVKYKGAIDCFQQIVSQEGVYSLFKGCGANI 201

>Sklu_2117.2 YDL198C, Contig c2117 3737-4633
          Length = 298

 Score = 42.0 bits (97), Expect = 3e-04,   Method: Compositional matrix adjust.
 Identities = 48/170 (28%), Positives = 79/170 (46%), Gaps = 22/170 (12%)

Query: 16  AWKTLLAGAVSGLLARSITAPMDTIKIRLQLTPANGLKPFGSQVMEVARSMIKNEGIRSF 75
           A ++  AG++ G+    +  P+D +KI+ Q  P    K  G   +++    +K+EG+   
Sbjct: 118 ALRSATAGSMIGI-GEIVLLPLDVLKIKRQTNP-EAFK--GRGFVKI----LKDEGL-GL 168

Query: 76  WKG-------NIPGSLLYVTYGSAQFS-SYSLFNRYLTPFGLEARLHSLVVGAFAGITSS 127
           ++G       N PGS  +  +G   F+  Y L  +  +         S +VGA A   S 
Sbjct: 169 YRGWGWTAARNAPGS--FALFGGNAFAKEYILGLKDYSQATWSQNFVSSIVGASA---SL 223

Query: 128 IVSYPFDVLRTRLVANNQMHSMSITREVRDIWKLEGLPGFFKGSIASMTT 177
           I+S P DV++TR+   N  +  S    V++  K EG   FFKG    + T
Sbjct: 224 IISAPLDVIKTRIQNKNFENPESGFTIVKNTLKNEGFSAFFKGLTPKLLT 273

 Score = 37.0 bits (84), Expect = 0.015,   Method: Compositional matrix adjust.
 Identities = 53/198 (26%), Positives = 78/198 (39%), Gaps = 29/198 (14%)

Query: 113 LHSLVVGAFAGITSSIVSYPFDVLRTRLVANNQMHSMSITREVRDIWKLEGLPGFFKGSI 172
           L S   G+  GI   IV  P DVL+ +   N +       R    I K EGL G ++G  
Sbjct: 119 LRSATAGSMIGI-GEIVLLPLDVLKIKRQTNPEAFK---GRGFVKILKDEGL-GLYRGWG 173

Query: 173 ASMTTITLTASIMFGTYETIRIYCDENEKTTAAHKKWELAT--LNHSAGTIGGVIAKIIT 230
            +       +  +FG     + Y           K +  AT   N  +  +G   + II+
Sbjct: 174 WTAARNAPGSFALFGGNAFAKEYI-------LGLKDYSQATWSQNFVSSIVGASASLIIS 226

Query: 231 FPLETIRRRMQFMNSKHLEKFSRHSSVYGSYKGYGFARIGLQILKQEGVSSLYRGILVAL 290
            PL+ I+ R+Q  N ++ E               GF  I    LK EG S+ ++G+   L
Sbjct: 227 APLDVIKTRIQNKNFENPES--------------GFT-IVKNTLKNEGFSAFFKGLTPKL 271

Query: 291 SKTIPTTFVSFWGYETAI 308
             T P    SF   +T I
Sbjct: 272 LTTGPKLVFSFALAQTLI 289

 Score = 30.4 bits (67), Expect = 1.9,   Method: Compositional matrix adjust.
 Identities = 51/204 (25%), Positives = 90/204 (44%), Gaps = 31/204 (15%)

Query: 110 EARLHSLVVGAFAGITSSIVSYPFDVLRTRLVANN-------QMHSMSITREVRDIWKLE 162
           ++ L  ++  A AGI    V +P D +  RL++N+       Q++S+ I RE       +
Sbjct: 7   QSGLARVLGSASAGILEIGVFHPVDTISKRLMSNHTKIGSSSQLNSV-IFREHAAEPLSK 65

Query: 163 GLPGFFKGSIASMTTITLTASIMFGTYETIRIYCDENEKTTAAH---KKWELATLNHSAG 219
            +   F G   + T   L     +G       + + N K    +   +K   A  + +AG
Sbjct: 66  RVFTLFPGLGYAATYKILQRVYKYGGQPFANEFLNRNFKADFDNTFGEKTGKALRSATAG 125

Query: 220 TIGGVIAKIITFPLETIRRRMQFMNSKHLEKFSRHSSVYGSYKGYGFARIGLQILKQEGV 279
           ++ G I +I+  PL+ ++ + Q  N +             ++KG GF    ++ILK EG+
Sbjct: 126 SMIG-IGEIVLLPLDVLKIKRQ-TNPE-------------AFKGRGF----VKILKDEGL 166

