Hit NameLength (aa)HSP LengthHSP ScoreHSP Significance
YGL233W (SEC15)91089546340.0
Scas_712.1888289327250.0
CAGL0H07909g88288726130.0
Sklu_2433.1188488923780.0
AFR251C86890222070.0
Kwal_47.1921487690320820.0
KLLA0A01023g86189120760.0
AFR691W26776702.4
Sklu_1929.2115497686.1
BLASTP 2.2.26 [Sep-21-2011]

Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, 
Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), 
"Gapped BLAST and PSI-BLAST: a new generation of protein database search
programs",  Nucleic Acids Res. 25:3389-3402.

Reference for compositional score matrix adjustment: Altschul, Stephen F., 
John C. Wootton, E. Michael Gertz, Richa Agarwala, Aleksandr Morgulis,
Alejandro A. Schaffer, and Yi-Kuo Yu (2005) "Protein database searches
using compositionally adjusted substitution matrices", FEBS J. 272:5101-5109.

Query= YGL233W
         (895 letters)

Database: blastdb 
           34,618 sequences; 16,596,109 total letters

Searching..................................................done

                                                                 Score    E
Sequences producing significant alignments:                      (bits) Value

YGL233W (SEC15) [1765] chr7 (59121..61853) Component of exocyst ...  1789   0.0  
Scas_712.18                                                          1054   0.0  
CAGL0H07909g 772741..775389 similar to sp|P22224 Saccharomyces c...  1011   0.0  
Sklu_2433.11 YGL233W, Contig c2433 17844-20498                        920   0.0  
AFR251C [3443] [Homologous to ScYGL233W (SEC15) - SH] (888186..8...   854   0.0  
Kwal_47.19214                                                         806   0.0  
KLLA0A01023g 96383..98968 similar to sp|P22224 Saccharomyces cer...   804   0.0  
AFR691W [3884] [Homologous to ScYLR181C (VTA1) - SH] complement(...    32   2.4  
Sklu_1929.2 YJR041C, Contig c1929 1685-5149 reverse complement         31   6.1  

>YGL233W (SEC15) [1765] chr7 (59121..61853) Component of exocyst
           complex required for exocytosis [2733 bp, 910 aa]
          Length = 910

 Score = 1789 bits (4634), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 883/895 (98%), Positives = 883/895 (98%)

Query: 1   MDQEGQPLLSKDFQQVLLATASGNNSSWTERAVLNNESTDAVKHEPALGQNDVFDLDPLS 60
           MDQEGQPLLSKDFQQVLLATASGNNSSWTERAVLNNESTDAVKHEPALGQNDVFDLDPLS
Sbjct: 1   MDQEGQPLLSKDFQQVLLATASGNNSSWTERAVLNNESTDAVKHEPALGQNDVFDLDPLS 60

Query: 61  FDKWVPFLRRALDKNQLDPVIDELENSIEDNFQGLELQLLQDSQMNDKLETSIDEIANIQ 120
           FDKWVPFLRRALDKNQLDPVIDELENSIEDNFQGLELQLLQDSQMNDKLETSIDEIANIQ
Sbjct: 61  FDKWVPFLRRALDKNQLDPVIDELENSIEDNFQGLELQLLQDSQMNDKLETSIDEIANIQ 120

Query: 121 GMVQDTLSSEISKFQIRLSESANELIVKKQMYVNNKKISLKISEATILITKVVRILELSS 180
           GMVQDTLSSEISKFQIRLSESANELIVKKQMYVNNKKISLKISEATILITKVVRILELSS
Sbjct: 121 GMVQDTLSSEISKFQIRLSESANELIVKKQMYVNNKKISLKISEATILITKVVRILELSS 180

Query: 181 KCQELITERKFFKVLQNLDSLEKLYLQEFKNYNFQFLIEIYNSIPFLQKVTKDECXXXXX 240
           KCQELITERKFFKVLQNLDSLEKLYLQEFKNYNFQFLIEIYNSIPFLQKVTKDEC     
Sbjct: 181 KCQELITERKFFKVLQNLDSLEKLYLQEFKNYNFQFLIEIYNSIPFLQKVTKDECINLIR 240

Query: 241 XXXXXXXGKNLIKVGQEFVAIYENELLPQWLETRSKMKLTNFKFNSPIEISMRDESFLAK 300
                  GKNLIKVGQEFVAIYENELLPQWLETRSKMKLTNFKFNSPIEISMRDESFLAK
Sbjct: 241 NSLNLNLGKNLIKVGQEFVAIYENELLPQWLETRSKMKLTNFKFNSPIEISMRDESFLAK 300

Query: 301 LNLGEFFQLDDFHDSIMIFQNLNELSVLSGEFNKEYELRKTKLMYPLIWKKNKTAAYQMD 360
           LNLGEFFQLDDFHDSIMIFQNLNELSVLSGEFNKEYELRKTKLMYPLIWKKNKTAAYQMD
Sbjct: 301 LNLGEFFQLDDFHDSIMIFQNLNELSVLSGEFNKEYELRKTKLMYPLIWKKNKTAAYQMD 360

Query: 361 SLLRGTGTTPGSTAHDVSTDDPFTQSLSLHFLQDYFLKILGFLLYDINLNKATEFILVDN 420
           SLLRGTGTTPGSTAHDVSTDDPFTQSLSLHFLQDYFLKILGFLLYDINLNKATEFILVDN
Sbjct: 361 SLLRGTGTTPGSTAHDVSTDDPFTQSLSLHFLQDYFLKILGFLLYDINLNKATEFILVDN 420

Query: 421 NYNSTNEFWDGLMDRLSPYLSYFIDEKLKTEEDMIKLKDFLCIYVAILENFKLNIEPLYK 480
           NYNSTNEFWDGLMDRLSPYLSYFIDEKLKTEEDMIKLKDFLCIYVAILENFKLNIEPLYK
Sbjct: 421 NYNSTNEFWDGLMDRLSPYLSYFIDEKLKTEEDMIKLKDFLCIYVAILENFKLNIEPLYK 480

Query: 481 ILVSIFEKFCSVSLRAFDDEFQILLNDDDFMPLSINDKTLYEKVLKICWMKEGEHLSLPD 540
           ILVSIFEKFCSVSLRAFDDEFQILLNDDDFMPLSINDKTLYEKVLKICWMKEGEHLSLPD
Sbjct: 481 ILVSIFEKFCSVSLRAFDDEFQILLNDDDFMPLSINDKTLYEKVLKICWMKEGEHLSLPD 540

