Hit NameLength (aa)HSP LengthHSP ScoreHSP Significance
YGR093W50749926750.0
Scas_716.3250950912781e-173
KLLA0D14927g50751310281e-135
ADR034W4043979971e-132
CAGL0G03069g4865049751e-127
Kwal_23.39913573668411e-109
CAGL0L13222g28249655.8
KLLA0D11264g679104656.9
KLLA0C18007g56838657.3
Kwal_14.255041833647.9
Scas_375.232756648.4
Scas_721.104*60753649.3
BLASTP 2.2.26 [Sep-21-2011]

Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, 
Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), 
"Gapped BLAST and PSI-BLAST: a new generation of protein database search
programs",  Nucleic Acids Res. 25:3389-3402.

Reference for compositional score matrix adjustment: Altschul, Stephen F., 
John C. Wootton, E. Michael Gertz, Richa Agarwala, Aleksandr Morgulis,
Alejandro A. Schaffer, and Yi-Kuo Yu (2005) "Protein database searches
using compositionally adjusted substitution matrices", FEBS J. 272:5101-5109.

Query= YGR093W
         (499 letters)

Database: blastdb 
           34,618 sequences; 16,596,109 total letters

Searching..................................................done

                                                                 Score    E
Sequences producing significant alignments:                      (bits) Value

YGR093W (YGR093W) [2053] chr7 (670390..671913) Member of the pro...  1035   0.0  
Scas_716.32                                                           496   e-173
KLLA0D14927g 1258177..1259700 similar to sp|P53255 Saccharomyces...   400   e-135
ADR034W [1775] [Homologous to ScYGR093W - SH] complement(767110....   388   e-132
CAGL0G03069g 284268..285728 similar to sp|P53255 Saccharomyces c...   380   e-127
Kwal_23.3991                                                          328   e-109
CAGL0L13222g 1411493..1412341 similar to sp|P38634 Saccharomyces...    30   5.8  
KLLA0D11264g complement(962069..964108) some similarities with s...    30   6.9  
KLLA0C18007g complement(1599968..1601674) weakly similar to sp|P...    30   7.3  
Kwal_14.2550                                                           29   7.9  
Scas_375.2                                                             29   8.4  
Scas_721.104*                                                          29   9.3  

>YGR093W (YGR093W) [2053] chr7 (670390..671913) Member of the
           protein similar to CwfJ N-terminus 1 containing family
           and of the CwfJ N-terminus 2 containing family, has low
           similarity to uncharacterized C. albicans Orf6.6477p
           [1524 bp, 507 aa]
          Length = 507

 Score = 1035 bits (2675), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 499/499 (100%), Positives = 499/499 (100%)

Query: 1   MTNAKILVAHISESDADEAIRKIKKVNEKSGPFDLIIIFSNSYDENFELNTDGLPQLILL 60
           MTNAKILVAHISESDADEAIRKIKKVNEKSGPFDLIIIFSNSYDENFELNTDGLPQLILL
Sbjct: 1   MTNAKILVAHISESDADEAIRKIKKVNEKSGPFDLIIIFSNSYDENFELNTDGLPQLILL 60

Query: 61  SCDKANNSKSKKINENVTLLHNMGTYKLANGITLSYFIYPDDTLQGEKKSILDEFGKSED 120
           SCDKANNSKSKKINENVTLLHNMGTYKLANGITLSYFIYPDDTLQGEKKSILDEFGKSED
Sbjct: 61  SCDKANNSKSKKINENVTLLHNMGTYKLANGITLSYFIYPDDTLQGEKKSILDEFGKSED 120

Query: 121 QVDILLTKEWGLSISERCGRLSGSEVVDELAKKLQARYHFAFSDEINFYELEPFQWERER 180
           QVDILLTKEWGLSISERCGRLSGSEVVDELAKKLQARYHFAFSDEINFYELEPFQWERER
Sbjct: 121 QVDILLTKEWGLSISERCGRLSGSEVVDELAKKLQARYHFAFSDEINFYELEPFQWERER 180

Query: 181 LSRFLNIPKYGSGKKWAYAFNMPIGDNELKDEPEPPNLIANPYNSVVTNSNKRPLETETE 240
           LSRFLNIPKYGSGKKWAYAFNMPIGDNELKDEPEPPNLIANPYNSVVTNSNKRPLETETE
Sbjct: 181 LSRFLNIPKYGSGKKWAYAFNMPIGDNELKDEPEPPNLIANPYNSVVTNSNKRPLETETE 240