Query: 280 SSLYRGILVALSKTIPTTFVSFWG 303
             LYRG     ++  P +F  F G
Sbjct: 167 -GLYRGWGWTAARNAPGSFALFGG 189

>AGR191W [4502] [Homologous to ScYDL198C (YHM1) - SH]
           complement(1114974..1115870) [897 bp, 298 aa]
          Length = 298

 Score = 42.0 bits (97), Expect = 4e-04,   Method: Compositional matrix adjust.
 Identities = 46/184 (25%), Positives = 78/184 (42%), Gaps = 20/184 (10%)

Query: 16  AWKTLLAGAVSGLLARSITAPMDTIKIRLQLTPANGLKPFGSQVMEVARSMIKNEGIRSF 75
           A ++  AG++ G+    +  P+D +KI+ Q  P +     G   + + R    +EG+   
Sbjct: 118 ALRSATAGSLIGI-GEIVLLPLDVLKIKRQTNPESFR---GRGFLRILR----DEGM-GL 168

Query: 76  WKG-------NIPGSLLYVTYGSAQFSSYSLFNRYLTPFGLEARLHSLVVGAFAGITSSI 128
           ++G       N PGS  +  +G   F+   +    L  +       + V   F    S I
Sbjct: 169 YRGWGWTAARNAPGS--FALFGGNAFAKEYILG--LKDYSQATWGQNFVSSIFGASASLI 224

Query: 129 VSYPFDVLRTRLVANNQMHSMSITREVRDIWKLEGLPGFFKGSIASMTTITLTASIMFGT 188
           VS P DV++TR+ + N   + S    V++  K EG   FFKG    + T        F  
Sbjct: 225 VSAPLDVIKTRIQSRNFESAESGFTIVKNTLKNEGATAFFKGLTPKLLTTGPKLVFSFAI 284

Query: 189 YETI 192
            +T+
Sbjct: 285 AQTL 288

 Score = 35.4 bits (80), Expect = 0.046,   Method: Compositional matrix adjust.
 Identities = 73/321 (22%), Positives = 118/321 (36%), Gaps = 60/321 (18%)

Query: 12  QNVAAWKTLLAGAVSGLLARSITAPMDTIKIRL-----QLTPANGL----------KPFG 56
           Q  +    ++  A +G+L   +  P+DTI  RL     ++T A  L          KPFG
Sbjct: 5   QKQSGLARVVGSASAGILEIGVFHPVDTISKRLMSNHTKITNAQQLNDVVFREHASKPFG 64

Query: 57  SQVMEVARSMIKNEGIRSFWKGNIPGSLLYVTYGSAQFSSYSLFNRYLTPFG------LE 110
            ++  +   +      + F +           YG   F++  L   +   F         
Sbjct: 65  QRLFTLFPGLGYAATYKIFQR--------VYKYGGQPFANEFLNKHFKADFDGAFGEKTG 116

Query: 111 ARLHSLVVGAFAGITSSIVSYPFDVLRTRLVANNQ-MHSMSITREVRDIWKLEGLPGFFK 169
             L S   G+  GI   IV  P DVL+ +   N +        R +RD    EG+ G ++
Sbjct: 117 KALRSATAGSLIGI-GEIVLLPLDVLKIKRQTNPESFRGRGFLRILRD----EGM-GLYR 170

Query: 170 GSIASMTTITLTASIMFGTYETIRIYCDENEKTTAAHKKWELAT--LNHSAGTIGGVIAK 227
           G   +       +  +FG     + Y           K +  AT   N  +   G   + 
Sbjct: 171 GWGWTAARNAPGSFALFGGNAFAKEYI-------LGLKDYSQATWGQNFVSSIFGASASL 223

Query: 228 IITFPLETIRRRMQFMNSKHLEKFSRHSSVYGSYKGYGFARIGLQILKQEGVSSLYRGIL 287
           I++ PL+ I+ R+Q  N +  E               GF  I    LK EG ++ ++G+ 
Sbjct: 224 IVSAPLDVIKTRIQSRNFESAES--------------GFT-IVKNTLKNEGATAFFKGLT 268

Query: 288 VALSKTIPTTFVSFWGYETAI 308
             L  T P    SF   +T I
Sbjct: 269 PKLLTTGPKLVFSFAIAQTLI 289

>AEL060C [2446] [Homologous to NOHBY] (525069..526358) [1290 bp, 429
           aa]
          Length = 429

 Score = 40.0 bits (92), Expect = 0.002,   Method: Compositional matrix adjust.
 Identities = 40/140 (28%), Positives = 64/140 (45%), Gaps = 20/140 (14%)