Query: 541 PTNGEPFAVTLPFSPLYPMTCTLAKKTYSKITAFLSIFYRHELHTLNNILVKTMDDIFND 600
           PTNGEPFAVTLPFSPLYPMTCTLAKKTYSKITAFLSIFYRHELHTLNNILVKTMDDIFND
Sbjct: 541 PTNGEPFAVTLPFSPLYPMTCTLAKKTYSKITAFLSIFYRHELHTLNNILVKTMDDIFND 600

Query: 601 IVNKKIRSKLESTSREEIAQILVNLDYFIIAAKEFSNFMTRENILQNPDMEIRLSSIKYL 660
           IVNKKIRSKLESTSREEIAQILVNLDYFIIAAKEFSNFMTRENILQNPDMEIRLSSIKYL
Sbjct: 601 IVNKKIRSKLESTSREEIAQILVNLDYFIIAAKEFSNFMTRENILQNPDMEIRLSSIKYL 660

Query: 661 AESRKLAETKLIELIDSKISDILETIEIDWQITEVRQDPDISIIDLAQFLEMMFASTLQN 720
           AESRKLAETKLIELIDSKISDILETIEIDWQITEVRQDPDISIIDLAQFLEMMFASTLQN
Sbjct: 661 AESRKLAETKLIELIDSKISDILETIEIDWQITEVRQDPDISIIDLAQFLEMMFASTLQN 720

Query: 721 LPYSVQTLLIFREFDSLTRQFMGLLLHDTPSTITHESIMNFEVDVNYLESIIPRIFPSTP 780
           LPYSVQTLLIFREFDSLTRQFMGLLLHDTPSTITHESIMNFEVDVNYLESIIPRIFPSTP
Sbjct: 721 LPYSVQTLLIFREFDSLTRQFMGLLLHDTPSTITHESIMNFEVDVNYLESIIPRIFPSTP 780

Query: 781 GTIDSNGYQSPMTPSTPTFPNANGVDAPTLFENNIKSLEATFMELKQCIELLKTQGKDYN 840
           GTIDSNGYQSPMTPSTPTFPNANGVDAPTLFENNIKSLEATFMELKQCIELLKTQGKDYN
Sbjct: 781 GTIDSNGYQSPMTPSTPTFPNANGVDAPTLFENNIKSLEATFMELKQCIELLKTQGKDYN 840

Query: 841 EPEIRLRKYSRIRQEDAALLLSKIQHFVSSVEGANGDDTSVMDSSSIFNSESASV 895
           EPEIRLRKYSRIRQEDAALLLSKIQHFVSSVEGANGDDTSVMDSSSIFNSESASV
Sbjct: 841 EPEIRLRKYSRIRQEDAALLLSKIQHFVSSVEGANGDDTSVMDSSSIFNSESASV 895

>Scas_712.18
          Length = 882

 Score = 1054 bits (2725), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 532/893 (59%), Positives = 681/893 (76%), Gaps = 28/893 (3%)

Query: 1   MDQEGQPLLSKDFQQVLLATASGNNSSWTERAVLNNESTDAVKHEPALGQNDVFDLDPLS 60
           MDQE   LLS+DFQ++LL+          E    +++  +A +++    + D F+LDP S
Sbjct: 1   MDQEV--LLSQDFQKILLSYEPKK----AETTTSHDKEENASEYKDLGMEEDAFELDPQS 54

Query: 61  FDKWVPFLRRALDKNQLDPVIDELENSIEDNFQGLELQLLQDSQMNDKLETSIDEIANIQ 120
           FDKWVPFLR A++KNQL  +I EL+ SI+DNFQGLELQLLQDSQ+NDKLETSI+EI+NIQ
Sbjct: 55  FDKWVPFLRSAVEKNQLGTIIQELDTSIDDNFQGLELQLLQDSQINDKLETSINEISNIQ 114

Query: 121 GMVQDTLSSEISKFQIRLSESANELIVKKQMYVNNKKISLKISEATILITKVVRILELSS 180
            M+  +LS  I   Q +L+++ NELI+KKQ++VNNKK SLKISE TIL+TKVVRILELSS
Sbjct: 115 NMIDTSLSGGILNLQEQLTQTTNELIIKKQVFVNNKKTSLKISELTILLTKVVRILELSS 174

Query: 181 KCQELITERKFFKVLQNLDSLEKLYLQEFKNYNFQFLIEIYNSIPFLQKVTKDECXXXXX 240
           KCQELITE  FFK LQNLDSLEK+YLQEF+NYNF+FL EIY+SIP+L+ VTKDEC     
Sbjct: 175 KCQELITEGNFFKALQNLDSLEKIYLQEFRNYNFKFLKEIYDSIPYLKSVTKDECLNLIR 234

Query: 241 XXXXXXXGKNLIKVGQEFVAIYENELLPQWLETRSKMKLTNFKFNSPIEISMRDESFLAK 300
                  GKNL  VG  F   Y+NELLP+WLE +  MKL  FKFNSP+EISMRD++ L K
Sbjct: 235 NSLNSNLGKNLTDVGMSFFDTYQNELLPKWLEIKKSMKLEKFKFNSPVEISMRDQASLKK 294

Query: 301 LNLGEFFQLDDFHDSIMIFQNLNELSVLSGEFNKEYELRKTKLMYPLIWKKNKTAAYQMD 360
           LNL +FF +++F+DSIMIFQ LN+L  L  EF+KEYE RKTKL+YPL+WK          
Sbjct: 295 LNLEKFFHIEEFYDSIMIFQTLNKLDYLFSEFSKEYEFRKTKLIYPLLWK---------- 344

Query: 361 SLLRGTGTTPGSTAHDVSTDDPFTQSLSLHFLQDYFLKILGFLLYDINLNKATEFILVDN 420
              R + +       D+S+ D FT+ ++L FL++YF KILGFLLYDINLNK+T+F+LVDN
Sbjct: 345 ---RASNSNANIPPGDISS-DAFTKQMNLKFLKEYFWKILGFLLYDINLNKSTDFVLVDN 400

Query: 421 NYNSTNEFWDGLMDRLSPYLSYFIDEKLKTEEDMIKLKDFLCIYVAILENFKLNIEPLYK 480
           NYN+TNEFWDGLM+RL PYL +FI   L  ++  ++ KDF+CIYVAILEN+KL+I+PLY+
Sbjct: 401 NYNATNEFWDGLMNRLQPYLRHFIVTGLNDDDSFVEFKDFMCIYVAILENYKLSIDPLYE 460

Query: 481 ILVSIFEKFCSVSLRAFDDEFQILLNDDDFMPLSINDKTLYEKVLKICWMKEGEHLSLPD 540
           IL+ +F+++C +S+R FD EF++LLNDDDFMPL+INDKTL++KV +ICWMKE EHL   +
Sbjct: 461 ILILLFDRYCDISIRYFDTEFEVLLNDDDFMPLTINDKTLFQKVSQICWMKEDEHLEPQE 520