Query: 241 NSFDGDKQVLANREKNENKKIRTILPSSCHFCFSNPNLEDHMIISIGKLVYLTTAKGPLS 300
           NSFDGDKQVLANREKNENKKIRTILPSSCHFCFSNPNLEDHMIISIGKLVYLTTAKGPLS
Sbjct: 241 NSFDGDKQVLANREKNENKKIRTILPSSCHFCFSNPNLEDHMIISIGKLVYLTTAKGPLS 300

Query: 301 VPKGDMDISGHCLIIPIEHIPKLDPSKNAELTQSILAYEASLVKMNYIKFDMCTIVFEIQ 360
           VPKGDMDISGHCLIIPIEHIPKLDPSKNAELTQSILAYEASLVKMNYIKFDMCTIVFEIQ
Sbjct: 301 VPKGDMDISGHCLIIPIEHIPKLDPSKNAELTQSILAYEASLVKMNYIKFDMCTIVFEIQ 360

Query: 361 SERSIHFHKQVIPVPKYLVLKFCSALDRQVHFNNEKFTRNAKLEFQCYDSHSSKQYVDVI 420
           SERSIHFHKQVIPVPKYLVLKFCSALDRQVHFNNEKFTRNAKLEFQCYDSHSSKQYVDVI
Sbjct: 361 SERSIHFHKQVIPVPKYLVLKFCSALDRQVHFNNEKFTRNAKLEFQCYDSHSSKQYVDVI 420

Query: 421 NNQSNNYLQFTVYETPEADPKIYLATFNASETIDLQFGRRVLAFLLNLPRRVKWNSSTCL 480
           NNQSNNYLQFTVYETPEADPKIYLATFNASETIDLQFGRRVLAFLLNLPRRVKWNSSTCL
Sbjct: 421 NNQSNNYLQFTVYETPEADPKIYLATFNASETIDLQFGRRVLAFLLNLPRRVKWNSSTCL 480

Query: 481 QTKQQETIEAEKFQKAYRT 499
           QTKQQETIEAEKFQKAYRT
Sbjct: 481 QTKQQETIEAEKFQKAYRT 499

>Scas_716.32
          Length = 509

 Score =  496 bits (1278), Expect = e-173,   Method: Compositional matrix adjust.
 Identities = 251/509 (49%), Positives = 341/509 (66%), Gaps = 19/509 (3%)

Query: 1   MTNAKILVAHISESDADEAIRKIKKVNEKSGPFDLIIIFSNSYDENFELNTDGLPQL-IL 59
           M  AK+LV H+    A+  I K+K++NEKSGPF+ I    +   +  +++   LP +   
Sbjct: 1   MVQAKVLVIHLKNESAESVINKVKRLNEKSGPFECIFFLGDLLSKLDQVDISTLPPIYCF 60

Query: 60  LSCDKANNSKSKKINENVTLLHNMGTYKLANGITLSYFIYPDDTLQGEKKSILDEFGKSE 119
            S   +  + S ++  N+T L+  G Y++ N + + Y    +      K  IL++F    
Sbjct: 61  TSLPDSPVNGSDEVQANLTRLNGYGVYQMTNKLRIGYIALEEAKCNELKDKILEKFKLVN 120

Query: 120 DQVDILLTKEWGLSISERCGRLSGSEVVDELAKKLQARYHFAFSDEINFYELEPFQW-ER 178
             +DIL+T+EW   I+E   RLSGS+ +D++AK LQ RYHF +SD   F+EL PF W E+
Sbjct: 121 APIDILITREWSTHIAELKDRLSGSDTIDDVAKLLQPRYHFTYSDNDTFFELNPFLWNEK 180

Query: 179 ERLSRFLNIPKYGSGKKWAYAFNMPI-GDNELKDEPE---PPNLIANPYNSVVTNSNKRP 234
           E +SRF+N+  YGSG KWAYAFN+ I  D++++DE E   P NLI+NPY++  TN  KRP
Sbjct: 181 ESVSRFINLATYGSGSKWAYAFNIKIETDDDIEDEHESNLPTNLISNPYST--TNIKKRP 238