Query: 82  GSLLYVTYGSAQFSSYSLFNRYLTPFGLEA----RLHSLVVGAF-AGITSSIVSYPFDVL 136
           G +LY TY     SS S     L   G       R+  +V   F AG+  ++ S P D +
Sbjct: 125 GVVLYTTY----LSSLSFLRGPLGAGGEHGQSPPRISDVVCAGFMAGVAQAVASAPIDAI 180

Query: 137 RTRLVANNQMHSMSITREVRDIW-----KLE--GLPGFFKGSIASMTTITLTASIMFGTY 189
            TR  AN+ + S    ++   +W     KL+  GL G F G   S+   ++  ++ F T+
Sbjct: 181 YTRSTANDLLSS---AKKYNSLWLYGIDKLKEIGLVGCFGGFGLSLVKESVGFAVYFTTF 237

Query: 190 ETIR-IYCDENEKTTAAHKK 208
           E ++   C++  +   AHKK
Sbjct: 238 ELLKGQVCNKTIEYLEAHKK 257

>YDL119C (YDL119C) [751] chr4 complement(246689..247612) Member of
           the mitochondrial carrier family (MCF) of membrane
           transporters [924 bp, 307 aa]
          Length = 307

 Score = 38.9 bits (89), Expect = 0.003,   Method: Compositional matrix adjust.
 Identities = 20/57 (35%), Positives = 31/57 (54%), Gaps = 5/57 (8%)

Query: 22  AGAVSGLLARSITAPMDTIKIRLQLTPANGLKPFGSQVMEVARSMIKNEGIRSFWKG 78
           +  +S  LA ++TAP DTIK R+QL P+     F +       S++KNE +   + G
Sbjct: 229 SAVLSASLATTVTAPFDTIKTRMQLEPSKFTNSFNTFT-----SIVKNENVLKLFSG 280

 Score = 30.0 bits (66), Expect = 2.4,   Method: Compositional matrix adjust.
 Identities = 19/75 (25%), Positives = 33/75 (44%), Gaps = 16/75 (21%)

Query: 218 AGTIGGVIAKIITFPLETIRRRMQFMNSKHLEKFSRHSSVYGSYKGYGFARIGLQILKQE 277
           +  +   +A  +T P +TI+ RMQ   SK    F+  +S                I+K E
Sbjct: 229 SAVLSASLATTVTAPFDTIKTRMQLEPSKFTNSFNTFTS----------------IVKNE 272

Query: 278 GVSSLYRGILVALSK 292
            V  L+ G+ + L++
Sbjct: 273 NVLKLFSGLSMRLAR 287

>CAGL0D04774g complement(467712..468680) similar to tr|Q06497
           Saccharomyces cerevisiae YPR128c, start by similarity
          Length = 322

 Score = 38.9 bits (89), Expect = 0.003,   Method: Compositional matrix adjust.
 Identities = 61/304 (20%), Positives = 122/304 (40%), Gaps = 40/304 (13%)

Query: 14  VAAWKTLLAGAVSGLLARSITAPMDTIKIRLQLTPANGLKPFGSQ------VMEVARSMI 67
           +A+ ++   GAV+  LA +   P+D  K  +Q    N       +      V++    + 
Sbjct: 1   MASLESAFTGAVASSLAATTVYPLDLAKTLIQTQHKNADSGDSKEEEKYKNVIDCIIKIF 60

Query: 68  KNEGIRSFWKG-------NIPGSLLYVTYGSAQFSSYSLFN------RYLTPFGLEARLH 114
           K  G    ++G       N   + +Y  + S   S+Y +F       +  + F   + + 
Sbjct: 61  KKRGFLGLYQGLATNVAANFVQNFIYFFWYSLIRSNYFVFKAGRLQLKDDSKFIELSTIE 120

Query: 115 SLVVGAFAGITSSIVSYPFDVLRTRLVANNQMHSMSITREVRDIWKLEG--LPGFFKGSI 172
            L +G  AG  + +V+ P  V+ TR          S+   ++ I++     L  F+KG  
Sbjct: 121 ELALGMSAGAMTQVVTNPISVISTRQQLTKDGEDASLKAVIKQIYEESNGDLTAFWKGFK 180

Query: 173 ASMTTITLTASIMFGTYETIRIYCDENEKTTAAHK-KWEL-ATLNHSAGTIGGVIAKIIT 230
            ++  ++   +I +G+Y+ ++      +  + + K   +L A  N   G    +I+  +T
Sbjct: 181 VAL-VLSTNPAITYGSYQKLKSMILTAKGLSGSQKISTQLSAGENFLLGMFSKMISTFVT 239