Query: 541 PTNGEPFAVTLPFSPLYPMTCTLAKKTYSKITAFLSIFYRHELHTLNNILVKTMDDIFND 600
             +G  F++TLPFSPLYPMTCTL KK YSK+T+F+++FYRH+L  LN +LV  +D IF D
Sbjct: 521 DMSG--FSITLPFSPLYPMTCTLLKKAYSKLTSFITMFYRHDLPALNRLLVNAIDKIFID 578

Query: 601 IVNKKIRSKLESTSREEIAQILVNLDYFIIAAKEFSNFMTRENILQNPDMEIRLSSIKYL 660
           IVNKKIR+KL+STSREEIAQIL+NLDYFI+A K FS  MT  NI+QNPD+EI+L S K L
Sbjct: 579 IVNKKIRAKLQSTSREEIAQILINLDYFIVATKAFSKIMTEGNIMQNPDIEIQLKSTKDL 638

Query: 661 AESRKLAETKLIELIDSKISDILETIEIDWQITEVRQDPDISIIDLAQFLEMMFASTLQN 720
            +SRK AE KLI+LIDSK++DILET+++DW   E+ QDPDISI+D+AQFLEMMFA+TL N
Sbjct: 639 KDSRKYAEGKLIKLIDSKVADILETVDLDWNSKEIIQDPDISIVDVAQFLEMMFATTLIN 698

Query: 721 LPYSVQTLLIFREFDSLTRQFMGLLLHDTPSTITHESIMNFEVDVNYLESIIPRIFPSTP 780
           LPYS+Q LLIFREFDSLTR+F+ +LL+DTP  ITHES++NFEV++ YLE IIPRIFPS  
Sbjct: 699 LPYSIQILLIFREFDSLTRRFLDILLNDTPDHITHESVLNFEVNIKYLEGIIPRIFPSRD 758

Query: 781 GTIDSNGYQSPMTPSTPTFPNANGVDAPTLFENNIKSLEATFMELKQCIELLKTQGKDYN 840
               +   +  MTP +P F   N   +P L ENN+KSLE TF+EL+Q IELLKT G +Y 
Sbjct: 759 EEETNITSERMMTPLSPVFNGTNNGHSPELIENNVKSLEETFIELRQYIELLKT-GNEYM 817

Query: 841 EPEIRLRKYSRIRQEDAALLLSKIQ--HFVSSVEGANGDDTSVMDSSSIFNSE 891
           +P++R+RKYSR++ E A +L+ K++    +S  +     D    DSSSIF  +
Sbjct: 818 DPDLRMRKYSRVKPEHANILMRKVRVTPIMSPSDTPQQQDD---DSSSIFTRD 867

>CAGL0H07909g 772741..775389 similar to sp|P22224 Saccharomyces
           cerevisiae YGL233w SEC15, start by similarity
          Length = 882

 Score = 1011 bits (2613), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 520/887 (58%), Positives = 660/887 (74%), Gaps = 31/887 (3%)

Query: 1   MDQEGQPLLSKDFQQVLLATASGNNSSWTERAVLNNESTDAVKHEPALGQN---DVFDLD 57
           MDQE + ++SKDFQ VLL T++   SS     V + E+   V  E A G +      D+D
Sbjct: 1   MDQETKKVISKDFQDVLLDTSTVVVSS-----VFDQENK-IVGGENAKGVDIIDSTLDID 54

Query: 58  PLSFDKWVPFLRRALDKNQLDPVIDELENSIEDNFQGLELQLLQDSQMNDKLETSIDEIA 117
             + DKW+P+LR   + +QL+ VI ELENSI+DNFQGLELQLLQDSQ+NDKLETS+DEIA
Sbjct: 55  QRAIDKWIPYLREYTENDQLNTVITELENSIDDNFQGLELQLLQDSQLNDKLETSMDEIA 114

Query: 118 NIQGMVQDTLSSEISKFQIRLSESANELIVKKQMYVNNKKISLKISEATILITKVVRILE 177
            IQ MV+ +LS +I +FQ  L+ S NELI +KQ Y+N+KK SLKISEA ILI KV+R+LE
Sbjct: 115 EIQSMVELSLSRDIDEFQKNLTSSTNELIRQKQTYLNSKKTSLKISEAIILINKVLRLLE 174

Query: 178 LSSKCQELITERKFFKVLQNLDSLEKLYLQEFKNYNFQFLIEIYNSIPFLQKVTKDECXX 237
           LS+KCQELITE  FFK LQNLDSLEKLYLQEF++YNF+ L EIY SIP+L+ VTKDEC  
Sbjct: 175 LSNKCQELITEGNFFKALQNLDSLEKLYLQEFRDYNFKLLKEIYVSIPYLKSVTKDECIN 234

Query: 238 XXXXXXXXXXGKNLIKVGQEFVAIYENELLPQWLETRSKMKLTNFKFNSPIEISMRDESF 297
                     GKNL  VGQ F  IY++ELL +WL TR  MKL   KFNSPIEISMRDE  
Sbjct: 235 LIKNSLNSNLGKNLNVVGQTFYLIYKDELLSKWLNTREIMKLKRVKFNSPIEISMRDEEN 294

Query: 298 LAKLNLGEFFQLDDFHDSIMIFQNLNELSVLSGEFNKEYELRKTKLMYPLIWKKNKTAAY 357
           L KL L +FF LD FHDS+MIF+ LNE   L  EFNKEYE +K+K + PL WK +     
Sbjct: 295 LRKLELEQFFNLDAFHDSLMIFETLNETDYLVEEFNKEYEFKKSKTIQPLPWKTS----- 349

Query: 358 QMDSLLRGTGTTPGSTAHDVSTDDPFTQSLSLHFLQDYFLKILGFLLYDINLNKATEFIL 417
                  G   +  STAH     D F +SLS+ FL++Y L ILGFLLYDINLN+ T++I 
Sbjct: 350 -------GNTVSVNSTAH-----DEFKESLSVPFLKEYLLNILGFLLYDINLNRLTDYIF 397

Query: 418 VDNNYNSTNEFWDGLMDRLSPYLSYFIDEKLKTEEDMIKLKDFLCIYVAILENFKLNIEP 477
           V+NNYN+TNEFW+ LM RL PY  YF+D  LKTE+D+I+ KDFL IYV I+EN+KLNI+P
Sbjct: 398 VNNNYNATNEFWEMLMMRLKPYFKYFMDTVLKTEKDIIEFKDFLGIYVCIMENYKLNIDP 457