Query: 235 LETETENSFDGDKQVLANREKNENKKIRTILPSSCHFCFSNPNLEDHMIISIGKLVYLTT 294
           ++       D D Q +  +     KK R +LP  CHFCF+NPN+EDHMIISI    Y+TT
Sbjct: 239 MDL-----IDTDGQQVT-KSSISLKKPRKVLPIDCHFCFTNPNMEDHMIISIDDSAYMTT 292

Query: 295 AKGPLSVPKGDMDISGHCLIIPIEHIPKLDPSKN-----AELTQSILAYEASLVKMNYIK 349
           AKGPL+VPKGDM+  GHCLIIPIEHIPK +           L + +LAYE S+V MNY K
Sbjct: 293 AKGPLTVPKGDMNFPGHCLIIPIEHIPKFNNVDGQSPFETPLGKDLLAYERSVVNMNYQK 352

Query: 350 FDMCTIVFEIQSERSIHFHKQVIPVPKYLVLKFCSALDRQVHFNNEKFTRNAKLEFQCYD 409
           FDM TIVFEI SERSIHFHKQV P+PKYL++KF  +LDRQ+HFNNEK++RNAKL F+ ++
Sbjct: 353 FDMSTIVFEINSERSIHFHKQVFPIPKYLIMKFNESLDRQLHFNNEKYSRNAKLNFEKFE 412

Query: 410 SHSSKQYVDVINNQSNNYLQFTVYETPEADPKIYLATFNASETIDLQFGRRVLAFLLNLP 469
           + S  +Y  ++ N + NYLQFTVYETP  +P IY++ F   + +DLQFGRRV+AFLL+LP
Sbjct: 413 TTSDLRYEAIVKNSNMNYLQFTVYETPITEPAIYVSKFELDDRLDLQFGRRVVAFLLHLP 472

Query: 470 RRVKWNSSTCLQTKQQETIEAEKFQKAYR 498
            R+ W+S TC QTK+QE I+ EKFQK+Y+
Sbjct: 473 NRLNWDSPTCQQTKEQEMIDVEKFQKSYK 501

>KLLA0D14927g 1258177..1259700 similar to sp|P53255 Saccharomyces
           cerevisiae YGR093w singleton, start by similarity
          Length = 507

 Score =  400 bits (1028), Expect = e-135,   Method: Compositional matrix adjust.
 Identities = 216/513 (42%), Positives = 308/513 (60%), Gaps = 36/513 (7%)

Query: 5   KILVAHISESDADEAIRKIKKVNEKSGPFDLIIIFSNSYD-----ENFELNTDGLPQLIL 59
           KILV + ++    + +     ++ KSGPF   +I  +         NF++    LP  I 
Sbjct: 5   KILVLNTNDESLLDVLAVANTLHNKSGPFACALILGDVKKCSDALTNFQME---LPTYIG 61

Query: 60  LSCD--KANNSKSKKINENVTLLHNMGTYKLANGITLSYFIYPDDTLQGEKKSILDEFGK 117
              +    N S S+ +NEN+T+L+  G  KLANG+ + Y           +  +L  F +
Sbjct: 62  NGSELSDGNISHSRDLNENLTVLNGFGFIKLANGLKIGYLAETSKLSDSARAEVLKNFQE 121

Query: 118 SEDQ--VDILLTKEWGLSISERCGRLSGSEVVDELAKKLQARYHFAFSDEINFYELEPFQ 175
             +Q   DILL+ +W  +ISER   + G+ +VD++A  ++ +YHF   +E  F+EL+PF 
Sbjct: 122 LSEQTSADILLSYDWSEAISERENLILGNSLVDQVASLMKPKYHFTGKNEKQFFELDPFV 181

Query: 176 WER--ERLSRFLNIPKYGSGKKWAYAFNMPIGDNELKDEPEPPNLIANPYNSVVTNSNKR 233
           W+   E + RF+N+ ++ SG KWAYAF + + +     E  P NLI NPY  +   S KR
Sbjct: 182 WDHTNEHICRFINVAQFKSGSKWAYAFKINLLEGL---ETIPDNLIDNPY--LEKPSGKR 236

Query: 234 PL--ETETENSFDGDKQVLANREKNENKKIRTILPSSCHFCFSNPNLEDHMIISIGKLVY 291
            L  + ET+NS    K+          +K + +LPS C FC SN  L DHMIISI K  Y
Sbjct: 237 DLVPDPETDNSSAVSKK---------QRKPKQVLPSECRFCLSNTKLNDHMIISISKFSY 287