Query: 231 FPLETIRRRMQFMNSKHLEKFSRHSSVYGSYKGYGFARIGLQILKQEGVSSLYRGILVAL 290
            PL   +  +Q   SK                   F  +   I + EG  SL++G++  +
Sbjct: 240 QPLIVAKITLQGKGSKF----------------KTFQEVLQHIYQNEGFLSLWKGVIPQV 283

Query: 291 SKTI 294
           SK +
Sbjct: 284 SKGV 287

>Scas_671.1*
          Length = 123

 Score = 36.2 bits (82), Expect = 0.006,   Method: Compositional matrix adjust.
 Identities = 22/58 (37%), Positives = 30/58 (51%), Gaps = 5/58 (8%)

Query: 21 LAGAVSGLLARSITAPMDTIKIRLQLTPANGLKPFGSQVMEVARSMIKNEGIRSFWKG 78
          ++   S  LA +ITAP DTIK R+QL P      F + V+     + KNE I   + G
Sbjct: 44 VSAIASASLATAITAPFDTIKTRMQLKPKVFTNFFTTLVL-----ITKNESIFQLFSG 96

 Score = 28.5 bits (62), Expect = 3.9,   Method: Compositional matrix adjust.
 Identities = 24/82 (29%), Positives = 40/82 (48%), Gaps = 5/82 (6%)

Query: 115 SLVVGAFAGITS----SIVSYPFDVLRTRLVANNQMHSMSITREVRDIWKLEGLPGFFKG 170
           S VV + + I S    + ++ PFD ++TR+    ++ +   T  V  I K E +   F G
Sbjct: 38  STVVNSVSAIASASLATAITAPFDTIKTRMQLKPKVFTNFFTTLVL-ITKNESIFQLFSG 96

Query: 171 SIASMTTITLTASIMFGTYETI 192
               +T   L+A I +G YE +
Sbjct: 97  LSMRLTRKALSAGIAWGIYEDL 118

>CAGL0K06545g complement(641129..642667) similar to tr|Q03327
           Saccharomyces cerevisiae YDR470c, hypothetical start
          Length = 512

 Score = 37.0 bits (84), Expect = 0.015,   Method: Compositional matrix adjust.
 Identities = 51/244 (20%), Positives = 87/244 (35%), Gaps = 53/244 (21%)

Query: 35  APMDTIKIRLQLTPANGLKPFGSQVMEVARSMIKNEGIRSFWKGN-------IPGSLLYV 87
           A ++   IR  LTP   + P     +++  S++  EGI+  WK N       I  S L  
Sbjct: 213 ASIEETHIRC-LTPERSINPESKHTLDIMNSILDEEGIKGLWKANNTNFIYQILSSTLEA 271

Query: 88  TYGSAQFSSYSLFNRYLT-----PFGLEARLHSLVVGAFAGITSSIVSYPFDVLRTRLV- 141
            Y         + + Y       P    A L +L VG    +T      P D++RTR + 
Sbjct: 272 WYTGLISPLLHIPDPYFIDLIHFPDTQSAVLLTLSVGVLTALT----LIPIDLIRTRFIV 327

Query: 142 ------------------ANNQMHSMSITREVRD-IWKLEGLPGFFKGSIASMTTITLTA 182
                             AN +  S S+   +R   W+ + L       +  +T +   +
Sbjct: 328 TALYGTDTEVSEEASEGAANKKHDSRSLRHWIRSWSWRHDALK--LPSDMWLLTMLQSVS 385

Query: 183 SIMFGTYETIRIYCDENEKTTAAHK----KWELATLNHSAGTIGGVIAKIITFPLETIRR 238
           ++ F     + IY          HK    K+   T  ++   +  +    +  P+E + R
Sbjct: 386 NVSFNKLIDLVIY----------HKFHVDKYSQMTTYNTMKVLARIAELFVKLPIECLLR 435

Query: 239 RMQF 242
           R Q 
Sbjct: 436 RCQL 439

>AFR373W [3565] [Homologous to ScYDR470C (UGO1) - SH]
           complement(1112020..1113423) [1404 bp, 467 aa]
          Length = 467

 Score = 36.2 bits (82), Expect = 0.025,   Method: Compositional matrix adjust.
 Identities = 36/137 (26%), Positives = 59/137 (43%), Gaps = 21/137 (15%)