Query: 478 LYKILVSIFEKFCSVSLRAFDDEFQILLNDDDFMPLSINDKTLYEKVLKICWMKEGEHLS 537
           LY +++++FEK+C  +L  FD +FQ++L+DDDFMPL+I++K  YEKV+KICWMKE     
Sbjct: 458 LYSVMLALFEKYCKTTLELFDKDFQVMLSDDDFMPLTIDNKGFYEKVIKICWMKENHQ-- 515

Query: 538 LPDPTNGEPFAVTLPFSPLYPMTCTLAKKTYSKITAFLSIFYRHELHTLNNILVKTMDDI 597
           + D  + E F+VTLPFSPLYPMTCT+ +K Y+K+T+F+S FYRH LH+LNNILV T+D I
Sbjct: 516 IIDDMDDENFSVTLPFSPLYPMTCTMTQKVYAKLTSFISSFYRHSLHSLNNILVNTIDGI 575

Query: 598 FNDIVNKKIRSKLESTSREEIAQILVNLDYFIIAAKEFSNFMTRENILQNPDMEIRLSSI 657
            + +VNK+IR+KLE+TSREEIAQ+L+NLDYF+IA+KEFSN MT++NIL+NPD+EIRL+S 
Sbjct: 576 LDGVVNKQIRAKLETTSREEIAQLLINLDYFVIASKEFSNLMTKDNILENPDVEIRLAST 635

Query: 658 KYLAESRKLAETKLIELIDSKISDILETIEIDWQITEVRQDPDISIIDLAQFLEMMFAST 717
           K  AESRK AE+KLI+LID+KI DILET+  DW  T+ R DPDISI+DLAQFLEMMFA+T
Sbjct: 636 KNFAESRKYAESKLIDLIDTKIKDILETVSFDWLDTDRRIDPDISIVDLAQFLEMMFATT 695

Query: 718 LQNLPYSVQTLLIFREFDSLTRQFMGLLLHDTPSTITHESIMNFEVDVNYLESIIPRIFP 777
           L NLPYSVQ LLIFREFDSLTR F+ +LLHDTP  I+ ES+ NFEVD+ YLE IIP+IFP
Sbjct: 696 LVNLPYSVQILLIFREFDSLTRHFLDVLLHDTPQYISKESVGNFEVDMMYLEGIIPKIFP 755

Query: 778 STPGTIDSNGYQSPMTPSTPTFPNANGVDAPTLFENNIKSLEATFMELKQCIELLKTQG- 836
            T    + NG     TP TPT  + +   + +  +NNIKSLE+TFMELKQCI+LL+++  
Sbjct: 756 RTDE--NENGRLGSQTPKTPTIDDESRSQSNSQIDNNIKSLESTFMELKQCIQLLQSEDP 813

Query: 837 KDYNEPEIRLRKYSRIRQEDAALLLSKIQHFVSSVEGANGDDTSVMD 883
            +Y +P++R RKYSRI+ +DA +L+ KI+   +       +++SV +
Sbjct: 814 NEYLDPQMRSRKYSRIKPDDANILIGKIRPITAPAPTNEAENSSVFN 860

>Sklu_2433.11 YGL233W, Contig c2433 17844-20498
          Length = 884

 Score =  920 bits (2378), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 474/889 (53%), Positives = 643/889 (72%), Gaps = 27/889 (3%)

Query: 1   MDQEGQPLLSKDFQQVLLATASGNNSSWTERAVLNNESTDAVKHEPALGQNDVFDLDPLS 60
           MDQE Q L+S++ Q+VLL++     +S       N +S  +     +L Q+D+ +LD  S
Sbjct: 1   MDQEPQSLVSQELQKVLLSSDFSTLASPITAQNNNKQSNTSA----SLLQDDIIELDEQS 56

Query: 61  FDKWVPFLRRALDKNQLDPVIDELENSIEDNFQGLELQLLQDSQMNDKLETSIDEIANIQ 120
           FD+WVP LR +++ + L  +++EL NS++DNFQ LE ++LQDSQ+ND L TSI+EI +IQ
Sbjct: 57  FDRWVPLLRTSIEDSSLTKLVEELFNSVDDNFQSLETRILQDSQINDNLTTSINEIESIQ 116

Query: 121 GMVQDTLSSEISKFQIRLSESANELIVKKQMYVNNKKISLKISEATILITKVVRILELSS 180
            ++  +L  E+S  Q +LS+S N++I+KKQ+ +NN+K S+KISE+ ILI K+++ILELS+
Sbjct: 117 KLINGSLQQEVSDLQQQLSQSTNDVILKKQILINNRKTSMKISESMILINKILQILELSN 176

Query: 181 KCQELITERKFFKVLQNLDSLEKLYLQEFKNYNFQFLIEIYNSIPFLQKVTKDECXXXXX 240
           +CQ+LI E  FFK LQ+LD+LEK+YLQ+FKNYNF FL EIYNSIPFL+ + KDE      
Sbjct: 177 RCQDLIKEGDFFKALQSLDNLEKIYLQDFKNYNFDFLKEIYNSIPFLKSIIKDESINLIK 236

Query: 241 XXXXXXXGKNLIKVGQEFVAIYENELLPQWLETRSKMKLTNFKFNSPIEISMRDESFLAK 300
                   K L  VG ++  +Y+  LL  WLE +  MKL NFKFNS +E+++RD+  L  
Sbjct: 237 KSFTSNLEKTLFTVGSKYFEVYQEVLLKDWLELKHSMKLGNFKFNSSVELALRDQKGLEL 296

Query: 301 LNLGEFFQLDDFHDSIMIFQNLNELSVLSGEFNKEYELRKTKLMYPLIWKKNKTAAYQMD 360
           L    F+ LD+FHDSI+IFQNL EL  L  EF KEY+ RK KL+YPL  K   T+     
Sbjct: 297 LKAENFYHLDEFHDSILIFQNLKELDYLCEEFIKEYDFRKAKLVYPLELKNTTTS----- 351

Query: 361 SLLRGTGTTPGSTAHDVSTDDPFTQSLSLHFLQDYFLKILGFLLYDINLNKATEFILVDN 420
           S L G   +          DD F ++L++ FL++Y LKILGFL+YD +LNK+T+++L  N
Sbjct: 352 SSLNGQNQS--------HLDDVFGENLNMSFLKEYLLKILGFLIYDKHLNKSTDYVLSFN 403

Query: 421 NYNSTNEFWDGLMDRLSPYLSYFIDEKLKTEEDMIKLKDFLCIYVAILENFKLNIEPLYK 480
           +YN+TNEFWD LM +L+P+L  F+   L TEE++++ KDFL I++AILEN KLNIE LY+
Sbjct: 404 SYNTTNEFWDILMKKLAPHLQQFVTRNLTTEEELVQFKDFLGIFIAILENLKLNIETLYR 463

