Hit NameLength (aa)HSP LengthHSP ScoreHSP Significance
YGR091W (PRP31)49446824780.0
Scas_716.3447942511211e-150
Sklu_2401.74733899231e-120
Kwal_23.39954743798201e-104
KLLA0D14883g4673707201e-89
CAGL0G03025g4793127062e-87
ADR032W4392643522e-36
AFR328C5132501726e-13
KLLA0F08613g5112081673e-12
Kwal_34.158945122081673e-12
Kwal_56.246545071991655e-12
ACL144C5491991646e-12
Scas_665.125152071621e-11
YOR310C (NOP58)5112101621e-11
KLLA0D12254g5132011612e-11
Scas_537.75101991583e-11
CAGL0A04015g5082011541e-10
YLR197W (SIK1)5041991532e-10
Sklu_1985.14981991504e-10
CAGL0I09790g5131571494e-10
CAGL0M13409g152747800.12
KLLA0C09801g58899720.98
CAGL0G05335g89091701.8
YPL169C (MEX67)599121701.9
YEL016C49393692.0
Kwal_14.255459259665.4
CAGL0J03960g435103647.2
YHR186C (KOG1)155749648.6
BLASTP 2.2.26 [Sep-21-2011]

Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, 
Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), 
"Gapped BLAST and PSI-BLAST: a new generation of protein database search
programs",  Nucleic Acids Res. 25:3389-3402.

Reference for compositional score matrix adjustment: Altschul, Stephen F., 
John C. Wootton, E. Michael Gertz, Richa Agarwala, Aleksandr Morgulis,
Alejandro A. Schaffer, and Yi-Kuo Yu (2005) "Protein database searches
using compositionally adjusted substitution matrices", FEBS J. 272:5101-5109.

Query= YGR091W
         (486 letters)

Database: blastdb 
           34,618 sequences; 16,596,109 total letters

Searching..................................................done

                                                                 Score    E
Sequences producing significant alignments:                      (bits) Value

YGR091W (PRP31) [2051] chr7 (666343..667827) Protein required fo...   959   0.0  
Scas_716.34                                                           436   e-150
Sklu_2401.7 YGR091W, Contig c2401 14483-15904                         360   e-120
Kwal_23.3995                                                          320   e-104
KLLA0D14883g 1254381..1255784 some similarities with sp|P49704 S...   281   1e-89
CAGL0G03025g 280230..281669 similar to sp|P49704 Saccharomyces c...   276   2e-87
ADR032W [1773] [Homologous to ScYGR091W (PRP31) - SH] complement...   140   2e-36
AFR328C [3520] [Homologous to ScYOR310C (NOP58) - SH] (1032031.....    71   6e-13
KLLA0F08613g complement(801623..803158) similar to sp|Q12499 Sac...    69   3e-12
Kwal_34.15894                                                          69   3e-12
Kwal_56.24654                                                          68   5e-12
ACL144C [905] [Homologous to ScYLR197W (SIK1) - SH] (94809..9645...    68   6e-12
Scas_665.12                                                            67   1e-11
YOR310C (NOP58) [5094] chr15 complement(896820..898355) Nucleola...    67   1e-11
KLLA0D12254g 1045077..1046618 highly similar to sp|Q12460 Saccha...    67   2e-11
Scas_537.7                                                             65   3e-11
CAGL0A04015g complement(397378..398904) similar to sp|Q12460 Sac...    64   1e-10
YLR197W (SIK1) [3600] chr12 (546099..547613) Nucleolar protein c...    64   2e-10
Sklu_1985.1 YLR197W, Contig c1985 148-1644 reverse complement          62   4e-10
CAGL0I09790g complement(934746..936287) highly similar to sp|Q12...    62   4e-10
CAGL0M13409g complement(1316268..1320851) similar to sp|P38873 S...    35   0.12 
KLLA0C09801g complement(846302..848068) similar to sp|Q99257 Sac...    32   0.98 
CAGL0G05335g 501279..503951 highly similar to sp|P31688 Saccharo...    32   1.8  
YPL169C (MEX67) [5278] chr16 complement(229038..230837) Protein ...    32   1.9  
YEL016C (YEL016C) [1410] chr5 complement(124737..126218) Protein...    31   2.0  
Kwal_14.2554                                                           30   5.4  
CAGL0J03960g complement(373177..374484) similar to sp|Q12206 Sac...    29   7.2  
YHR186C (KOG1) [2471] chr8 complement(475997..480670) Component ...    29   8.6  

>YGR091W (PRP31) [2051] chr7 (666343..667827) Protein required for
           pre-mRNA splicing, associated with U4/U6.U5 tri-snRNP
           [1485 bp, 494 aa]
          Length = 494

 Score =  959 bits (2478), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 468/468 (100%), Positives = 468/468 (100%)

Query: 19  VNEEKEDIQTKKLTTVNCQTEKFNPFEILPESIELFRTLALISPDRLSLSETAQILPKIV 78
           VNEEKEDIQTKKLTTVNCQTEKFNPFEILPESIELFRTLALISPDRLSLSETAQILPKIV
Sbjct: 19  VNEEKEDIQTKKLTTVNCQTEKFNPFEILPESIELFRTLALISPDRLSLSETAQILPKIV 78

Query: 79  DLKRILQQQEIDFIKLLPFFNEIIPLIKSNIKLMHNFLISLYSRRFPELSSLIPSPLQYS 138
           DLKRILQQQEIDFIKLLPFFNEIIPLIKSNIKLMHNFLISLYSRRFPELSSLIPSPLQYS
Sbjct: 79  DLKRILQQQEIDFIKLLPFFNEIIPLIKSNIKLMHNFLISLYSRRFPELSSLIPSPLQYS 138

Query: 139 KVISILENENYSKNESDELFFHLENKAKLTREQILVLTMSMKTSFKNKEPLDIKTRTQIL 198
           KVISILENENYSKNESDELFFHLENKAKLTREQILVLTMSMKTSFKNKEPLDIKTRTQIL
Sbjct: 139 KVISILENENYSKNESDELFFHLENKAKLTREQILVLTMSMKTSFKNKEPLDIKTRTQIL 198

Query: 199 EANSILENLWKLQEDIGQYIASKISIIAPNVCFLVGPEIAAQLIAHAGGVLEFSRIPSCN 258
           EANSILENLWKLQEDIGQYIASKISIIAPNVCFLVGPEIAAQLIAHAGGVLEFSRIPSCN
Sbjct: 199 EANSILENLWKLQEDIGQYIASKISIIAPNVCFLVGPEIAAQLIAHAGGVLEFSRIPSCN 258

Query: 259 IASIGKNKHLSHELHTLESGVRQEGYLFASDMIQKFPVSVHKQMLRMLCAKVSLAARVDA 318
           IASIGKNKHLSHELHTLESGVRQEGYLFASDMIQKFPVSVHKQMLRMLCAKVSLAARVDA
Sbjct: 259 IASIGKNKHLSHELHTLESGVRQEGYLFASDMIQKFPVSVHKQMLRMLCAKVSLAARVDA 318

Query: 319 GQKNGDRNTVLAHKWKAELSKKARKLSEAPSISETKALPIPEDQPKKKRAGRKFRKYKEK 378
           GQKNGDRNTVLAHKWKAELSKKARKLSEAPSISETKALPIPEDQPKKKRAGRKFRKYKEK
Sbjct: 319 GQKNGDRNTVLAHKWKAELSKKARKLSEAPSISETKALPIPEDQPKKKRAGRKFRKYKEK 378

