Hit NameLength (aa)HSP LengthHSP ScoreHSP Significance
YGL231C1901889921e-139
Scas_712.201861845382e-70
CAGL0H07953g1831815217e-68
Kwal_47.192101811834903e-63
AFR249W1811824834e-62
KLLA0A01067g2021823561e-42
Sklu_2433.1379771416e-12
KLLA0C16203g145434710.27
KLLA0F13420g133654606.4
YHR056C (RSC30)88376606.4
Sklu_2275.41012106606.8
YCL049C31286598.0
BLASTP 2.2.26 [Sep-21-2011]

Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, 
Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), 
"Gapped BLAST and PSI-BLAST: a new generation of protein database search
programs",  Nucleic Acids Res. 25:3389-3402.

Reference for compositional score matrix adjustment: Altschul, Stephen F., 
John C. Wootton, E. Michael Gertz, Richa Agarwala, Aleksandr Morgulis,
Alejandro A. Schaffer, and Yi-Kuo Yu (2005) "Protein database searches
using compositionally adjusted substitution matrices", FEBS J. 272:5101-5109.

Query= YGL231C
         (188 letters)

Database: blastdb 
           34,618 sequences; 16,596,109 total letters

Searching..................................................done

                                                                 Score    E
Sequences producing significant alignments:                      (bits) Value

YGL231C (YGL231C) [1767] chr7 complement(63047..63619) Protein o...   386   e-139
Scas_712.20                                                           211   2e-70
CAGL0H07953g complement(776742..777293) similar to sp|P53073 Sac...   205   7e-68
Kwal_47.19210                                                         193   3e-63
AFR249W [3441] [Homologous to ScYGL231C - SH] complement(886552....   190   4e-62
KLLA0A01067g complement(100259..100867) weakly similar to sp|P53...   141   1e-42
Sklu_2433.13 YGL231C, Contig c2433 22436-22670 reverse complement      59   6e-12
KLLA0C16203g complement(1414169..1418533) weakly similar to sp|Q...    32   0.27 
KLLA0F13420g 1240135..1244145 gi|3002789|gb|AAC39438.1 Kluyverom...    28   6.4  
YHR056C (RSC30) [2344] chr8 complement(215184..217835) Component...    28   6.4  
Sklu_2275.4 YLL005C, Contig c2275 4812-7850                            28   6.8  
YCL049C (YCL049C) [497] chr3 complement(39786..40724) Protein of...    27   8.0  

>YGL231C (YGL231C) [1767] chr7 complement(63047..63619) Protein of
           unknown function, has moderate similarity to
           uncharacterized S. pombe Spcc1281.03cp [573 bp, 190 aa]
          Length = 190

 Score =  386 bits (992), Expect = e-139,   Method: Compositional matrix adjust.
 Identities = 188/188 (100%), Positives = 188/188 (100%)

Query: 1   MSEQEPYEWAKHLLDTKYIEKYNIQNSNTLPSPPGFEGNSSKGNVTRKQQDATSQTTSLA 60
           MSEQEPYEWAKHLLDTKYIEKYNIQNSNTLPSPPGFEGNSSKGNVTRKQQDATSQTTSLA
Sbjct: 1   MSEQEPYEWAKHLLDTKYIEKYNIQNSNTLPSPPGFEGNSSKGNVTRKQQDATSQTTSLA 60

Query: 61  QKNQITVLQVQKAWQIALQPAKSIPMNIFMSYMSGTSLQIIPIMTALMLLSGPIKAIFST 120
           QKNQITVLQVQKAWQIALQPAKSIPMNIFMSYMSGTSLQIIPIMTALMLLSGPIKAIFST
Sbjct: 61  QKNQITVLQVQKAWQIALQPAKSIPMNIFMSYMSGTSLQIIPIMTALMLLSGPIKAIFST 120

Query: 121 RSAFKPVLGNKATQSQVQTAMFMYIVFQGVLMYIGYRKLNSMGLIPNAKGDWLPWERIAH 180
           RSAFKPVLGNKATQSQVQTAMFMYIVFQGVLMYIGYRKLNSMGLIPNAKGDWLPWERIAH
Sbjct: 121 RSAFKPVLGNKATQSQVQTAMFMYIVFQGVLMYIGYRKLNSMGLIPNAKGDWLPWERIAH 180

Query: 181 YNNGLQWF 188
           YNNGLQWF
Sbjct: 181 YNNGLQWF 188

>Scas_712.20
          Length = 186

 Score =  211 bits (538), Expect = 2e-70,   Method: Compositional matrix adjust.
 Identities = 109/184 (59%), Positives = 126/184 (68%), Gaps = 3/184 (1%)

Query: 5   EPYEWAKHLLDTKYIEKYNIQNSNTLPSPPGFEGNSSKGNVTRKQQDATSQTTSLAQKNQ 64
           EP+EWA  L + K  E  +     TLPSPPG+       N    Q +  ++   + + N 
Sbjct: 4   EPFEWAVKLCNLKEEEATDSSAIKTLPSPPGYGVVEVGKNQHESQGNKATEAIRMKELNN 63