Query: 481 ILVSIFEKFCSVSLRAFDDEFQILLNDDDFMPLSINDKTLYEKVLKICWMKEGEHLSL-- 538
           I +++FEK+C++ +  F +EF  LLNDDDFMPL+ ND+ LYEKVLKICW+KE E   +  
Sbjct: 464 IHITVFEKYCNLLVHKFSEEFSTLLNDDDFMPLTTNDRNLYEKVLKICWLKEEEPEKMKE 523

Query: 539 -PDPTNGEPFAVTLPFSPLYPMTCTLAKKTYSKITAFLSIFYRHELHTLNNILVKTMDDI 597
             DP NG+ F  TLPFSPLYPM CTLAKKTY KI  FL+ FY+HEL+ LN ILVKTMD I
Sbjct: 524 QQDPANGD-FLATLPFSPLYPMACTLAKKTYGKIVTFLNNFYQHELYHLNTILVKTMDSI 582

Query: 598 FNDIVNKKIRSKLESTSREEIAQILVNLDYFIIAAKEFSNFMTRENILQNPDMEIRLSSI 657
           F  +VN KIRSKL++TSREEIAQ+L+NLDYF+IAA+EFS+ +TRENI+QNPD+EIRL+S 
Sbjct: 583 FQKVVNNKIRSKLDTTSREEIAQVLINLDYFVIAAREFSSILTRENIIQNPDVEIRLASA 642

Query: 658 KYLAESRKLAETKLIELIDSKISDILETIEIDWQITEVRQDPDISIIDLAQFLEMMFAST 717
           + L ESRK AETKLIELIDSK+SD++E +E+DW  T ++Q+PDISI D+AQFLEMMF ST
Sbjct: 643 EQLTESRKYAETKLIELIDSKVSDLMEFVELDWVATTIKQEPDISIRDIAQFLEMMFTST 702

Query: 718 LQNLPYSVQTLLIFREFDSLTRQFMGLLLHDTPSTITHESIMNFEVDVNYLESIIPRIFP 777
           L NLPYSV+TLLIFREFDSLTR+F+ +LL+ TPSTIT +S++NFE+D+ +LE I+ +IFP
Sbjct: 703 LVNLPYSVKTLLIFREFDSLTRRFLEMLLNGTPSTITPQSVLNFEMDMKFLEGIVSKIFP 762

Query: 778 STPGTIDSNGYQSPMTPSTPTFPNANGVDAPTLFENNIKSLEATFMELKQCIELLKTQG- 836
           S    +    ++S  +P +P    ++   A  L ENN++SL++TF +LKQ I+L+K    
Sbjct: 763 SETKEL---PFESSPSPDSPL--QSDQARASNLIENNVRSLQSTFTDLKQHIQLMKASNL 817

Query: 837 KDYNEPEIRLRKYSRIRQEDAALLLSKIQHFVSSVEGANGDDTSVMDSS 885
           ++Y +P IR+RKY RIR E A LL+SK+     S    +GD+TS    S
Sbjct: 818 EEYKDPSIRMRKYPRIRPEVAQLLVSKVAIPSPSPSAGDGDNTSYRGQS 866

>AFR251C [3443] [Homologous to ScYGL233W (SEC15) - SH]
           (888186..890792) [2607 bp, 868 aa]
          Length = 868

 Score =  854 bits (2207), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 442/902 (49%), Positives = 617/902 (68%), Gaps = 54/902 (5%)

Query: 1   MDQEGQPLLSKDFQQVLLAT--ASGNNSSWTERAVLNNESTDAVKHEPALGQNDVFDLDP 58
           ++QE    LS++ Q+VLL    A+  +  +T                P    + +  L  
Sbjct: 5   LEQEPHTQLSQELQKVLLTAEFAATRDDDYT----------------PGETGDGLMCLSD 48

Query: 59  LSFDKWVPFLRRALDKNQLDPVIDELENSIEDNFQGLELQLLQDSQMNDKLETSIDEIAN 118
            +F+KWVP+LR+A++ ++LD V++E+ +S+E+NFQ  E Q+LQDSQ++D L  SIDE   
Sbjct: 49  QTFEKWVPYLRQAVESDRLDGVVEEVYSSVEENFQNFETQILQDSQVSDNLSFSIDENDR 108

Query: 119 IQGMVQDTLSSEISKFQIRLSESANELIVKKQMYVNNKKISLKISEATILITKVVRILEL 178
           IQ + +  L  +++  Q  LS S NE++ KK+   +N++ S+KISE+ ILI K+ ++LEL
Sbjct: 109 IQNLAESYLQGQVADLQAHLSASTNEVVSKKRALTSNRRTSIKISESIILIEKIFQMLEL 168

Query: 179 SSKCQELITERKFFKVLQNLDSLEKLYLQEFKNYNFQFLIEIYNSIPFLQKVTKDECXXX 238
           ++KCQELI +  F+K LQNLD LE++Y+ +FKNY F+FL  IYNSIP L+ + KDE    
Sbjct: 169 TNKCQELIRDGNFYKALQNLDKLERIYIHDFKNYKFEFLAVIYNSIPKLKNIIKDESINL 228

Query: 239 XXXXXXXXXGKNLIKVGQEFVAIYENELLPQWLETRSKMKLTNFKFNSPIEISMRDESFL 298
                     K L +VGQ +  +Y ++LLP WL  +  MKL+N+KFNSP+E+S+RD+SFL
Sbjct: 229 IKKSLSSNLEKTLSQVGQTYFQVYNDQLLPHWLAMKKAMKLSNYKFNSPVEVSLRDDSFL 288

Query: 299 AKLNLGEFFQLDDFHDSIMIFQNLNELSVLSGEFNKEYELRKTKLMYPLIWKKNKTAAYQ 358
           A L L +++ LD+F+DSIMIF++L E + L  EF KEY+ RK KL+YPL WK   T  + 
Sbjct: 289 AGLKLEDYYNLDEFYDSIMIFESLKETNYLCDEFTKEYDFRKVKLVYPLDWKSTTTMTHS 348

Query: 359 MDSLLRGTGTTPGSTAHDVSTDDPFTQSLSLHFLQDYFLKILGFLLYDINLNKATEFILV 418
            +  +                 D F Q LSL FL++Y LKILGFLLYD  L+K+T++I  
Sbjct: 349 ANEQV-----------------DSFYQQLSLPFLKEYLLKILGFLLYDKFLHKSTDYIFA 391

Query: 419 DNNYNSTNEFWDGLMDRLSPYLSYFIDEKLKTEEDMIKLKDFLCIYVAILENFKLNIEPL 478
            N Y +T EFW+  M ++SP+LS FI EKL TE+ +I+ K+FL I +AILEN KLN E +
Sbjct: 392 YNTYTTTEEFWEQFMTKVSPHLSRFIKEKLTTEDQLIEFKNFLGILIAILENMKLNSESM 451