Query: 379 FRLSHVRQLQNRMEFGKQEQTVLDSYGEEVGLGMSNTSLQQAVGATSGSRRSAGNQAKLT 438
           FRLSHVRQLQNRMEFGKQEQTVLDSYGEEVGLGMSNTSLQQAVGATSGSRRSAGNQAKLT
Sbjct: 379 FRLSHVRQLQNRMEFGKQEQTVLDSYGEEVGLGMSNTSLQQAVGATSGSRRSAGNQAKLT 438

Query: 439 KVMKHRISEANQQADEFLISLGHNTEQPNLSPEMVQMHKKQHTNPEEE 486
           KVMKHRISEANQQADEFLISLGHNTEQPNLSPEMVQMHKKQHTNPEEE
Sbjct: 439 KVMKHRISEANQQADEFLISLGHNTEQPNLSPEMVQMHKKQHTNPEEE 486

>Scas_716.34
          Length = 479

 Score =  436 bits (1121), Expect = e-150,   Method: Compositional matrix adjust.
 Identities = 212/425 (49%), Positives = 305/425 (71%), Gaps = 14/425 (3%)

Query: 42  NPFEILPESIELFRTLALIS-------PDRLSLSETAQILPKIVDLKRILQQQEIDFIKL 94
           N    L E ++ F+   ++S       P +LS+     +   I  LK +   Q   FI++
Sbjct: 57  NDTAFLNELVKTFKPSTMLSSVDMNMEPKKLSI-----VYRAIEKLKAMFHSQSTSFIEV 111

Query: 95  LPFFNEIIPLIKSNIKLMHNFLISLYSRRFPELSSLIPSPLQYSKVISILENENYSKNES 154
           LP  NE+   I+  I +++ +  ++YS RF EL ++  +P QY+KV S++E    S +++
Sbjct: 112 LPHLNELSHQIRREIDILYQYSKNIYSTRFTELDTIAATPYQYAKVTSLIEGT--SDDKA 169

Query: 155 DELFFHLENKAKLTREQILVLTMSMKTSFKNKEPLDIKTRTQILEANSILENLWKLQEDI 214
            +L  ++E +AKL++EQ+LVL MSM+TSF   +PL+ K +  +LEA S++  L  LQ  I
Sbjct: 170 GQLPINIEIEAKLSKEQVLVLRMSMQTSFLKNKPLEKKVKHLLLEACSMIIQLTDLQNVI 229

Query: 215 GQYIASKISIIAPNVCFLVGPEIAAQLIAHAGGVLEFSRIPSCNIASIGKNKHLSHELHT 274
            QYI+S +S IAPN+C LVGPE+A+ LIAH GG+L+ + IPSCN+ASIGKN+HLSHELHT
Sbjct: 230 LQYISSNVSDIAPNLCVLVGPEVASLLIAHTGGILQLAEIPSCNLASIGKNRHLSHELHT 289

Query: 275 LESGVRQEGYLFASDMIQKFPVSVHKQMLRMLCAKVSLAARVDAGQKNGDRNTVLAHKWK 334
             SGVRQEGY+++S+++Q  P+  HKQMLRM+CAKV+LAARVDAGQ+   +N +L  +W+
Sbjct: 290 TLSGVRQEGYIYSSELVQNQPIQNHKQMLRMVCAKVALAARVDAGQRGAAKNDLLGQRWR 349

Query: 335 AELSKKARKLSEAPSISETKALPIPEDQPKKKRAGRKFRKYKEKFRLSHVRQLQNRMEFG 394
            EL  K +K++E+P+IS  K LPIPED+PKKKRAGRKFRKYK++F+LSH+RQLQNRMEFG
Sbjct: 350 EELETKIQKVTESPNISNVKPLPIPEDKPKKKRAGRKFRKYKQQFQLSHLRQLQNRMEFG 409

Query: 395 KQEQTVLDSYGEEVGLGMSNTSLQQAVGATSGSRRSAGNQAKLTKVMKHRISEANQQADE 454
           KQEQ+ +D++GEE+G+GM+++S+QQ++G    S +   N AK+TKVMK R+ EA+ Q+ E
Sbjct: 410 KQEQSTMDAFGEEIGMGMTSSSIQQSIGGIRASSQRVDNSAKITKVMKRRLKEADSQSKE 469

Query: 455 FLISL 459
           F  SL
Sbjct: 470 FASSL 474

>Sklu_2401.7 YGR091W, Contig c2401 14483-15904
          Length = 473

 Score =  360 bits (923), Expect = e-120,   Method: Compositional matrix adjust.
 Identities = 185/389 (47%), Positives = 269/389 (69%), Gaps = 21/389 (5%)

Query: 69  ETAQILPKIVDLKRILQQQEIDFIKLLPFFNEIIPLIKSNIKLMHNFLISLYSRRFPELS 128
           E  Q+LP    +K+++   +   + LL   +E+ P+I+S + L+HN++ SLYS++F EL 
Sbjct: 69  ELCQLLPLQNGIKKLMLNNKFSTVTLL---SELQPVIQSELALLHNYIKSLYSKKFSELD 125

Query: 129 SLIPSPLQYSKVISILENENYSKNESDELFFHLENKAKLTREQILVLTMSMKTSFKNKEP 188
           SL+  P  YSK+I  LE  +     + E          L++EQIL+++MSMKT FK    
Sbjct: 126 SLVNPPRSYSKLIKFLETSDARDLSTLE--------GILSKEQILIVSMSMKTGFKRDLA 177

Query: 189 LDIKTRTQILEANSILENLWKLQEDIGQYIASKISIIAPNVCFLVGPEIAAQLIAHAGGV 248
           L    +T +L A  +L  L+ LQ++I  +IAS++  IAPNVC +VGP++A+++++ AGG+
Sbjct: 178 LPSDEKTYLLTAIDMLIQLYDLQDEITSFIASQVINIAPNVCAIVGPQVASKILSAAGGL 237

Query: 249 LEFSRIPSCNIASIGKNKHLSHELHTLESGVRQEGYLFASDMIQKFPVSVHKQMLRMLCA 308
           LE S++PSCN+ASIGK++++SHE++T  SGVRQ GY+++  +IQ  P  VHKQ LRM+CA
Sbjct: 238 LELSQVPSCNLASIGKDRYMSHEINTDMSGVRQRGYVYSCSLIQDQPPHVHKQALRMVCA 297

Query: 309 KVSLAARVDAGQKNGDRNTVLAHKWKAELSKKARKLSEAPSISETKALPIPEDQPKKKRA 368
           KVSLAARVD    + +++  L  KW  E+S+K  KL + P+IS TK LPIPED+PKKKRA
Sbjct: 298 KVSLAARVDI---SNNKDNSLGVKWANEISEKLNKLQDPPNISNTKPLPIPEDKPKKKRA 354

Query: 369 GRKFRKYKEKFRLSHVRQLQNRMEFGKQEQTVLDSYGEEVGLGMSNTSLQQAVGATSGSR 428
           GRKFRKYK++F+LSH+RQLQNR+EFG QE+TV+DSYGEE+G+GM+  SLQ    +T    
Sbjct: 355 GRKFRKYKQQFQLSHLRQLQNRVEFGTQERTVIDSYGEEIGMGMAG-SLQATQYSTH--- 410