Query: 47  TPANGLKPFGSQVMEVARSMIKNEGIRSFWKGNIPGSLLYVTYGSAQFSSYSLFNRYLTP 106
           T  + ++P G   M+V  +++  EG R  W+ N   ++    + S    ++  F   L+P
Sbjct: 196 TKTHVVQPTGLHTMDVLNAVMDKEGTRGVWRAN--NTIFIYNFLSESLDAW--FTGLLSP 251

Query: 107 F------------GLEARLHSLVVGAFAGITSSIVSYPFDVLRTRLV--ANNQMHSMSIT 152
           F                   S+ +   A I + +V  P DV++TRLV  A    H  S+ 
Sbjct: 252 FLQIPDPYFIDIINSPDVQKSVALTFAAAIFTGLVLLPLDVIKTRLVVGAVASTHERSLR 311

Query: 153 REV-RDIWK--LEGLPG 166
           R V R  W+  +  LPG
Sbjct: 312 RLVKRWSWREYIHSLPG 328

>YDR470C (UGO1) [1287] chr4 complement(1399694..1401202) Protein of
           the mitochondrial outer membrane required for
           mitochondrial fusion, member of the mitochondrial
           carrier family (MCF) of membrane transporters [1509 bp,
           502 aa]
          Length = 502

 Score = 35.4 bits (80), Expect = 0.050,   Method: Compositional matrix adjust.
 Identities = 25/101 (24%), Positives = 46/101 (45%), Gaps = 12/101 (11%)

Query: 52  LKPFGSQVMEVARSMIKNEGIRSFWKGNIPGSLLYVTYGSAQFSSY--SLFNRYL---TP 106
           + P     ++V  ++   EGIR  WK N   +     + S    ++   L + +L    P
Sbjct: 222 IAPQSLHTIDVINALFDQEGIRGLWKAN--NTTFIYNFLSLSIDTWFTGLLSSFLGVPDP 279

Query: 107 FGLEAR-----LHSLVVGAFAGITSSIVSYPFDVLRTRLVA 142
           + +E         S ++   AG+ +SI+  P D++RTRL+ 
Sbjct: 280 YFMEVINSPDISKSFILALGAGVFTSIILLPVDLIRTRLIV 320

>Sklu_2194.3 YMR241W, Contig c2194 5245-6183
          Length = 312

 Score = 34.7 bits (78), Expect = 0.083,   Method: Compositional matrix adjust.
 Identities = 34/159 (21%), Positives = 67/159 (42%), Gaps = 27/159 (16%)

Query: 132 PFDVLRTRLVANNQMHSMSITREVRDIWKLEGLPGFFKGSI--ASMTTITLTASIMFGTY 189
           P +V++T + AN    S S    ++ +W   G+ GF++G I  A +   T  A ++F + 
Sbjct: 38  PLEVIKTTMAAN---RSFSFFNAIKHVWSRGGVFGFYQGLIPWAWIEASTKGAVLLFVSA 94

Query: 190 ETIRIYCDENEKTTAAHKKWELATLNHS--AGTIGGVIAKIITFPLETIRRRMQFMNSKH 247
           E+   +           K+  L+        G  GGV    +T    T  + ++    K 
Sbjct: 95  ESEYQF-----------KRMGLSNFGSGIMGGVTGGVAQAYLTMGFCTCMKTVEITKKKS 143

Query: 248 LEKFSRHSSVYGSYKGYGFARIGLQILKQEGVSSLYRGI 286
               +   S +G++K         +I K++G+  + +G+
Sbjct: 144 AGAGAIPQSSWGAFK---------EIYKKDGIKGINKGV 173

>Kwal_34.15907
          Length = 312

 Score = 33.9 bits (76), Expect = 0.13,   Method: Compositional matrix adjust.
 Identities = 34/167 (20%), Positives = 73/167 (43%), Gaps = 31/167 (18%)

Query: 126 SSIVSYPFDVLRTRLVANNQMHSMSITREVRDIWKLEGLPGFFKGSI--ASMTTITLTAS 183
           ++ +  P +V++T + AN    +++  + V+ +W   G+ GF++G I  A +   T  A 
Sbjct: 32  ATTLGQPLEVIKTTMAAN---RNLNFGQSVKHVWSRGGVFGFYQGLIPWAWIEASTKGAV 88

Query: 184 IMFGTYETIRIYCDENEKTTAAHKKWELATLNHSAGTIGGVIAKI----ITFPLETIRRR 239
           ++F + E             A ++   L   N  AG +GGV   +    +T    T  + 
Sbjct: 89  LLFVSAE-------------AEYQFKRLGLGNFGAGIMGGVSGGVAQAYLTMGFCTCMKT 135