Query: 479 YKILVSIFEKFCSVSLRAFDDEFQILLNDDDFMPLSINDKTLYEKVLKICWMKEGEHLSL 538
           YKI V +FEK+C + +  FD EF  LLNDDDFMPL I+D+  YEKV+K+CWMK     S+
Sbjct: 452 YKIQVQVFEKYCGLLIHVFDKEFTNLLNDDDFMPLPISDRNFYEKVMKLCWMKPD---SV 508

Query: 539 P----DPTNGEPFAVTLPFSPLYPMTCTLAKKTYSKITAFLSIFYRHELHTLNNILVKTM 594
           P    D  NG  F+VTLPFSPLYPMTC L KK+Y+ +  FL+ F++H+L  LN +LV+T+
Sbjct: 509 PIVTQDDANG--FSVTLPFSPLYPMTCALIKKSYANMLLFLNTFFQHDLSYLNIVLVRTV 566

Query: 595 DDIFNDIVNKKIRSKLESTSREEIAQILVNLDYFIIAAKEFSNFMTRENILQNPDMEIRL 654
           DDIF  +VN KIRSKL++TSREEIAQIL+NLDYFI+AAKEFS+ MT+ENI QNPD+EI+L
Sbjct: 567 DDIFIKVVNNKIRSKLDTTSREEIAQILINLDYFIVAAKEFSDIMTKENITQNPDIEIKL 626

Query: 655 SSIKYLAESRKLAETKLIELIDSKISDILETIEIDWQITEVRQDPDISIIDLAQFLEMMF 714
           SS K LA+++K AETKLIELIDSK++D++E +E+DW   EVR +P +SI D+AQFLEMMF
Sbjct: 627 SSTKQLADTKKYAETKLIELIDSKVTDLMEFVELDWTTEEVRDEPGLSIRDIAQFLEMMF 686

Query: 715 ASTLQNLPYSVQTLLIFREFDSLTRQFMGLLLHDTPSTITHESIMNFEVDVNYLESIIPR 774
            STL NLPYS+++LLIFREFD LTR+F+ LL+H++PS IT +S+ NFE D+ +LE++I  
Sbjct: 687 TSTLANLPYSIKSLLIFREFDQLTRKFLELLVHESPSYITTQSVANFETDMKFLENVISN 746

Query: 775 IFPSTPGTIDSNGYQSPMTPSTPTFPNANG--VDAPTLFENNIKSLEATFMELKQCIELL 832
           IFP+     +S      ++PSTPT P A+   V +P + E+N++SL +TF +L Q I L+
Sbjct: 747 IFPN-----ESTEQNVEISPSTPTTPVADSFNVKSPNMIESNVRSLFSTFTDLNQHILLM 801

Query: 833 KTQGKD-YNEPEIRLRKYSRIRQEDAALLLSKIQHFVSSVEGANGDDTSVMDSSSIFNSE 891
           K+   D Y +  IR+RKY RI+ E A LL++K+     +    +GD+T+V D S   N  
Sbjct: 802 KSNNFDEYKDSSIRMRKYPRIKPEVAHLLMNKLSR--PTTATTDGDNTTVSDYSVTSNGR 859

Query: 892 SA 893
            A
Sbjct: 860 FA 861

>Kwal_47.19214
          Length = 876

 Score =  806 bits (2082), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 429/903 (47%), Positives = 610/903 (67%), Gaps = 63/903 (6%)

Query: 1   MDQEGQPLLSKDFQQVLLATASGNNSSWTERAVLNNESTDAVKHEPALGQNDVFDLDPL- 59
           M+ + Q L+S++ QQVLL+T         + + L +  T         GQ+++ ++    
Sbjct: 1   MEGDAQSLISEELQQVLLST---------DLSFLKSLQT---------GQDEIAEVAGEY 42

Query: 60  ---------SFDKWVPFLRRALDKNQLDPVIDELENSIEDNFQGLELQLLQDSQMNDKLE 110
                    +F+KW P LR A++   L  V++EL NSIEDNF+ LE Q+LQDSQ++D L 
Sbjct: 43  EEELDLDEHTFNKWTPLLRSAIEDESLPLVVEELYNSIEDNFENLESQILQDSQLSDNLT 102

Query: 111 TSIDEIANIQGMVQDTLSSEISKFQIRLSESANELIVKKQMYVNNKKISLKISEATILIT 170
            S+ +IA+I+ +++ +L  EI    I+L+E+ N++I +KQ Y+NNKKIS KISE  ILIT
Sbjct: 103 ASVGQIASIKEVIEGSLLQEIEDLHIQLAETTNDVITRKQNYINNKKISTKISETIILIT 162

Query: 171 KVVRILELSSKCQELITERKFFKVLQNLDSLEKLYLQEFKNYNFQFLIEIYNSIPFLQKV 230
           KV++ILELS KCQ+LI ER +FK LQ+L  LEK+Y+Q+FKNYNF FL +IY SIP L+  
Sbjct: 163 KVLQILELSKKCQDLIKERSYFKALQSLGGLEKIYVQDFKNYNFDFLKKIYASIPILKSK 222

Query: 231 TKDECXXXXXXXXXXXXGKNLIKVGQEFVAIYENELLPQWLETRSKMKLTNFKFNSPIEI 290
            KDE              K L+ VGQ F   Y + LL  WL +RS++KL+NFKFNSP+EI
Sbjct: 223 IKDESINLVKSSFNSNLEKKLLTVGQTFFDFYHDVLLSDWLNSRSELKLSNFKFNSPVEI 282

Query: 291 SMRDESFLAKLNLGEFFQLDDFHDSIMIFQNLNELSVLSGEFNKEYELRKTKLMYPLIWK 350
           S+RD + L  LN+   + LD+F+DSI+IFQNL E+  L  EF KEY+ R +K+++PL  K
Sbjct: 283 SLRDTTQLESLNVATLYPLDEFYDSILIFQNLKEIDYLRTEFKKEYDFRTSKVVHPLELK 342

Query: 351 KNKTAAYQMDSLLRGTGTTPGSTAHDVST--DDPFTQSLSLHFLQDYFLKILGFLLYDIN 408
            + +A             TP      V+    D FTQ      L+ Y L+ILGF++YD +
Sbjct: 343 VSASA-------------TPAEQKLQVTNLFADDFTQDQ----LKHYLLRILGFVIYDRH 385