Query: 429 RSAGNQAKLTKVMKHRISEANQQADEFLI 457
               N AK+ K MK RI++A     +F++
Sbjct: 411 ---NNTAKMRKSMKRRIADAEDNVRDFVL 436

>Kwal_23.3995
          Length = 474

 Score =  320 bits (820), Expect = e-104,   Method: Compositional matrix adjust.
 Identities = 171/379 (45%), Positives = 245/379 (64%), Gaps = 22/379 (5%)

Query: 98  FNEIIPLIKSNIKLMHNFLISLYSRRFPELSSLIPSPLQYSKVISILENENYSKNESDEL 157
            +++ P++   + L+   +  +Y RRFPEL SL+ SP  Y++V+  LE  +   NE +  
Sbjct: 89  LSKLQPIVLEEMGLLQKLMAKIYERRFPELQSLMTSPKGYAQVVKHLETSDI--NEGN-- 144

Query: 158 FFHLENKAKLTREQILVLTMSMKTSFKNKEPLDIKTRTQILEANSILENLWKLQEDIGQY 217
              LE+   +++E  LVL+M+M T FK   PL  +    +++   +L  L  +++ I +Y
Sbjct: 145 LRGLEDI--ISKEHFLVLSMAMHTGFKQDVPLTAEDSRLVIQTADVLLELCDIRDKIERY 202

Query: 218 IASKISIIAPNVCFLVGPEIAAQLIAHAGGVLEFSRIPSCNIASIGKNKHLSHELHTLES 277
           +AS +S +APN+C LVG +IAA LIA AGG+ E S IPSCN++SIGK K+ SH   T  S
Sbjct: 203 VASLVSDVAPNLCILVGSQIAASLIAVAGGLSELSEIPSCNLSSIGKTKNSSHTSDTDAS 262

Query: 278 GVRQEGYLFASDMIQKFPVSVHKQMLRMLCAKVSLAARVDAGQKNGDRNTVLAHKWKAEL 337
           GVRQ+GY++ SD++   PVS  KQ LRM+CAKVSL AR D  +     +  L  KWK ++
Sbjct: 263 GVRQKGYIYQSDLVSGQPVSFQKQALRMVCAKVSLCARADRSKSC--PSGTLGAKWKEQV 320

Query: 338 SKKARKLSEAPSISETKALPIPEDQPKKKRAGRKFRKYKEKFRLSHVRQLQNRMEFGKQE 397
            +K RKL + P+IS TKALPIPED+PKKKRAGR+FRKYKE+F+LSH RQLQNRMEFGKQE
Sbjct: 321 LEKLRKLQDPPNISNTKALPIPEDKPKKKRAGRRFRKYKEQFQLSHTRQLQNRMEFGKQE 380

Query: 398 QTVLDSYGEEVGLGMSNTSLQQAVGATSGSRRSAGNQAKLTKVMKHRISEANQQADEFLI 457
            T  D++GEE+G+GM++T     + A +   R   N+AK+ K M+ R+   +Q   +FL 
Sbjct: 381 NTTFDAFGEEIGMGMAHT-----LRAPTTVFR---NRAKMRKSMQQRLLSESQGTQDFLT 432

Query: 458 S------LGHNTEQPNLSP 470
           +      LG+ +   + SP
Sbjct: 433 TDDRSNILGNTSTALSASP 451

>KLLA0D14883g 1254381..1255784 some similarities with sp|P49704
           Saccharomyces cerevisiae YGR091w PRP31 pre-mRNA splicing
           protein, hypothetical start
          Length = 467

 Score =  281 bits (720), Expect = 1e-89,   Method: Compositional matrix adjust.
 Identities = 145/370 (39%), Positives = 231/370 (62%), Gaps = 33/370 (8%)

Query: 98  FNEIIPLIKSNIKLMHNFLISLYSRRFPELSSLIPSPLQYSKVISILENENYSKNESDEL 157
             +++PL  + + ++   ++  Y  +FP L +++P   QY  V+ +L+ ++    + D++
Sbjct: 92  LGQLMPLFDTELSMVFQCIVDTYKAKFPGLETIVPERKQYVDVVKMLQ-QDIPNVQLDQV 150

Query: 158 FFHLENKAKLTREQILVLTMSMKTSFKNKEPLDIKTRTQILEANSILENLWKLQEDIGQY 217
                    L++E+ LV++MS+KT FK    +D    ++ +    IL NL   ++++  Y
Sbjct: 151 ---------LSKEETLVVSMSLKTDFKEGARIDKDLLSKAIHWFDILYNL---RDNVSHY 198

Query: 218 IASKISIIAPNVCFLVGPEIAAQLIAHAGGVLEFSRIPSCNIASIGKNKHLSHELHTLES 277
           + ++I ++APN+C L+GP+ AA+L+ H G V E S +PSCN+ASIG++K L H      S
Sbjct: 199 VETRIQMVAPNLCALLGPDTAAKLVTHCGSVKELSVVPSCNLASIGQDKTL-HGKSLDIS 257

Query: 278 GVRQEGYLFASDMIQKFPVSVHKQMLRMLCAKVSLAARVDA----------GQKNGDRN- 326
           GVRQ+GYLF +D++Q  P    KQ LRM+ AKV+LAAR D           G  +G+ + 
Sbjct: 258 GVRQKGYLFYTDVVQTQPPEFQKQALRMVSAKVALAARADCTMGNQVINPDGNSDGNSDA 317

Query: 327 TVLAHKWKAELSKKARKLSEAPSISETKALPIPEDQPKKKRAGRKFRKYKEKFRLSHVRQ 386
           + L  KW+ E+ +K +K+ + P+IS  K LPIPED PKKKRAGR+FRKYKE+F++SH+RQ
Sbjct: 318 SKLGLKWRHEIVEKLKKIIDPPNISNIKPLPIPEDAPKKKRAGRRFRKYKEQFKMSHLRQ 377

Query: 387 LQNRMEFGKQEQTVLDSYGEEVGLGMSNTSLQQAVGATSGSRRSAGNQAKLTKVMKHRIS 446
           +QNRMEFGK+EQT +D YGEE+G GM+++    A+        S+ N+ K+ K M+ R+ 
Sbjct: 378 MQNRMEFGKEEQTTMDPYGEEIGFGMADSKNVSAL--------SSFNKTKMRKSMRLRLD 429

Query: 447 EANQQADEFL 456
           +  +    FL
Sbjct: 430 QETKNTHSFL 439

>CAGL0G03025g 280230..281669 similar to sp|P49704 Saccharomyces
           cerevisiae YGR091w PRP31 pre-mRNA splicing protein,
           hypothetical start
          Length = 479

 Score =  276 bits (706), Expect = 2e-87,   Method: Compositional matrix adjust.
 Identities = 139/312 (44%), Positives = 201/312 (64%), Gaps = 7/312 (2%)

Query: 116 LISLYSRRFPELSSLIPSPLQYSKVISILENENYSKNESDELFFHLENKAKLTREQILVL 175
           L  +Y  +F EL S++  P QY++ IS+LE       E +++    E     +RE I+VL
Sbjct: 131 LTEIYEDKFSELKSILRLPHQYAQCISLLE----QGLELEQVVLRFEELCSTSRELIMVL 186