Query: 292 LTTAKGPLSVPKGDMDISGHCLIIPIEHIPKLDPSK------NAELTQSILAYEASLVKM 345
           +T AKGPL+ P  DMD SGHCLIIPIEHIPKL+ +K      + +L + +  +E S+ +M
Sbjct: 288 ITIAKGPLTTPGNDMDFSGHCLIIPIEHIPKLNTAKQEAVITDTDLFKDLNKFEESIAEM 347

Query: 346 NYIKFDMCTIVFEIQSERSIHFHKQVIPVPKYLVLKFCSALDRQVHFNNEKFTRNAKLEF 405
           N+ ++DM T++FEI S  +IHFHKQ+IPVPKYL+  F SAL+RQVH NNEKF  NAKLEF
Sbjct: 348 NFKRYDMSTLIFEINSSNAIHFHKQLIPVPKYLIGNFISALNRQVHMNNEKFKSNAKLEF 407

Query: 406 QCYDSHSSKQYVDVINNQSNNYLQFTVYETPEADPKIYLATFNASETIDLQFGRRVLAFL 465
           + ++    K+Y+ ++N+   NY QF + ET  + PK+Y++ F+  E IDLQFGRRV AFL
Sbjct: 408 KEFEGFDDKEYLGLVNDHETNYFQFIIRETASSKPKVYISVFDKDERIDLQFGRRVAAFL 467

Query: 466 LNLPRRVKWNSSTCLQTKQQETIEAEKFQKAYR 498
           L  P+R  W+S  C QTKQQE  +   FQ+AY+
Sbjct: 468 LKQPKRTMWDSKVCFQTKQQEEKDVSNFQRAYK 500

>ADR034W [1775] [Homologous to ScYGR093W - SH]
           complement(767110..768324) [1215 bp, 404 aa]
          Length = 404

 Score =  388 bits (997), Expect = e-132,   Method: Compositional matrix adjust.
 Identities = 186/397 (46%), Positives = 266/397 (67%), Gaps = 32/397 (8%)

Query: 114 EFGKSEDQVDILLTKEWGLSISERCGRLSGSEVVDELAKKLQARYHFAFSDEINFYELEP 173
           E  K   ++DILLTKEW  S+  +   +SG++ VD+L    + +YHFA   +  ++ELEP
Sbjct: 22  EIFKKVGRLDILLTKEWPKSVRSKLEEVSGTDTVDQLVISSKPQYHFATLGD-KYFELEP 80

Query: 174 FQWERERL---SRFLNIPKYGSGKKWAYAFNMPIGDNELKDEPEPPNLIANPYNSVVTNS 230
           F W+R  +   +RF+N+  +GSG+KWAYAFN+ +G ++  +   P NL  NP+  +  + 
Sbjct: 81  FGWDRSSMPDITRFINLATFGSGEKWAYAFNITVGTDQ--EASVPTNLTTNPF--ITMDR 136

Query: 231 NKRPLETETENSFDGDKQVLANREKNENKKIRTILPSSCHFCFSNPNLEDHMIISIGKLV 290
            KR L+++                    KK   +LP++CHFC SNP++EDHM+ISIGK  
Sbjct: 137 PKRDLDSD---------------PLPPPKKRTKVLPAACHFCLSNPSVEDHMVISIGKHS 181

Query: 291 YLTTAKGPLSVPKGDMDISGHCLIIPIEHIPKLDPSK---------NAELTQSILAYEAS 341
           YLT AKGPLSVP+G+M  SGHCLIIPI+H+PK + +            E+ + ++ YE++
Sbjct: 182 YLTIAKGPLSVPRGEMTFSGHCLIIPIDHVPKFNSASPDQTTSAIMETEMGKEVMRYESA 241

Query: 342 LVKMNYIKFDMCTIVFEIQSERSIHFHKQVIPVPKYLVLKFCSALDRQVHFNNEKFTRNA 401
           LV MNY KFDM T+VFEI S  S+HFHKQV+PVPKYL+  F +ALDRQ+H NNEKF +NA
Sbjct: 242 LVNMNYKKFDMSTLVFEINSVNSVHFHKQVVPVPKYLIGSFTTALDRQLHINNEKFKKNA 301