Query: 240 MQFMNSKHLEKFSRHSSVYGSYKGYGFARIGLQILKQEGVSSLYRGI 286
           ++   +K     +   S + ++K         +I  +EG+  + +G+
Sbjct: 136 VEITKAKSAVAGAIPQSSWSAFK---------EIYSKEGIKGINKGV 173

>YMR241W (YHM2) [4197] chr13 (751960..752904) Suppressor of abf1
           mutant that affects mitochondrial HMG-like DNA-binding
           protein, member of the mitochondrial carrier family
           (MCF) of membrane transporters [945 bp, 314 aa]
          Length = 314

 Score = 33.1 bits (74), Expect = 0.22,   Method: Compositional matrix adjust.
 Identities = 36/175 (20%), Positives = 74/175 (42%), Gaps = 24/175 (13%)

Query: 115 SLVVGAFAGITS-SIVSYPFDVLRTRLVANNQMHSMSITREVRDIWKLEGLPGFFKGSI- 172
           ++++GA   ++  + +  P +V++T + AN    + +    V+ +W   G+ G+++G I 
Sbjct: 22  NILLGACLNLSEVTTLGQPLEVVKTTMAAN---RNFTFLESVKHVWSRGGILGYYQGLIP 78

Query: 173 -ASMTTITLTASIMFGTYETIRIYCDENEKTTAAHKKWELATLNHSAGTIGGVIAKIITF 231
            A +   T  A ++F + E             A ++   L   N ++G +GGV   +   
Sbjct: 79  WAWIEASTKGAVLLFVSAE-------------AEYRFKSLGLNNFASGILGGVTGGVTQA 125

Query: 232 PLETIRRRMQFMNSKHLEKFSRHSSVYGSYKGYGFARIGLQILKQEGVSSLYRGI 286
            L      M F       + +RH S            +   I K+EG+  + +G+
Sbjct: 126 YLT-----MGFCTCMKTVEITRHKSASAGGVPQSSWSVFKNIYKKEGIRGINKGV 175

>AFR542W [3734] [Homologous to ScYMR241W (YHM2) - SH]
           complement(1408478..1409410) [933 bp, 310 aa]
          Length = 310

 Score = 32.0 bits (71), Expect = 0.51,   Method: Compositional matrix adjust.
 Identities = 27/95 (28%), Positives = 43/95 (45%), Gaps = 18/95 (18%)

Query: 132 PFDVLRTRLVANNQMHSMSITREVRDIWKLEGLPGFFKGSI--ASMTTITLTASIMFGTY 189
           P +V +T + AN Q      ++ VR +W   G+ GF++G I  A +   T  A ++F + 
Sbjct: 37  PLEVTKTTMAANRQF---GFSQAVRHVWSRGGVFGFYQGLIPWAWIEASTKGAVLLFVSA 93

Query: 190 ETIRIYCDENEKTTAAHKKWELATLNHSAGTIGGV 224
           E             A ++   L   N  AG +GGV
Sbjct: 94  E-------------AEYQFRRLGLSNFGAGILGGV 115

>Sklu_2436.18 YDR470C, Contig c2436 37947-39431 reverse complement
          Length = 494

 Score = 31.2 bits (69), Expect = 1.2,   Method: Compositional matrix adjust.
 Identities = 23/100 (23%), Positives = 45/100 (45%), Gaps = 14/100 (14%)

Query: 52  LKPFGSQVMEVARSMIKNEGIRSFWKGNIPGSLLYVTYGSAQFSSY-----SLFNRYLTP 106
           +KP     M++  S++  EG R  W+ N   +     + SA   ++     S F +   P
Sbjct: 226 IKPQSLHTMDIMNSVMDEEGTRGLWRAN--NTTFIYNFLSATLDAWFTGMLSPFLQIPDP 283

Query: 107 FGLEARLH------SLVVGAFAGITSSIVSYPFDVLRTRL 140
           + ++  +H      S+ +   A + + I   P D+++TRL
Sbjct: 284 YFIDI-IHSPDPQKSIALTLAASVFTGIALLPLDLIKTRL 322

>KLLA0A05071g complement(452333..453730) similar to sp|P25340
           Saccharomyces cerevisiae YGL012w ERG4 sterol C-24
           reductase, start by similarity
          Length = 465

 Score = 30.8 bits (68), Expect = 1.3,   Method: Compositional matrix adjust.
 Identities = 25/95 (26%), Positives = 41/95 (43%), Gaps = 19/95 (20%)