Query: 409 LNKATEFILVDNNYNSTNEFWDGLMDRLSPYLSYFIDEKLKTEEDMIKLKDFLCIYVAIL 468
           LNK+TE++L  N +N++  FW+  ++R SP+L +F++ ++ TEE+MI LKDFL +Y+AIL
Sbjct: 386 LNKSTEYVLSFNQFNTSESFWELFINRFSPFLEHFVNSRINTEEEMIDLKDFLGVYIAIL 445

Query: 469 ENFKLNIEPLYKILVSIFEKFCSVSLRAFDDEFQILLNDDDFMPLSINDKTLYEKVLKIC 528
           EN  +NIE +Y+I V +F+K+    ++ FD EF  LL+DDDFMPL+IND  LYEKVLKIC
Sbjct: 446 ENIGVNIEQIYRINVLLFKKYARFLVQMFDSEFSTLLDDDDFMPLTINDHGLYEKVLKIC 505

Query: 529 WMKEGE--HLSLPDPTNGEPFAVTLPFSPLYPMTCTLAKKTYSKITAFLSIFYRHELHTL 586
           W++E E       + T GE F  TLPFSPLYPMTCTLAKK Y+K+  FL+ F++++L  L
Sbjct: 506 WLREDELDKFGSIEQTPGESFFATLPFSPLYPMTCTLAKKCYNKLVGFLTDFFQYDLGEL 565

Query: 587 NNILVKTMDDIFNDIVNKKIRSKLESTSREEIAQILVNLDYFIIAAKEFSNFMTRENILQ 646
           N+++V+ +DDIF  IVN KI +K ++TSREEIAQIL+NLDYFI+A KEFSN ++RENI+ 
Sbjct: 566 NHVIVQMIDDIFGKIVNDKIAAKSDTTSREEIAQILINLDYFIVAVKEFSNILSRENIMH 625

Query: 647 NPDMEIRLSSIKYLAESRKLAETKLIELIDSKISDILETIEIDWQITEVRQDPDISIIDL 706
           NP +E+ L + K L++SR L ETKLI LIDSK+SD++E +E +W   E+ ++PD SI D+
Sbjct: 626 NPGVELGLQATKQLSKSRTLTETKLIALIDSKVSDLMEFVEFEWASQEILREPDYSIKDI 685

Query: 707 AQFLEMMFASTLQNLPYSVQTLLIFREFDSLTRQFMGLLLHDTPSTITHESIMNFEVDVN 766
           AQFLEMMF STL NLP SV+TLLIFREFD+LTR+F+ +LL+ TPS IT +SI+NFE +++
Sbjct: 686 AQFLEMMFNSTLVNLPDSVKTLLIFREFDALTRRFLDVLLNQTPSVITPQSILNFERNMD 745

Query: 767 YLESIIPRIFPSTPGTIDSNGYQSPMTPSTPTFPNANGVD---APTLFENNIKSLEATFM 823
           +LE+II ++FPS+  T        P TP++P  P+    D   +  +  N ++SL +TF 
Sbjct: 746 FLEAIITKLFPSSDST--------PQTPTSPEIPSGQFSDNARSSNVINNTVRSLHSTFS 797

Query: 824 ELKQCIELLKTQG-KDYNEPEIRLRKYSRIRQEDAALLLSKIQHFVSSVEGANGDDTSVM 882
           +LKQ I+ LK+   ++Y +  IR+RKY RI+ E A +L +KI    S+  G   +++S +
Sbjct: 798 DLKQHIQFLKSPDMEEYKDSSIRMRKYPRIKPEVAQMLYNKIVPPRSA--GTESEESSSV 855

Query: 883 DSS 885
           D S
Sbjct: 856 DQS 858

>KLLA0A01023g 96383..98968 similar to sp|P22224 Saccharomyces
           cerevisiae YGL233w SEC15 vesicular traffic control
           protein singleton, start by similarity
          Length = 861

 Score =  804 bits (2076), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 429/891 (48%), Positives = 597/891 (67%), Gaps = 46/891 (5%)

Query: 1   MDQEGQPLLSKDFQQVLLAT--ASGNNSSWTERAVLNNESTDAVKHEPALGQNDVFDLDP 58
           MDQ+ Q  +S+D Q+ LL     S + SS  ++                 G++++F+LDP
Sbjct: 1   MDQDPQLAVSQDLQRALLTAEFVSKSGSSNQDQ-----------------GEDELFELDP 43

Query: 59  LSFDKWVPFLRRALDKNQLDPVIDELENSIEDNFQGLELQLLQDSQMNDKLETSIDEIAN 118
             FD+WVP LR+ +D+ QL+ VID+L  SI+D+F+ LE Q+LQDSQ+N+ L TSI+EI  
Sbjct: 44  QIFDRWVPLLRQTIDEGQLNTVIDDLYASIDDHFENLETQILQDSQINNNLVTSINEIQK 103

Query: 119 IQGMVQDTLSSEISKFQIRLSESANELIVKKQMYVNNKKISLKISEATILITKVVRILEL 178
           +Q ++  +L ++I   Q ++  S   L+ +KQ+ ++N K S KI+E++ILI KV++ILEL
Sbjct: 104 VQQIIDGSLQNDIKNLQSQVRHSTLNLVSRKQILIDNTKTSSKITESSILIQKVLQILEL 163

Query: 179 SSKCQELITERKFFKVLQNLDSLEKLYLQEFKNYNFQFLIEIYNSIPFLQKVTKDECXXX 238
            ++C+ELI E+ FFK LQ +++ E +YLQ+FK YNF+FL +IY SIP L+   KDE    
Sbjct: 164 FNRCRELIEEKDFFKALQTIETFETIYLQDFKQYNFEFLNQIYTSIPMLKSQIKDESINL 223

Query: 239 XXXXXXXXXGKNLIKVGQEFVAIYENELLPQWLETRSKMKLTNFKFNSPIEISMRDESFL 298
                     K    +G+++  +YE ++L  WL+T+  MKL N+KFNSP+EIS+RD S L
Sbjct: 224 IKKSLNYNLEKTFSVIGEKYYDVYETQILQDWLKTKQSMKLHNYKFNSPVEISLRDTSKL 283

Query: 299 AKLNLGEFFQLDDFHDSIMIFQNLNELSVLSGEFNKEYELRKTKLMYPLIWKKNKTAAYQ 358
             L L  F QL +FHDSI+IFQ+LNE+     EF KEYE RK+KL++PL  K   T +  
Sbjct: 284 DSLQLQNFCQLHEFHDSILIFQSLNEMDFFIDEFRKEYEFRKSKLIHPLFLKDFSTVS-- 341

Query: 359 MDSLLRGTGTTPGSTAHDVSTDDPFTQSLSLHFLQDYFLKILGFLLYDINLNKATEFILV 418
                           H     D F + L L F ++Y LKILGFL+YD  L+K+T+++L 
Sbjct: 342 ----------------HSNGKIDAFAEKLDLSFFKEYILKILGFLVYDKELHKSTDYVLS 385