Query: 402 KLEFQCYDSHSSKQYVDVINNQSNNYLQFTVYETPEADPKIYLATFNASETIDLQFGRRV 461
              FQ ++      ++ ++N+   NY+QFTVYET +A PK+++ATF + ++IDLQFGRRV
Sbjct: 302 NFTFQDFEGLQHPDFLALVNDPKTNYMQFTVYETHKASPKVFIATFKSEDSIDLQFGRRV 361

Query: 462 LAFLLNLPRRVKWNSSTCLQTKQQETIEAEKFQKAYR 498
            AFLL LP+RV WNS  CLQ+K++E IE + FQ++++
Sbjct: 362 AAFLLKLPKRVIWNSKACLQSKEEEEIEVKDFQRSFQ 398

>CAGL0G03069g 284268..285728 similar to sp|P53255 Saccharomyces
           cerevisiae YGR093w, hypothetical start
          Length = 486

 Score =  380 bits (975), Expect = e-127,   Method: Compositional matrix adjust.
 Identities = 204/504 (40%), Positives = 315/504 (62%), Gaps = 36/504 (7%)

Query: 5   KILVAHISESDADEAIRKIKKVNEKSGPFDLIIIFS-NSYDENFELNTDGLPQLILLSCD 63
           KI+VA+    +  EA+ KI+  NEK+GPF+ + +   N  D +++L        IL++  
Sbjct: 2   KIMVANPGLENTKEALDKIQIANEKNGPFETVFLLGQNKEDTSYDLKD---TNTILVTNQ 58

Query: 64  KANNSKSKKINENVTLLHNMGTYKLANGITLSYFIYPDDTLQGEKKSILDEFGKSEDQVD 123
             N   ++K   +V +LH  G  KLA+G+ + Y     ++LQ EKKSIL+ F  S++ +D
Sbjct: 59  LKNGRTTRK--SSVIILHGFGIMKLASGLVVGYITLSKNSLQQEKKSILEYFKASKEFID 116

Query: 124 ILLTKEWGLSISERCG-RLSGSEVVDELAKKLQARYHFAFSDEINFYELEPFQWER---- 178
           +L+T     +++     + +G+ ++DE+ K  + +YH  +  +  +++++PF W      
Sbjct: 117 VLVTNIGSKAVASHLQYKANGNSIIDEVMKHCKPQYHLTYDGDRGYHDMKPFCWGETSSD 176

Query: 179 ERLSRFLNIPKYG--SGKKWAYAFNMPIGD--NELKDEPEPPNLIANPYNSVVTNSNKRP 234
            +++R+ N+P Y   +  KW  AF++  G   NE+ D      L  NPY  ++  + KR 
Sbjct: 177 SQITRYYNLPSYSPITKSKWIVAFSIEPGKDFNEINDYKN--ELGTNPY--LLKPALKR- 231

Query: 235 LETETENSFDGDKQVLANREKNENKKIRTILPSSCHFCFSNPNLEDHMIISIGKLVYLTT 294
                      D+  +   E+N + K   I  ++CHFCFSNPN+ED MI++I K  YLT 
Sbjct: 232 -----------DRSGI---EQNAHTKKTKIDSTTCHFCFSNPNVEDQMIVAIAKHSYLTL 277

Query: 295 AKGPLSVPKGDMDISGHCLIIPIEHIPKLDPSKNAELTQSILAYEASLVKMNYIKFDMCT 354
           AKGPL+VPKGDM  SGH LI PI H+ K+D S + EL++ I  +E+ + KMNY  FD  T
Sbjct: 278 AKGPLTVPKGDMSFSGHALITPINHVAKIDKSLDNELSKEIELFESRVAKMNYKLFDCST 337

Query: 355 IVFEIQSERSIHFHKQVIPVPKYLVLKFCSALDRQVHFNNEKFTRNAKLEFQCYDSHSSK 414
           +VFEIQS+++IHFHKQVIPVPKYL+ KF  ALDRQVH N+E+   N KLEF+ +D   ++
Sbjct: 338 VVFEIQSDKAIHFHKQVIPVPKYLITKFERALDRQVHINSER--GNCKLEFEKFDGLDNE 395

Query: 415 QYVDVINNQSNNYLQFTVYETPEADPKIYLATFNASETIDLQFGRRVLAFLLNLPRRVKW 474
           +Y  ++  +  NYLQFT+YET  +   IY+++F+ +E +DLQ+GRR LAF+LNLP+RV+W
Sbjct: 396 EYRKIVGRKDTNYLQFTIYETDTSKATIYISSFDITERLDLQYGRRTLAFVLNLPKRVQW 455