Query: 65  ITVLQVQKAWQIALQPAKSIPMNIFMSYMSGTSLQIIPIMTALMLLSGPIKAIFSTRSAF 124
              L  QKA  IA+QPAKSIPMN+ MSYMSGTSLQIIPIM ALMLLSGP+KAIFS R+AF
Sbjct: 64  ---LLAQKAMSIAMQPAKSIPMNMIMSYMSGTSLQIIPIMAALMLLSGPLKAIFSIRAAF 120

Query: 125 KPVLGNKATQSQVQTAMFMYIVFQGVLMYIGYRKLNSMGLIPNAKGDWLPWERIAHYNNG 184
           KPVLGNK  QSQV +AMF+YIVFQG LMYIG RKLN+MGLIPN K DWL WE    YN G
Sbjct: 121 KPVLGNKEIQSQVNSAMFLYIVFQGALMYIGIRKLNAMGLIPNTKSDWLTWELPVDYNIG 180

Query: 185 LQWF 188
            + F
Sbjct: 181 RKVF 184

>CAGL0H07953g complement(776742..777293) similar to sp|P53073
           Saccharomyces cerevisiae YGL231c, hypothetical start
          Length = 183

 Score =  205 bits (521), Expect = 7e-68,   Method: Compositional matrix adjust.
 Identities = 103/181 (56%), Positives = 131/181 (72%), Gaps = 7/181 (3%)

Query: 8   EWAKHLLDTKYIEKYNIQNSNTLPSPPGFEGNSSKGNVTRKQQDATSQTTSLAQKNQITV 67
           EW ++LL+ + ++++     NT PSP G++G S  G+V  K+  +  Q      K  I  
Sbjct: 8   EWVENLLNPQIVKEWQQSTVNT-PSPQGYQGLS--GSVRDKKNTSNKQ----VNKPDIAN 60

Query: 68  LQVQKAWQIALQPAKSIPMNIFMSYMSGTSLQIIPIMTALMLLSGPIKAIFSTRSAFKPV 127
           LQVQKAW+IALQPAKSIPMN FMSYMSGTSLQIIPIMTALMLLSGP+K+IF+ R  FKPV
Sbjct: 61  LQVQKAWEIALQPAKSIPMNFFMSYMSGTSLQIIPIMTALMLLSGPVKSIFTIRETFKPV 120

Query: 128 LGNKATQSQVQTAMFMYIVFQGVLMYIGYRKLNSMGLIPNAKGDWLPWERIAHYNNGLQW 187
           LGN  +Q+Q+   M +Y+ FQGVLM+IG +KLN MGLIPN   DW+ WE+I  YN G++ 
Sbjct: 121 LGNPKSQNQIYLMMILYVAFQGVLMFIGLKKLNDMGLIPNKTSDWMAWEKITDYNKGIRV 180

Query: 188 F 188
           F
Sbjct: 181 F 181

>Kwal_47.19210
          Length = 181

 Score =  193 bits (490), Expect = 3e-63,   Method: Compositional matrix adjust.
 Identities = 100/183 (54%), Positives = 127/183 (69%), Gaps = 7/183 (3%)

Query: 1   MSEQEPYEWAKHLLDTKYIEKYNIQNSNTLPSPPGFEGNSSKGNVTRKQQDATSQTTSLA 60
           MSE  P EWA++L D  Y++K N+  SN+LPSPPGF+  S   +   K+   +++  +LA
Sbjct: 1   MSEIIP-EWAQNLCDPDYVQKINVVTSNSLPSPPGFKTLSVSTSKPSKKTSNSAEAENLA 59

Query: 61  QKNQITVLQVQKAWQIALQPAKSIPMNIFMSYMSGTSLQIIPIMTALMLLSGPIKAIFST 120
                  L VQKAWQI+ QPAKSIPMN+ +SYMSGTSLQII IMTALM +S PIK++ + 
Sbjct: 60  S------LMVQKAWQISFQPAKSIPMNMIVSYMSGTSLQIISIMTALMFVSNPIKSVINI 113

Query: 121 RSAFKPVLGNKATQSQVQTAMFMYIVFQGVLMYIGYRKLNSMGLIPNAKGDWLPWERIAH 180
           R  FKPV+GN   Q QV +AM M++VFQ +LM IG  KLNSMGLIPN K DWL  E+ A 
Sbjct: 114 RRTFKPVMGNPEVQPQVLSAMIMFVVFQAMLMGIGIHKLNSMGLIPNTKSDWLFLEKPAI 173

Query: 181 YNN 183
           Y +
Sbjct: 174 YKD 176

>AFR249W [3441] [Homologous to ScYGL231C - SH]
           complement(886552..887097) [546 bp, 181 aa]
          Length = 181

 Score =  190 bits (483), Expect = 4e-62,   Method: Compositional matrix adjust.
 Identities = 93/182 (51%), Positives = 124/182 (68%), Gaps = 7/182 (3%)

Query: 1   MSEQEPYEWAKHLLDTKYIEKYNIQNSNTLPSPPGFEGNSSKGNVTRKQQDATSQTTSLA 60
           MS + P  WA+ L++ +Y++  ++ +SNTLP PPGF          + Q  + S+    A
Sbjct: 1   MSSEAP-TWARCLVEPEYLKSISVVSSNTLPQPPGFSKKQ------KSQTRSVSKEEGEA 53