Query: 176 TMSMKTSFKNKEPLDIKTRTQILEANSILENLWKLQEDIGQYIASKISIIAPNVCFLVGP 235
            MS++  +K    L    +  + +  SI+     +   +   IA++I  IAPN+C L+G 
Sbjct: 187 NMSLRADYKGNYKLTDTNKKSLHKLTSIIFEAHDIIRFVSVEIANRIGEIAPNLCALLGT 246

Query: 236 EIAAQLIAHAGGVLEFSRIPSCNIASIGKNKHLSHELHTLESGVRQEGYLFASDMIQKFP 295
             A+ L++H GG+L+ S+IPSCNIA+IGK     H +    +     GY+F ++++Q  P
Sbjct: 247 NTASLLVSHTGGLLQLSKIPSCNIANIGKKNTKDHNILNFSN---PGGYIFQNELVQNQP 303

Query: 296 VSVHKQMLRMLCAKVSLAARVDAGQKNGDRNTVLAHKWKAELSKKARKLSEAPSISETKA 355
           +  HKQM+RML +KVSLAARVDAG K GD+N  L  +W+ E+ +K +K+   P+IS+ KA
Sbjct: 304 IENHKQMMRMLSSKVSLAARVDAGLKTGDKNNKLGKQWRVEIEEKIKKIRAPPNISDVKA 363

Query: 356 LPIPEDQPKKKRAGRKFRKYKEKFRLSHVRQLQNRMEFGKQEQTVLDSYGEEVGLGMSNT 415
           LPIPED+PKKKRAGRKFRKYKE+F+LS  RQLQNRM FGKQE T+ D++G+EVGLGM++ 
Sbjct: 364 LPIPEDKPKKKRAGRKFRKYKEQFKLSGTRQLQNRMVFGKQEATIYDTFGDEVGLGMTSQ 423

Query: 416 SLQQAVGATSGS 427
                  +T+GS
Sbjct: 424 RKNGLAISTTGS 435

>ADR032W [1773] [Homologous to ScYGR091W (PRP31) - SH]
           complement(763163..764482) [1320 bp, 439 aa]
          Length = 439

 Score =  140 bits (352), Expect = 2e-36,   Method: Compositional matrix adjust.
 Identities = 82/264 (31%), Positives = 142/264 (53%), Gaps = 24/264 (9%)

Query: 74  LPKIVDLKRILQQQEIDFIKLLPFFNEIIPLIKSNIKLMHNFLISLYSRRFPELSSLIPS 133
           LP + +L   L   ++D   L     +++P+++     ++  L + Y   FPEL+ L+PS
Sbjct: 47  LPLLPELHEALAAGQLDLGTL----GQLLPVLRDEAADVYRQLEARYRPVFPELAELVPS 102

Query: 134 PLQYSKVISILENENYSKNESDELFFHLENKAKLTREQILVLTMSMKTSFKNKEPLDIKT 193
              Y +V+  LE    +    DEL         LTREQ +++ M+   + +       + 
Sbjct: 103 QRTYVRVLRALE----TGAPLDEL---------LTREQAMLVAMTRPQAPRADP---ARW 146

Query: 194 RTQILEANSILENLWKLQEDIGQYIASKISIIAPNVCFLVGPEIAAQLIAHAGGVLEFSR 253
             ++       E L    + I  +I  +   +AP V  LVGP +AA L++HAG V E ++
Sbjct: 147 PRELAPHADRHEQLHTAVDAIDAHIVRQAHRLAPTVTALVGPVVAAALLSHAGSVRELAQ 206

Query: 254 IPSCNIASIGKNKHLSHELHTLESGVRQEGYLFASDMIQKFPVSVHKQMLRMLCAKVSLA 313
           +P+CN+A+IG  +H +H   T  SGVR  G+++ + ++Q+ P ++ +Q LRMLCA+++LA
Sbjct: 207 VPACNLAAIGAPRHAAHARRTDASGVRLRGHVWDTPLVQEQPPALQRQALRMLCARLALA 266

Query: 314 ARVDAGQKNGDRNTVLAHKWKAEL 337
           ARVDA       +  LA +W+A++
Sbjct: 267 ARVDASAP----DPALAARWRADI 286

>AFR328C [3520] [Homologous to ScYOR310C (NOP58) - SH]
           (1032031..1033572) [1542 bp, 513 aa]
          Length = 513

 Score = 70.9 bits (172), Expect = 6e-13,   Method: Compositional matrix adjust.
 Identities = 61/250 (24%), Positives = 121/250 (48%), Gaps = 23/250 (9%)

Query: 120 YSRRFPELSSLIPSPLQYSKVISILE-NENYSKNESDELF-FHLENKAKLTREQILVLTM 177
           Y   FPEL+ ++   + ++++I  +    N ++ +  E+    +E + K   E      +
Sbjct: 188 YGWHFPELAKIVTDSVAFARIILTMGVRSNAAETDMSEILPEEIEERVKSAAE------V 241

Query: 178 SMKTSFKNKEPLDIKTRT-QILEANSILENLWKLQEDIGQYIASKISIIAPNVCFLVGPE 236
           SM T     +  +IK+   QI+E           +E +  Y++S++  IAPN+  LVG  
Sbjct: 242 SMGTEITQVDLDNIKSLAEQIVE-------FAAYREQLSNYLSSRMKAIAPNLTQLVGEL 294

Query: 237 IAAQLIAHAGGVLEFSRIPSCNIASIGKNKHLSHELHTLESGVRQEGYLFASDMIQKFPV 296
           + A+LIAHAG ++  ++ P+  I  +G  K L   L T +    + G L+ + ++ +   
Sbjct: 295 VGARLIAHAGSLVSLAKAPASTIQILGAEKALFRALKT-KHDTPKYGLLYHASLVGQATG 353

Query: 297 SVHKQMLRMLCAKVSLAARVDAGQKNGDRNTVLAHKWKAELSKK-----ARKLSEAPSIS 351
               ++ R+L AK +++ R DA  ++ D +  +  + +A++  +      R L   P +S
Sbjct: 354 KNKGKIARVLAAKAAVSLRYDALAEDRDDSGDIGLEARAKVESRLSQLEGRDLRTTPKVS 413

Query: 352 -ETKALPIPE 360
            + K + I E
Sbjct: 414 RDAKKIEISE 423

>KLLA0F08613g complement(801623..803158) similar to sp|Q12499
           Saccharomyces cerevisiae YOR310c NOP58 required for
           pre-18S rRNA processing, start by similarity
          Length = 511

 Score = 68.9 bits (167), Expect = 3e-12,   Method: Compositional matrix adjust.
 Identities = 53/208 (25%), Positives = 103/208 (49%), Gaps = 17/208 (8%)

Query: 120 YSRRFPELSSLIPSPLQYSKVISILE-NENYSKNESDELF-FHLENKAKLTREQILVLTM 177
           Y   FPEL+ ++   + Y+++I  +    N ++ +  E+    +E + K   E      +
Sbjct: 188 YGWHFPELAKIVTDSVAYARIILTMGIRVNAAETDMSEILPEEIEERVKTAAE------V 241