Query: 210 ELATLNHSAGTIGGVIAKIITFP--LETIRRRMQFMNSKHLEKFSRHSSVYGSYKGYGFA 267
           +L  + +  G I GVI  ++ FP  +  +    QF N      + +    +G + G+   
Sbjct: 24  KLEEIEYEFGGIPGVIGMMVGFPALMYYMWLSAQFYNGA--PAWPKDGETWGQFLGHL-- 79

Query: 268 RIGLQILKQEGVSSLYRGILVALSKTIPTTFVSFW 302
              LQ++K  GV SLY            T F++FW
Sbjct: 80  ---LQLVKDHGVPSLYAW----------TIFLTFW 101

>Scas_433.1
          Length = 1167

 Score = 29.3 bits (64), Expect = 4.5,   Method: Compositional matrix adjust.
 Identities = 22/80 (27%), Positives = 36/80 (45%), Gaps = 7/80 (8%)

Query: 214 LNHSAGTIGGVIAKIITF----PLETIRRRMQFMNSKHLEKFSRHSSVYGSYKGYGFARI 269
           L+ S     G +AK ++       +  RR  Q MNS     F+  +  + S  G GF+ +
Sbjct: 917 LSDSMAKFTGSVAKGLSVTQDSDFQKARRLQQRMNSTSRNVFATSAQSFASTLGSGFSGV 976

Query: 270 GLQILK---QEGVSSLYRGI 286
            L   K   +EG S  ++G+
Sbjct: 977 ALDPYKAAQKEGTSGFFKGL 996

>KLLA0E22880g complement(2033077..2034387) similar to
           ca|CA2800|IPF11366 Candida albicans unknown function,
           hypothetical start
          Length = 436

 Score = 29.3 bits (64), Expect = 4.5,   Method: Compositional matrix adjust.
 Identities = 25/82 (30%), Positives = 35/82 (42%), Gaps = 4/82 (4%)

Query: 116 LVVGAFAGITSSIVSYPFDVLRTRLVANNQMHSMSITREV----RDIWKLEGLPGFFKGS 171
           L  G  AG   +IVS P D + TR   +  + S      +    RD  +  GL G F G 
Sbjct: 164 LRAGFLAGAAQAIVSAPIDAIYTRANIDELLSSAKKYDNLWLYSRDKIREIGLIGCFGGF 223

Query: 172 IASMTTITLTASIMFGTYETIR 193
             S    +   ++ F T+E IR
Sbjct: 224 GLSFIRESFGFALYFTTFEMIR 245

>Scas_696.9
          Length = 312

 Score = 28.9 bits (63), Expect = 4.8,   Method: Compositional matrix adjust.
 Identities = 34/134 (25%), Positives = 52/134 (38%), Gaps = 19/134 (14%)

Query: 156 RDIWKLEGLPGFFKGSIASMTTITLTASIMFGTYETIRIYCDENEKTTAAHKK---WELA 212
           R I+  EGL G +KG  A            FG    +  +  +    T    +   WE  
Sbjct: 158 RSIYAKEGLRGIYKGVNAVAIRQMTNWGSRFGFSRLVEDWVRKATGKTKPEDRLNAWE-- 215

Query: 213 TLNHSAGTIGGVIAKIITFPLETIRRRMQFMNSKHLEKFSRHSSVYGSYKGYGFARIGLQ 272
                A  +GG ++     P+E IR  MQ  + K      ++ +V  ++K          
Sbjct: 216 --KIGATAVGGGLSAW-NQPIEVIRVEMQ--SKKEDPNRPKNLTVAKTFK---------Y 261

Query: 273 ILKQEGVSSLYRGI 286
           I+K  GV  LYRG+
Sbjct: 262 IMKTNGVKGLYRGV 275

 Score = 28.5 bits (62), Expect = 6.6,   Method: Compositional matrix adjust.
 Identities = 39/166 (23%), Positives = 75/166 (45%), Gaps = 21/166 (12%)

Query: 37  MDTIKIRLQLTPANGLKPFGSQVMEVARSMIKNEGIRSFWKGNIPGSLLYVTYGSAQFSS 96
           M T++I  +L  A+   P  S    V RS+   EG+R  +KG    ++  +T   ++F  
Sbjct: 133 MKTVEI-TRLKSASAGAPVQSS-WNVFRSIYAKEGLRGIYKGVNAVAIRQMTNWGSRFGF 190

Query: 97  YSLFNRYLTPF----GLEARLHSL-VVGAFA-GITSSIVSYPFDVLRTRLVAN----NQM 146
             L   ++         E RL++   +GA A G   S  + P +V+R  + +     N+ 
Sbjct: 191 SRLVEDWVRKATGKTKPEDRLNAWEKIGATAVGGGLSAWNQPIEVIRVEMQSKKEDPNRP 250