Query: 475 NSSTCLQTKQQETIEAEKFQKAYR 498
           NS  C Q+K+QE  EA+ +QK+++
Sbjct: 456 NSPICQQSKEQELKEAQLYQKSFK 479

>Kwal_23.3991
          Length = 357

 Score =  328 bits (841), Expect = e-109,   Method: Compositional matrix adjust.
 Identities = 171/366 (46%), Positives = 233/366 (63%), Gaps = 26/366 (7%)

Query: 142 SGSEVVDELAKKLQARYHFAFSDEINFYELEPFQWERER-LSRFLNIPKYGSGKKWAYAF 200
           S S +VD +      +YHF+ +    F E+ PF+W      +R LN+ ++ SG KWAYAF
Sbjct: 6   SSSPIVDFVLTNTHPKYHFSATGNDTFQEIAPFKWASTNDTTRCLNLAQFDSGAKWAYAF 65

Query: 201 NMPIGDNELKDEPEPPNLIANPYNSVVTNSNKRPLETETENSFDGDKQVLANREKNENKK 260
            +  G N   ++  P  L  NPY   +TN  KR  E+E     + D   ++       KK
Sbjct: 66  TVATGVN---NQDIPQTLGKNPYEVEITN--KRTHESE-----NADNSRIS-------KK 108

Query: 261 IRTILPSSCHFCFSNPNLEDHMIISIGKLVYLTTAKGPLSVPKGDMDISGHCLIIPIEHI 320
            + +LP  C FCFSN ++EDH+IISIG+  YLTTAKGPL++P  +M+  GHCL+IPI+HI
Sbjct: 109 PKQVLPEECRFCFSNSSIEDHLIISIGEHAYLTTAKGPLTLPTSNMNFPGHCLVIPIKHI 168

Query: 321 PKLDPSKNAELTQSI-------LAYEASLVKMNYIKFDMCTIVFEIQSERSIHFHKQVIP 373
           PK+    N+    S          YE ++ KMN+ KF+M T+ FEI SE SIH+HKQ+IP
Sbjct: 169 PKMKARHNSSADLSYDPFWRESQKYEEAIAKMNFTKFEMGTVAFEINSENSIHYHKQIIP 228

Query: 374 VPKYLVLKFCSALDRQVHFNNEKFTRNAKLEFQCYDSHSSKQYVDVINNQSNNYLQFTVY 433
           VPKYL+ KF SAL+RQVHFNN K+T NA+LEFQ ++  + + Y  +IN+   NYLQF+VY
Sbjct: 229 VPKYLINKFKSALERQVHFNNTKYTNNAQLEFQEFNGPNDEGYRSLINDYEQNYLQFSVY 288

Query: 434 ETPE-ADPKIYLATFNASETIDLQFGRRVLAFLLNLPRRVKWNSSTCLQTKQQETIEAEK 492
           E  + A PK Y+ATF   E IDLQFGRRV+AF+L LP+R KW+S  C QT +QE  +  +
Sbjct: 289 EGIDGAPPKTYVATFKPDERIDLQFGRRVVAFVLRLPKRAKWDSPACRQTLEQEKNDVRE 348

Query: 493 FQKAYR 498
           FQK ++
Sbjct: 349 FQKHFK 354

>CAGL0L13222g 1411493..1412341 similar to sp|P38634 Saccharomyces
           cerevisiae YLR079w SIC1, start by similarity
          Length = 282

 Score = 29.6 bits (65), Expect = 5.8,   Method: Compositional matrix adjust.
 Identities = 17/49 (34%), Positives = 27/49 (55%), Gaps = 1/49 (2%)

Query: 5   KILVAHISESDADEAIRKIKKVNEKSGPFDLIIIFSNSYDENFELNTDG 53
           K+ ++HI +++ DE IRK+ K      P D +I F  + D N   + DG
Sbjct: 144 KLQLSHIRDAENDEQIRKMAK-QVPGTPSDKVITFEMAQDWNNVSSKDG 191

>KLLA0D11264g complement(962069..964108) some similarities with
           sp|Q03213 Saccharomyces cerevisiae YMR172w HOT1,
           hypothetical start
          Length = 679

 Score = 29.6 bits (65), Expect = 6.9,   Method: Compositional matrix adjust.
 Identities = 30/104 (28%), Positives = 46/104 (44%), Gaps = 20/104 (19%)