Query: 178 SMKTSFKNKEPLDIKTRT-QILEANSILENLWKLQEDIGQYIASKISIIAPNVCFLVGPE 236
           SM T     + ++IK    QI+E           +E +  Y++S++  IAPN+  LVG  
Sbjct: 242 SMGTEITPVDLINIKCLAEQIVE-------FAAYREQLSNYLSSRMKAIAPNLTQLVGEL 294

Query: 237 IAAQLIAHAGGVLEFSRIPSCNIASIGKNKHLSHELHTLESGVRQEGYLFASDMIQKFPV 296
           + A+LIAH+G ++  ++ P+  I  +G  K L   L T +    + G L+ + ++ +   
Sbjct: 295 VGARLIAHSGSLISLAKSPASTIQILGAEKALFRALKT-KHDTPKYGLLYHASLVGQASG 353

Query: 297 SVHKQMLRMLCAKVSLAARVDAGQKNGD 324
               ++ R+L AK +++ R DA  ++ D
Sbjct: 354 KNKGKIARVLAAKAAVSLRYDALAEDRD 381

>Kwal_34.15894
          Length = 512

 Score = 68.9 bits (167), Expect = 3e-12,   Method: Compositional matrix adjust.
 Identities = 53/208 (25%), Positives = 104/208 (50%), Gaps = 17/208 (8%)

Query: 120 YSRRFPELSSLIPSPLQYSKVISILE-NENYSKNESDELF-FHLENKAKLTREQILVLTM 177
           Y   FPEL+ ++   + ++++I  +    N ++ +  E+    +E + K   E      +
Sbjct: 188 YGWHFPELAKIVTDSVAFARIILTMGVRSNAAETDLSEILPEEIEERVKSAAE------I 241

Query: 178 SMKTSFKNKEPLDIKT-RTQILEANSILENLWKLQEDIGQYIASKISIIAPNVCFLVGPE 236
           SM T   + +  +IK+  TQI E           +E +  Y+++++  IAPN+  LVG  
Sbjct: 242 SMGTEITSVDLDNIKSLATQITE-------FAAYREQLSNYLSARMKAIAPNLTQLVGEL 294

Query: 237 IAAQLIAHAGGVLEFSRIPSCNIASIGKNKHLSHELHTLESGVRQEGYLFASDMIQKFPV 296
           + A+LIAHAG ++  ++ P+  I  +G  K L   L T +    + G L+ + ++ +   
Sbjct: 295 VGARLIAHAGSLISLAKSPASTIQILGAEKALFRALKT-KHDTPKYGLLYHASLVGQATG 353

Query: 297 SVHKQMLRMLCAKVSLAARVDAGQKNGD 324
               ++ R+L AK +++ R DA  ++ D
Sbjct: 354 KNKGKIARVLAAKAAVSLRYDALAEDRD 381

>Kwal_56.24654
          Length = 507

 Score = 68.2 bits (165), Expect = 5e-12,   Method: Compositional matrix adjust.
 Identities = 50/199 (25%), Positives = 95/199 (47%), Gaps = 8/199 (4%)

Query: 120 YSRRFPELSSLIPSPLQYSK-VISILENENYSKNESDELFFHLENKAKLTREQILVLTMS 178
           Y   FPEL+ L+P   ++++ V+ I +  + S++   +L   L+N A +    I    +S
Sbjct: 198 YGWHFPELAKLVPDNYKFAQLVLFIKDKASLSEDSLHDLSAILDNDAGIAERVIDNARIS 257

Query: 179 MKTSFKNKEPLDIKTRTQILEANSILENLWKLQEDIGQYIASKISIIAPNVCFLVGPEIA 238
           M       +  ++    + + +      L   +  + +Y+ SK+  +APN+  L+G  I 
Sbjct: 258 MGQDLSETDMDNVCVFAERVTS------LADYRRQLYEYLCSKMHTVAPNLSELIGEVIG 311

Query: 239 AQLIAHAGGVLEFSRIPSCNIASIGKNKHLSHELHTLESGVRQEGYLFASDMIQKFPVSV 298
           A+LI+HAG +   S+  +  +  +G  K L   L T +    + G ++ S  I K     
Sbjct: 312 ARLISHAGSLTNLSKQAASTVQILGAEKALFRALKT-KGNTPKYGLIYHSGFIGKAAAKN 370

Query: 299 HKQMLRMLCAKVSLAARVD 317
             ++ R L  K S+A+R+D
Sbjct: 371 KGRISRYLANKCSIASRID 389

>ACL144C [905] [Homologous to ScYLR197W (SIK1) - SH] (94809..96458)
           [1650 bp, 549 aa]
          Length = 549

 Score = 67.8 bits (164), Expect = 6e-12,   Method: Compositional matrix adjust.
 Identities = 51/199 (25%), Positives = 95/199 (47%), Gaps = 8/199 (4%)

Query: 120 YSRRFPELSSLIPSPLQYSKVISILENENYSKNES-DELFFHLENKAKLTREQILVLTMS 178
           Y   FPEL+ L+P   +++K++  + ++    +ES  +L   L   A +    I    +S
Sbjct: 198 YGWHFPELAKLVPDNYKFAKLVLFIRDKASLNDESLHDLSAILGEDAGIAERVISNARIS 257

Query: 179 MKTSFKNKEPLDIKTRTQILEANSILENLWKLQEDIGQYIASKISIIAPNVCFLVGPEIA 238
           M         +D++  +   E    + NL + +  + +Y+  K+  +APN+  L+G  I 
Sbjct: 258 MGQDLSE---VDMENVSVFAER---VVNLVEYRRQLYEYLCEKMHTVAPNLSELIGEVIG 311

Query: 239 AQLIAHAGGVLEFSRIPSCNIASIGKNKHLSHELHTLESGVRQEGYLFASDMIQKFPVSV 298
           A+LI+HAG +   S+  +  +  +G  K L   L T +    + G ++ S  I K     
Sbjct: 312 ARLISHAGSLTNLSKQAASTVQILGAEKALFRALKT-KGNTPKYGLIYHSGFISKASAKN 370

Query: 299 HKQMLRMLCAKVSLAARVD 317
             ++ R L  K S+A+R+D
Sbjct: 371 KGRISRYLANKCSMASRID 389

>Scas_665.12
          Length = 515

 Score = 67.0 bits (162), Expect = 1e-11,   Method: Compositional matrix adjust.
 Identities = 52/207 (25%), Positives = 103/207 (49%), Gaps = 15/207 (7%)

Query: 120 YSRRFPELSSLIPSPLQYSKVISIL--ENENYSKNESDELFFHLENKAKLTREQILVLTM 177
           Y   FPEL+ ++   + Y+++I  +   ++    + S+ L   +E + K   E      +
Sbjct: 188 YGWHFPELAKIVTDSVAYARIILTMGIRSKAADTDMSEILPEEIEERVKTAAE------V 241

Query: 178 SMKTSFKNKEPLDIKTRTQILEANSILENLWKLQEDIGQYIASKISIIAPNVCFLVGPEI 237
           SM T     +  +IK       A+ I+E     +E +  Y+++++  IAPN+  LVG  +
Sbjct: 242 SMGTEITQLDLENIKCL-----ADQIVE-FAAYREQLSNYLSARMKAIAPNLTQLVGELV 295

Query: 238 AAQLIAHAGGVLEFSRIPSCNIASIGKNKHLSHELHTLESGVRQEGYLFASDMIQKFPVS 297
            A+LIAH+G ++  ++ P+  I  +G  K L   L T +    + G L+ + ++ +    
Sbjct: 296 GARLIAHSGSLISLAKSPASTIQILGAEKALFRALKT-KHDTPKYGLLYHASLVGQATGK 354