Query: 419 DNNY-NSTNEFWDGLMDRLSPYLSYFIDEKLKTEEDMIKLKDFLCIYVAILENFKLNIEP 477
           +NN  NST+ FW  +M++L PYL   + EKL TE+ + + KDFL + +AILEN KLN+E 
Sbjct: 386 NNNNPNSTDIFWTSIMNKLYPYLITMVKEKLTTEQLLTEFKDFLGVLIAILENLKLNVEL 445

Query: 478 LYKILVSIFEKFCSVSLRAFDDEFQILLNDDDFMPLSINDKTLYEKVLKICWMKEGEHLS 537
           LYK+ V  F ++C + +  F  EF  LL DDDFMPL+I DK LYEK+LKICW+   +  S
Sbjct: 446 LYKVQVETFSQYCELLVFLFQKEFTNLLQDDDFMPLAITDKALYEKILKICWL--ADQGS 503

Query: 538 LPDPTNGEPFAVTLPFSPLYPMTCTLAKKTYSKITAFLSIFYRHELHTLNNILVKTMDDI 597
               T  + F+ T PFSPLYPMTCTL KKTYS + +F+SIFY+H++  LN I++K +D+I
Sbjct: 504 DTSNTTNDNFSATFPFSPLYPMTCTLVKKTYSSLHSFISIFYKHDISHLNLIVIKAIDNI 563

Query: 598 FNDIVNKKIRSKLESTSREEIAQILVNLDYFIIAAKEFSNFMTRENILQNPDMEIRLSSI 657
           F+ +VN  I+SKL++TSREEIAQILVNLDYF+IAAKEFS  +TREN+  NPD+EIRLSSI
Sbjct: 564 FDRVVNDNIKSKLDTTSREEIAQILVNLDYFVIAAKEFSLILTRENLTNNPDVEIRLSSI 623

Query: 658 KYLAESRKLAETKLIELIDSKISDILETIEIDWQITEVRQDPDISIIDLAQFLEMMFAST 717
           K L E+RK AETKLI LIDSK+ D++E IE DW  TEVR +PD++I+D+AQFLEMMF ST
Sbjct: 624 KKLIETRKEAETKLITLIDSKVIDLMEFIEFDWNSTEVRTEPDMTIVDIAQFLEMMFTST 683

Query: 718 LQNLPYSVQTLLIFREFDSLTRQFMGLLLHDTPSTITHESIMNFEVDVNYLESIIPRIFP 777
           L  +PY+++ LLIFREFD +TR+F+  LL++TP  I+ +S+ NFE D+ YLE  I +IFP
Sbjct: 684 LAIIPYNIKMLLIFREFDVITRRFLEKLLNETPDRISPQSVQNFETDMLYLEKTITKIFP 743

Query: 778 STPGTIDSNGYQSPMTPSTPT-FPNANGVDAPTLFENNIKSLEATFMELKQCIELLKTQG 836
           +   ++ +    SP  P+TPT  P+  G  + T  ENNIKSL +TF +LKQ I L+K   
Sbjct: 744 NDVSSVPT----SPSIPATPTDVPSTAGNRSSTQVENNIKSLLSTFTDLKQHIGLMKINH 799

Query: 837 KD-YNEPEIRLRKYSRIRQEDAALLLSKIQHFVSSVEGANGDDTSVMDSSS 886
            D Y + +IRL+KYSR++ E A  LLSK+Q   S       D+ S  +S +
Sbjct: 800 WDEYKDNDIRLKKYSRVKPEVAQSLLSKLQPPSSEQSNLVSDEGSSAESRA 850

>AFR691W [3884] [Homologous to ScYLR181C (VTA1) - SH]
           complement(1714741..1715544) [804 bp, 267 aa]
          Length = 267

 Score = 31.6 bits (70), Expect = 2.4,   Method: Composition-based stats.
 Identities = 23/76 (30%), Positives = 40/76 (52%), Gaps = 4/76 (5%)

Query: 814 NIKSLEATFMELKQCIELLKTQGKDYNEPEIRLRKYSRIRQEDAALLLSKIQHFVSSVEG 873
           N++ L+A   EL++    +    K Y    I L +    R++ AA LL +++ F  + +G
Sbjct: 8   NLERLQAWCRELEESAPAVAYYMKLYTVERI-LSQGDGARRDVAAALLDEVERFKEAAQG 66

Query: 874 ANGDD---TSVMDSSS 886
           ANGD+   T V D ++
Sbjct: 67  ANGDEGMATVVRDQTA 82

>Sklu_1929.2 YJR041C, Contig c1929 1685-5149 reverse complement
          Length = 1154

 Score = 30.8 bits (68), Expect = 6.1,   Method: Compositional matrix adjust.
 Identities = 25/97 (25%), Positives = 42/97 (43%), Gaps = 16/97 (16%)

Query: 64  WVPFLRRALDKNQLDP-VIDELENSIEDNFQGLELQLLQDSQMNDKLETSIDEIANIQGM 122
           +V   +  +  + + P VI  +E S+ED F G           N+  +T I   + + G 
Sbjct: 847 YVVLRQMGIPGDDISPGVISVIEKSLEDGFHGF----------NNAFDTVIQSFSQLSGG 896

Query: 123 VQDTLSSEISKFQIRLS---ESANELIVK--KQMYVN 154
           V D++      F +RL+   E   +L VK   + Y N
Sbjct: 897 VTDSILELYIHFSVRLTKDNEVGTKLFVKSVSEFYTN 933

  Database: blastdb
    Posted date:  Apr 3, 2006  3:33 PM
  Number of letters in database: 16,596,109
  Number of sequences in database:  34,618
  
Lambda     K      H
   0.318    0.135    0.380 

Gapped
Lambda     K      H
   0.267   0.0410    0.140 

Matrix: BLOSUM62
Gap Penalties: Existence: 11, Extension: 1
Number of Sequences: 34618
Number of Hits to DB: 30,025,319
Number of extensions: 1416112
Number of successful extensions: 5647
Number of sequences better than 10.0: 79
Number of HSP's gapped: 5849
Number of HSP's successfully gapped: 82
Length of query: 895
Length of database: 16,596,109
Length adjustment: 111
Effective length of query: 784
Effective length of database: 12,753,511
Effective search space: 9998752624
Effective search space used: 9998752624
Neighboring words threshold: 11
Window for multiple hits: 40
X1: 16 ( 7.3 bits)
X2: 38 (14.6 bits)
X3: 64 (24.7 bits)
S1: 41 (21.7 bits)
S2: 66 (30.0 bits)