Query: 27  NEKSGPF--DLIIIFSNSYDENFELNTDGLPQLILLSCDKANNSKSKKINENVTLLHNMG 84
           N+  G F  +LI   SN  +++   NT G P         A N +   + +       M 
Sbjct: 251 NQGDGAFAAELINAISNVSNKHIRKNTYGFP---------AGNPQGNDMGQT------MN 295

Query: 85  TYKLANGITLSYFIYPDDTLQGEKKSILDEFGKSEDQVDILLTK 128
            Y   N + LS    P   + GE+ + L++ G S+DQ+D  LTK
Sbjct: 296 GYN--NAMQLSSMAAPMSYVPGEQVN-LNQLGNSKDQIDRFLTK 336

>KLLA0C18007g complement(1599968..1601674) weakly similar to
           sp|P53207 Saccharomyces cerevisiae YGR013w SNU71
           associated with U1 snRNP, no counterpart in mammalian U1
           snRNP singleton, start by similarity
          Length = 568

 Score = 29.6 bits (65), Expect = 7.3,   Method: Compositional matrix adjust.
 Identities = 13/38 (34%), Positives = 24/38 (63%)

Query: 216 PNLIANPYNSVVTNSNKRPLETETENSFDGDKQVLANR 253
           P+L++  + ++  + +K+ LETE   +FD D  VL +R
Sbjct: 524 PDLVSYIFENIEEHQSKQALETELTETFDEDSPVLVSR 561

>Kwal_14.2550
          Length = 418

 Score = 29.3 bits (64), Expect = 7.9,   Method: Compositional matrix adjust.
 Identities = 15/33 (45%), Positives = 22/33 (66%), Gaps = 2/33 (6%)

Query: 110 SILDEFGKSEDQVDIL--LTKEWGLSISERCGR 140
           +IL ++ K +D  D++  L KE  L ISE+CGR
Sbjct: 157 TILSKYNKLQDNDDVVDWLLKEVSLRISEKCGR 189

>Scas_375.2
          Length = 327

 Score = 29.3 bits (64), Expect = 8.4,   Method: Compositional matrix adjust.
 Identities = 22/56 (39%), Positives = 28/56 (50%), Gaps = 5/56 (8%)

Query: 70  SKKINENVTLLHNMG-TYKLANGITLSYFIYPDDTLQGEKKSILDEFGKSEDQVDI 124
           SKKIN N T L N+  T+     IT    +   D L G+K  I + FG+   Q DI
Sbjct: 7   SKKINNNATQLANLKPTFNFLKNITFRNVM---DQL-GQKLEIFESFGEGISQTDI 58

>Scas_721.104*
          Length = 607

 Score = 29.3 bits (64), Expect = 9.3,   Method: Compositional matrix adjust.
 Identities = 13/53 (24%), Positives = 27/53 (50%)

Query: 400 NAKLEFQCYDSHSSKQYVDVINNQSNNYLQFTVYETPEADPKIYLATFNASET 452
           +++L+FQC      +  + V+    ++ L   ++  P  DPK YL+ ++   T
Sbjct: 445 DSELDFQCESDSGCEHEIQVVKETDHDELLDLLFSEPYCDPKWYLSIWSILTT 497

  Database: blastdb
    Posted date:  Apr 3, 2006  3:33 PM
  Number of letters in database: 16,596,109
  Number of sequences in database:  34,618
  
Lambda     K      H
   0.317    0.134    0.389 

Gapped
Lambda     K      H
   0.267   0.0410    0.140 

Matrix: BLOSUM62
Gap Penalties: Existence: 11, Extension: 1
Number of Sequences: 34618
Number of Hits to DB: 18,011,153
Number of extensions: 868010
Number of successful extensions: 2581
Number of sequences better than 10.0: 23
Number of HSP's gapped: 2620
Number of HSP's successfully gapped: 23
Length of query: 499
Length of database: 16,596,109
Length adjustment: 106
Effective length of query: 393
Effective length of database: 12,926,601
Effective search space: 5080154193
Effective search space used: 5080154193
Neighboring words threshold: 11
Window for multiple hits: 40
X1: 16 ( 7.3 bits)
X2: 38 (14.6 bits)
X3: 64 (24.7 bits)
S1: 41 (21.6 bits)
S2: 64 (29.3 bits)