Query: 298 VHKQMLRMLCAKVSLAARVDAGQKNGD 324
              ++ R+L AK +++ R DA  ++ D
Sbjct: 355 NKGKIARVLAAKAAVSIRYDALAEDRD 381

>YOR310C (NOP58) [5094] chr15 complement(896820..898355) Nucleolar
           protein component of box C/D snoRNPs, which are
           necessary for 2'-O-methylation of ribosomal RNAs,
           component of U3 snoRNP (also called small subunit
           processome), which is required for 18S rRNA biogenesis
           [1536 bp, 511 aa]
          Length = 511

 Score = 67.0 bits (162), Expect = 1e-11,   Method: Compositional matrix adjust.
 Identities = 51/210 (24%), Positives = 104/210 (49%), Gaps = 21/210 (10%)

Query: 120 YSRRFPELSSLIPSPLQYSKVISIL--ENENYSKNESDELFFHLENKAKLTREQILVLTM 177
           Y   FPEL+ ++   + Y+++I  +   ++    + S+ L   +E + K   E      +
Sbjct: 188 YGWHFPELAKIVTDSVAYARIILTMGIRSKASETDLSEILPEEIEERVKTAAE------V 241

Query: 178 SMKTSFKNKEPLDIKTRTQILEANSILENLWKL---QEDIGQYIASKISIIAPNVCFLVG 234
           SM T           T+T +   N++ E + +    +E +  Y+++++  IAPN+  LVG
Sbjct: 242 SMGTEI---------TQTDLDNINALAEQIVEFAAYREQLSNYLSARMKAIAPNLTQLVG 292

Query: 235 PEIAAQLIAHAGGVLEFSRIPSCNIASIGKNKHLSHELHTLESGVRQEGYLFASDMIQKF 294
             + A+LIAH+G ++  ++ P+  I  +G  K L   L T +    + G L+ + ++ + 
Sbjct: 293 ELVGARLIAHSGSLISLAKSPASTIQILGAEKALFRALKT-KHDTPKYGLLYHASLVGQA 351

Query: 295 PVSVHKQMLRMLCAKVSLAARVDAGQKNGD 324
                 ++ R+L AK +++ R DA  ++ D
Sbjct: 352 TGKNKGKIARVLAAKAAVSLRYDALAEDRD 381

>KLLA0D12254g 1045077..1046618 highly similar to sp|Q12460
           Saccharomyces cerevisiae YLR197w SIK1 involved in
           pre-rRNA processing, start by similarity
          Length = 513

 Score = 66.6 bits (161), Expect = 2e-11,   Method: Compositional matrix adjust.
 Identities = 50/201 (24%), Positives = 98/201 (48%), Gaps = 12/201 (5%)

Query: 120 YSRRFPELSSLIPSPLQYSKVISILENENYSKNES-DELFFHLENKAKLTREQI--LVLT 176
           Y   FPEL+ L+P   +++K++  ++++     ES  +L   L+N A ++   I    ++
Sbjct: 198 YGWHFPELAKLVPDNYKFAKLVLFIKDKASLNEESLHDLSEILDNDAGISERVIDNARIS 257

Query: 177 MSMKTSFKNKEPLDIKTRTQILEANSILENLWKLQEDIGQYIASKISIIAPNVCFLVGPE 236
           M    S  + E + I  +  +        +L + ++ +  Y+  K+  +APN+  L+G  
Sbjct: 258 MGQDLSETDMENVTIFAKRVV--------SLVEYRKQLYDYLCEKMHTVAPNLSELIGEV 309

Query: 237 IAAQLIAHAGGVLEFSRIPSCNIASIGKNKHLSHELHTLESGVRQEGYLFASDMIQKFPV 296
           I A+LI+H+G +   S+  +  +  +G  K L   L T +    + G ++ S  I K   
Sbjct: 310 IGARLISHSGSLTNLSKQAASTVQILGAEKALFRALKT-KGNTPKYGLIYHSGFIAKASA 368

Query: 297 SVHKQMLRMLCAKVSLAARVD 317
               ++ R L  K S+A+R+D
Sbjct: 369 KNKGRISRYLANKCSMASRID 389

>Scas_537.7
          Length = 510

 Score = 65.5 bits (158), Expect = 3e-11,   Method: Compositional matrix adjust.
 Identities = 48/199 (24%), Positives = 95/199 (47%), Gaps = 8/199 (4%)

Query: 120 YSRRFPELSSLIPSPLQYSKVISILENENYSKNES-DELFFHLENKAKLTREQILVLTMS 178
           Y   FPEL+ L+P   ++++++  ++++    +ES  +L   L + A +    I    +S
Sbjct: 198 YGWHFPELAKLVPDNYKFAQLVLFIKDKASLNDESLHDLAAILNDDAGIAERVIDNARIS 257

Query: 179 MKTSFKNKEPLDIKTRTQILEANSILENLWKLQEDIGQYIASKISIIAPNVCFLVGPEIA 238
           M       +  ++    Q + +      L + ++ +  Y+  K+  +APN+  L+G  I 
Sbjct: 258 MGQDISETDMENVGVFAQRVVS------LVEYRKQLYDYLCEKMHTVAPNLSELIGEVIG 311

Query: 239 AQLIAHAGGVLEFSRIPSCNIASIGKNKHLSHELHTLESGVRQEGYLFASDMIQKFPVSV 298
           A+LI+HAG +   S+  +  +  +G  K L   L T +    + G ++ S  I K     
Sbjct: 312 ARLISHAGSLTNLSKQAASTVQILGAEKALFRALKT-KGNTPKYGLIYHSGFIAKASAKN 370

Query: 299 HKQMLRMLCAKVSLAARVD 317
             ++ R L  K S+A+R+D
Sbjct: 371 KGRISRYLANKCSMASRID 389

>CAGL0A04015g complement(397378..398904) similar to sp|Q12460
           Saccharomyces cerevisiae YLR197w SIK1 involved in
           pre-rRNA processing, hypothetical start
          Length = 508

 Score = 63.9 bits (154), Expect = 1e-10,   Method: Compositional matrix adjust.
 Identities = 48/201 (23%), Positives = 94/201 (46%), Gaps = 12/201 (5%)

Query: 120 YSRRFPELSSLIPSPLQYSKVISILENENYSKNESDELFFHLENKAKLTREQIL---VLT 176
           Y   FPEL+ L+P    ++K++  ++++     ES      + N+     E+I+    ++
Sbjct: 197 YGWHFPELAKLVPDNYTFAKLVLFIKDKASLNEESLHDLAAVVNEDAGIAERIIDNARIS 256

Query: 177 MSMKTSFKNKEPLDIKTRTQILEANSILENLWKLQEDIGQYIASKISIIAPNVCFLVGPE 236
           M    S  + E + +  +  +        +L   ++ +  Y+  K+  +APN+  L+G  
Sbjct: 257 MGQDLSETDMENVCVFAQRVV--------SLVDYRKQLYDYLCEKMHTVAPNLSGLIGEV 308