Query: 147 HSMSITREVRDIWKLEGLPGFFKGSIASMTTITLTASIMFGTYETI 192
            ++++ +  + I K  G+ G ++G         +T  I  G ++T+
Sbjct: 251 KNLTVAKTFKYIMKTNGVKGLYRG---------VTPRIGLGIWQTV 287

>KLLA0C00869g 64120..65241 similar to sgd|S0002939 Saccharomyces
           cerevisiae YDR531w, hypothetical start
          Length = 373

 Score = 28.5 bits (62), Expect = 7.1,   Method: Compositional matrix adjust.
 Identities = 15/54 (27%), Positives = 28/54 (51%), Gaps = 6/54 (11%)

Query: 198 ENEKTTAAHKKWELATLNHSAGTIGGVIAKIITFPLETIRRRMQFMNSKHLEKF 251
           E+E T  +   + +A        IGG +AK++  PL T R   + + ++ +E+F
Sbjct: 18  EDETTNGSGNVFTIAV------DIGGTLAKVVFMPLNTNRLMFRTLETERIEEF 65

>KLLA0E03399g 317949..319391 similar to sgd|S0002878 Saccharomyces
           cerevisiae YDR470c, start by similarity
          Length = 480

 Score = 28.5 bits (62), Expect = 7.5,   Method: Compositional matrix adjust.
 Identities = 25/121 (20%), Positives = 53/121 (43%), Gaps = 14/121 (11%)

Query: 52  LKPFGSQVMEVARSMIKNEGIRSFWKGNIPGSLLYVTYGSAQFSSY-----SLFNRYLTP 106
           +KP     +++  S++  EGI+  W+ N   +     + S    ++     S   +   P
Sbjct: 210 IKPASIHTIDILNSIMDKEGIQGVWRAN--NTEFIYNFLSISLDAWFTGLLSPLMQIPDP 267

Query: 107 FGLEARLHSLVVGA------FAGITSSIVSYPFDVLRTRLVANNQMHSMSITREVRDIWK 160
           + ++  +HS  V         A   + +V  P D++R RL+ ++  +  S++   R + K
Sbjct: 268 YFIDI-IHSPDVTKSASLILLASCMTRLVLLPLDLVRVRLIISSVRNDGSLSDNDRSLRK 326

Query: 161 L 161
           L
Sbjct: 327 L 327

>Kwal_47.18297
          Length = 472

 Score = 28.5 bits (62), Expect = 8.2,   Method: Compositional matrix adjust.
 Identities = 25/100 (25%), Positives = 46/100 (46%), Gaps = 14/100 (14%)

Query: 52  LKPFGSQVMEVARSMIKNEGIRSFWKGN---IPGSLLYVTYGSAQFSSYSLFNRYLTPFG 108
           ++P     M++  S+++ EG R  W+ N      + L VT  +      S F +   PF 
Sbjct: 208 IQPESLNTMDILNSVMEEEGSRGLWRANNTFFIYNFLSVTLDAWFTGLLSPFLQIPDPFF 267

Query: 109 LEARLHS--------LVVGAFAGITSSIVSYPFDVLRTRL 140
           ++  +HS        L +G  A + + ++  P D++R RL
Sbjct: 268 IDI-VHSTDIRKSVLLTIG--ASVFTGLMLLPVDLIRARL 304

  Database: blastdb
    Posted date:  Apr 3, 2006  3:33 PM
  Number of letters in database: 16,596,109
  Number of sequences in database:  34,618
  
Lambda     K      H
   0.321    0.135    0.394 

Gapped
Lambda     K      H
   0.267   0.0410    0.140 

Matrix: BLOSUM62
Gap Penalties: Existence: 11, Extension: 1
Number of Sequences: 34618
Number of Hits to DB: 9,280,352
Number of extensions: 355199
Number of successful extensions: 2548
Number of sequences better than 10.0: 218
Number of HSP's gapped: 1441
Number of HSP's successfully gapped: 600
Length of query: 309
Length of database: 16,596,109
Length adjustment: 101
Effective length of query: 208
Effective length of database: 13,099,691
Effective search space: 2724735728
Effective search space used: 2724735728
Neighboring words threshold: 11
Window for multiple hits: 40
X1: 16 ( 7.4 bits)
X2: 38 (14.6 bits)
X3: 64 (24.7 bits)
S1: 41 (21.9 bits)
S2: 61 (28.1 bits)