Query: 237 IAAQLIAHAGGVLEFSRIPSCNIASIGKNKHLSHELHTLESGVRQEGYLFASDMIQKFPV 296
           I A+LI+HAG +   S+  +  +  +G  K L   L T +    + G ++ S  I K   
Sbjct: 309 IGARLISHAGSLTSLSKQAASTVQILGAEKALFRALKT-KGNTPKYGLIYHSGFIAKASA 367

Query: 297 SVHKQMLRMLCAKVSLAARVD 317
               ++ R L  K S+A+R+D
Sbjct: 368 KNKGRISRYLANKCSMASRID 388

>YLR197W (SIK1) [3600] chr12 (546099..547613) Nucleolar protein
           component of box C/D snoRNPs, which are necessary for
           2'-O-methylation of ribosomal RNAs, component of U3
           snoRNP (also called small subunit processome), which is
           required for 18S rRNA biogenesis [1515 bp, 504 aa]
          Length = 504

 Score = 63.5 bits (153), Expect = 2e-10,   Method: Compositional matrix adjust.
 Identities = 47/199 (23%), Positives = 92/199 (46%), Gaps = 8/199 (4%)

Query: 120 YSRRFPELSSLIPSPLQYSKVISILENENYSKNES-DELFFHLENKAKLTREQILVLTMS 178
           Y   FPEL+ L+P    ++K++  ++++    ++S  +L   L   + + +  I    +S
Sbjct: 199 YGWHFPELAKLVPDNYTFAKLVLFIKDKASLNDDSLHDLAALLNEDSGIAQRVIDNARIS 258

Query: 179 MKTSFKNKEPLDIKTRTQILEANSILENLWKLQEDIGQYIASKISIIAPNVCFLVGPEIA 238
           M       +  ++    Q + +      L   +  +  Y+  K+  +APN+  L+G  I 
Sbjct: 259 MGQDISETDMENVCVFAQRVAS------LADYRRQLYDYLCEKMHTVAPNLSELIGEVIG 312

Query: 239 AQLIAHAGGVLEFSRIPSCNIASIGKNKHLSHELHTLESGVRQEGYLFASDMIQKFPVSV 298
           A+LI+HAG +   S+  +  +  +G  K L   L T +    + G ++ S  I K     
Sbjct: 313 ARLISHAGSLTNLSKQAASTVQILGAEKALFRALKT-KGNTPKYGLIYHSGFISKASAKN 371

Query: 299 HKQMLRMLCAKVSLAARVD 317
             ++ R L  K S+A+R+D
Sbjct: 372 KGRISRYLANKCSMASRID 390

>Sklu_1985.1 YLR197W, Contig c1985 148-1644 reverse complement
          Length = 498

 Score = 62.4 bits (150), Expect = 4e-10,   Method: Compositional matrix adjust.
 Identities = 48/199 (24%), Positives = 94/199 (47%), Gaps = 8/199 (4%)

Query: 120 YSRRFPELSSLIPSPLQYSKVISILENENYSKNES-DELFFHLENKAKLTREQILVLTMS 178
           Y   FPEL+ L+P   ++++++  ++++     ES  +L   L + A +    I    +S
Sbjct: 198 YGWHFPELAKLVPDNYKFAQLVLFIKDKASLDEESLHDLASILNDDAGIAERVIDNARIS 257

Query: 179 MKTSFKNKEPLDIKTRTQILEANSILENLWKLQEDIGQYIASKISIIAPNVCFLVGPEIA 238
           M       +  ++      + A  ++ +L   +  +  Y+  K+  +APN+  L+G  I 
Sbjct: 258 MGQDLSETDMENV-----CIFAERVV-SLADYRRQLYDYLCEKMHTVAPNLSELIGEVIG 311

Query: 239 AQLIAHAGGVLEFSRIPSCNIASIGKNKHLSHELHTLESGVRQEGYLFASDMIQKFPVSV 298
           A+LI+HAG +   S+  +  +  +G  K L   L T +    + G ++ S  I K     
Sbjct: 312 ARLISHAGSLTNLSKQAASTVQILGAEKALFRALKT-KGNTPKYGLIYHSGFIAKASAKN 370

Query: 299 HKQMLRMLCAKVSLAARVD 317
             ++ R L  K S+A+R+D
Sbjct: 371 KGRISRYLANKCSMASRID 389

>CAGL0I09790g complement(934746..936287) highly similar to sp|Q12499
           Saccharomyces cerevisiae YOR310c, start by similarity
          Length = 513

 Score = 62.0 bits (149), Expect = 4e-10,   Method: Compositional matrix adjust.
 Identities = 43/157 (27%), Positives = 80/157 (50%), Gaps = 14/157 (8%)

Query: 120 YSRRFPELSSLIPSPLQYSKVISIL--ENENYSKNESDELFFHLENKAKLTREQILVLTM 177
           Y   FPEL+ ++   + Y+++I  +   ++    + S+ L   +E + K   E      +
Sbjct: 188 YGWHFPELAKIVTDSVAYARLILTMGVRSKAAETDMSEILPEEIEERVKAAAE------V 241

Query: 178 SMKTSFKNKEPLDIKTRTQILEANSILENLWKLQEDIGQYIASKISIIAPNVCFLVGPEI 237
           SM T   + + ++I+       A+ I+E     +E +  Y++S++  IAPN+  LVG  +
Sbjct: 242 SMGTEITDVDLINIRAL-----ADQIVE-FAAYREQLSNYLSSRMKAIAPNLTQLVGELV 295

Query: 238 AAQLIAHAGGVLEFSRIPSCNIASIGKNKHLSHELHT 274
            A+LIAHAG ++  ++ P+  I  +G  K L   L T
Sbjct: 296 GARLIAHAGSLISLAKSPASTIQILGAEKALFRALKT 332

>CAGL0M13409g complement(1316268..1320851) similar to sp|P38873
           Saccharomyces cerevisiae YHR186c, start by similarity
          Length = 1527

 Score = 35.4 bits (80), Expect = 0.12,   Method: Compositional matrix adjust.
 Identities = 16/47 (34%), Positives = 28/47 (59%)

Query: 78  VDLKRILQQQEIDFIKLLPFFNEIIPLIKSNIKLMHNFLISLYSRRF 124
           VDLK+I QQ+ ++ I  LP  N+  PL++  + +M + ++  Y   F
Sbjct: 859 VDLKKIKQQEIVNLIACLPLRNDGSPLVRKELAIMFSQIVYRYCNFF 905

>KLLA0C09801g complement(846302..848068) similar to sp|Q99257
           Saccharomyces cerevisiae YPL169c MEX67 factor for
           nuclear mRNA export singleton, start by similarity
          Length = 588

 Score = 32.3 bits (72), Expect = 0.98,   Method: Compositional matrix adjust.
 Identities = 29/99 (29%), Positives = 45/99 (45%), Gaps = 11/99 (11%)

Query: 29  KKLTTVNCQTEKFNPFEILPESIELFRTLAL----ISPDRLSLSETAQILPKIVDLKRIL 84
           K L   N    +F+  E+     +  R L +    I+ DRL  +E  +I PK+V L  ++
Sbjct: 193 KNLCIANNSISRFHSLEVWKNKFKELRELLMMNNPITSDRLYRTEMLRIFPKLVILDNVV 252

Query: 85  --QQQEIDFIKLLP-----FFNEIIPLIKSNIKLMHNFL 116
              +Q++  I  LP     FF E   L  S+   + NFL
Sbjct: 253 VRDEQKLLSIYSLPVQQTQFFFEDNGLASSSTDFITNFL 291

>CAGL0G05335g 501279..503951 highly similar to sp|P31688
           Saccharomyces cerevisiae YDR074w TPS2 alpha,
           alpha-trehalose-phosphate synthase, hypothetical start
          Length = 890

 Score = 31.6 bits (70), Expect = 1.8,   Method: Compositional matrix adjust.
 Identities = 21/91 (23%), Positives = 43/91 (47%), Gaps = 12/91 (13%)

Query: 148 NYSKNESDELFFHLENKAKLTREQILVLTMSMKTSFKNKEPLDIKTRTQILEANSILENL 207
           N++K + D+     E+   LT+EQI  LT +++   K            + ++NS +  +
Sbjct: 76  NFTKEDKDKHDASEEDPMYLTKEQISGLTSTLQDQMK------------VEDSNSTVHPV 123

Query: 208 WKLQEDIGQYIASKISIIAPNVCFLVGPEIA 238
           W L+ D  ++ +    +I P   +++ P  A
Sbjct: 124 WLLRRDQSRWRSYAEKVIWPTFHYILNPSSA 154

>YPL169C (MEX67) [5278] chr16 complement(229038..230837) Protein
           involved in the export of mRNA from the nucleus to the
           cytoplasm [1800 bp, 599 aa]
          Length = 599

 Score = 31.6 bits (70), Expect = 1.9,   Method: Compositional matrix adjust.
 Identities = 32/121 (26%), Positives = 55/121 (45%), Gaps = 12/121 (9%)

Query: 29  KKLTTVNCQTEKFNPFEILPESIELFRTLAL----ISPDRLSLSETAQILPKIVDLKRIL 84
           K L   N Q  +F   E+     +  R L +    I+ D+L  +E  ++ PK+V L  ++
Sbjct: 191 KNLCLANNQIFRFRSLEVWKNKFKDLRELLMTNNPITTDKLYRTEMLRLFPKLVVLDNVI 250

Query: 85  --QQQEIDFIKLLP-----FFNEIIPLIKSNIKLMHNFLISLYSRRFPELSSLIPSPLQY 137
              +Q++  +  LP     FF E   L +S+     NFL +L+     +L +L     Q+
Sbjct: 251 VRDEQKLQTVYSLPMKIQQFFFENDALGQSSTDFATNFL-NLWDNNREQLLNLYSPQSQF 309

Query: 138 S 138
           S
Sbjct: 310 S 310

>YEL016C (YEL016C) [1410] chr5 complement(124737..126218) Protein
           with similarity to Ycr026p [1482 bp, 493 aa]
          Length = 493

 Score = 31.2 bits (69), Expect = 2.0,   Method: Compositional matrix adjust.
 Identities = 22/93 (23%), Positives = 38/93 (40%), Gaps = 9/93 (9%)

Query: 374 KYKEKFRLSHVRQLQNRMEFGKQEQTVLDSYGEEVGLGMSNTSLQQAVGATSG------- 426
           K  + FR   + QL++R E        +DSYG   G  + +  LQ+ +G   G       
Sbjct: 229 KLAQIFRYIDMPQLKDRPELVISYIPNVDSYGHSFGYDLRDKRLQKLIGEVDGFFLDLIE 288

Query: 427 --SRRSAGNQAKLTKVMKHRISEANQQADEFLI 457
              +R+    + +  V  H +S  N    E ++
Sbjct: 289 GLQKRNLLKISNVMIVSDHGMSNVNANDGEHVV 321

>Kwal_14.2554
          Length = 592

 Score = 30.0 bits (66), Expect = 5.4,   Method: Compositional matrix adjust.
 Identities = 19/59 (32%), Positives = 33/59 (55%), Gaps = 7/59 (11%)

Query: 376 KEKFRLSHVRQLQ--NRMEFGKQEQTVLDSY-----GEEVGLGMSNTSLQQAVGATSGS 427
           KE   +S +RQ++  ++   GK++  ++ SY     G E+G G    S++QA G  +GS
Sbjct: 33  KESGEISLLRQIRGPHKDTGGKRDARLISSYFCPQCGSEIGTGFDLASVEQAPGQGTGS 91

>CAGL0J03960g complement(373177..374484) similar to sp|Q12206
           Saccharomyces cerevisiae YOR229w WTM2 or sp|Q12363
           Saccharomyces cerevisiae YOR230w WTM1, hypothetical
           start
          Length = 435

 Score = 29.3 bits (64), Expect = 7.2,   Method: Compositional matrix adjust.
 Identities = 28/103 (27%), Positives = 47/103 (45%), Gaps = 19/103 (18%)

Query: 242 IAHAGGV----LEFSRIPSCNIASIGKNKHLSHELHTLESGVRQEGYLFA--SDMIQKFP 295
           + H+GG     ++FS   S    ++G + ++ H    +E       YLF+   D  + + 
Sbjct: 322 VFHSGGDSVVDIKFSETSSSEFVTVGGSGNIYH--WDME-------YLFSRNDDDNEDYL 372

Query: 296 VSVHKQMLRMLCAKVSLAARVDAGQKNGDRNTVLAHKWKAELS 338
            S+  + L+  C K    +RV    K+G RNTV  H    +LS
Sbjct: 373 PSLEPEELQSHCLKFCQPSRV----KSGSRNTVALHPMVHDLS 411

>YHR186C (KOG1) [2471] chr8 complement(475997..480670) Component of
           the TOR complex 1 (Tor1p or Tor2p-Kog1p-Lst8p), which is
           required for wild-type growth, maintenance of cell and
           vacuole size and morphology, protein synthesis,
           maintenance of glycogen homeostasis [4674 bp, 1557 aa]
          Length = 1557

 Score = 29.3 bits (64), Expect = 8.6,   Method: Compositional matrix adjust.
 Identities = 12/49 (24%), Positives = 30/49 (61%)

Query: 76  KIVDLKRILQQQEIDFIKLLPFFNEIIPLIKSNIKLMHNFLISLYSRRF 124
           +++DL+++ +Q+  + I +LP  N+   L++  + +  + ++S YS  F
Sbjct: 879 EVIDLRKLKRQEIGNLISILPLINDGSSLVRKELVVYFSHIVSRYSNFF 927

  Database: blastdb
    Posted date:  Apr 3, 2006  3:33 PM
  Number of letters in database: 16,596,109
  Number of sequences in database:  34,618
  
Lambda     K      H
   0.315    0.131    0.358 

Gapped
Lambda     K      H
   0.267   0.0410    0.140 

Matrix: BLOSUM62
Gap Penalties: Existence: 11, Extension: 1
Number of Sequences: 34618
Number of Hits to DB: 14,761,298
Number of extensions: 628115
Number of successful extensions: 2763
Number of sequences better than 10.0: 63
Number of HSP's gapped: 2805
Number of HSP's successfully gapped: 63
Length of query: 486
Length of database: 16,596,109
Length adjustment: 106
Effective length of query: 380
Effective length of database: 12,926,601
Effective search space: 4912108380
Effective search space used: 4912108380
Neighboring words threshold: 11
Window for multiple hits: 40
X1: 16 ( 7.3 bits)
X2: 38 (14.6 bits)
X3: 64 (24.7 bits)
S1: 41 (21.6 bits)
S2: 63 (28.9 bits)