Query: 61  QKNQITVLQVQKAWQIALQPAKSIPMNIFMSYMSGTSLQIIPIMTALMLLSGPIKAIFST 120
            + +I  LQV+KAWQ+A QP+K+IPMN FMSYMSGTSLQIIPIMTALMLL+GP+K++   
Sbjct: 54  NRERINALQVKKAWQLAFQPSKAIPMNFFMSYMSGTSLQIIPIMTALMLLTGPVKSVLQV 113

Query: 121 RSAFKPVLGNKATQSQVQTAMFMYIVFQGVLMYIGYRKLNSMGLIPNAKGDWLPWERIAH 180
           RS FK +L N+A   QV  AM +Y+ FQ VLM IG +KLN+MGL+PN   DWL WE    
Sbjct: 114 RSTFKGLLNNEAAYGQVLAAMCLYVFFQAVLMAIGLQKLNAMGLLPNKHSDWLAWETPMA 173

Query: 181 YN 182
           Y+
Sbjct: 174 YS 175

>KLLA0A01067g complement(100259..100867) weakly similar to sp|P53073
           Saccharomyces cerevisiae YGL231c singleton, start by
           similarity
          Length = 202

 Score =  141 bits (356), Expect = 1e-42,   Method: Compositional matrix adjust.
 Identities = 80/182 (43%), Positives = 108/182 (59%), Gaps = 10/182 (5%)

Query: 1   MSEQEPYEWAKHLLDTKYIEKYNIQNSNTLPSPPGFEGNSSKGNVTRKQQDATSQTTSLA 60
           MSE  P +WAK L   K + + ++ N   LP P G +    +G    K  D  +Q     
Sbjct: 23  MSEDIP-QWAKDLKVDKVMRRNSV-NGGKLPDPFGIKKLEIEGQKPPKVIDHDAQ----- 75

Query: 61  QKNQITVLQVQKAWQIALQPAKSIPMNIFMSYMSGTSLQIIPIMTALMLLSGPIKAIFST 120
             N+I  L  ++AWQI+ +P KS+PMNI MSYMSG SLQIIPIMTA+ML+S PIK+I   
Sbjct: 76  --NRIAKLTAERAWQISSEPLKSVPMNIIMSYMSGNSLQIIPIMTAVMLVSNPIKSILGV 133

Query: 121 RSAFKPVLG-NKATQSQVQTAMFMYIVFQGVLMYIGYRKLNSMGLIPNAKGDWLPWERIA 179
           +S F+ ++  +      V  AM MY+++Q +LM IG  KLNSMGL P    DWL W++  
Sbjct: 134 KSKFQHLINKDNDVTPPVVAAMIMYVIYQLILMGIGLHKLNSMGLFPTTSSDWLAWQQPT 193

Query: 180 HY 181
            Y
Sbjct: 194 EY 195

>Sklu_2433.13 YGL231C, Contig c2433 22436-22670 reverse complement
          Length = 79

 Score = 58.9 bits (141), Expect = 6e-12,   Method: Compositional matrix adjust.
 Identities = 32/77 (41%), Positives = 48/77 (62%), Gaps = 6/77 (7%)

Query: 5  EPYEWAKHLLDTKYIEKYNIQNSNTLPSPPGFEGNSSKGNVTRKQQDATSQTTSLAQKNQ 64
          +P +WA  L + K+ +   + +SNTLPSPPGF+   S+G+   K  +A       +++  
Sbjct: 4  QPPQWATDLCNPKHAKSLTVASSNTLPSPPGFKL-VSEGSSKNKNDNANK-----SKEKD 57

Query: 65 ITVLQVQKAWQIALQPA 81
          I  LQVQKAW++ALQPA
Sbjct: 58 INGLQVQKAWELALQPA 74

>KLLA0C16203g complement(1414169..1418533) weakly similar to
          sp|Q03214 Saccharomyces cerevisiae YMR176w ECM5
          involved in cell wall biogenesis and architecture
          singleton, start by similarity
          Length = 1454

 Score = 32.0 bits (71), Expect = 0.27,   Method: Composition-based stats.
 Identities = 15/34 (44%), Positives = 18/34 (52%)

Query: 30 LPSPPGFEGNSSKGNVTRKQQDATSQTTSLAQKN 63
          +P P  FE N SK  + RK  D  S +TS  Q N
Sbjct: 65 IPVPDQFENNHSKTTLPRKVIDGQSASTSFTQNN 98

>KLLA0F13420g 1240135..1244145 gi|3002789|gb|AAC39438.1
           Kluyveromyces lactis silent information regulator 4,
           start by similarity
          Length = 1336

 Score = 27.7 bits (60), Expect = 6.4,   Method: Composition-based stats.
 Identities = 12/54 (22%), Positives = 24/54 (44%)

Query: 21  KYNIQNSNTLPSPPGFEGNSSKGNVTRKQQDATSQTTSLAQKNQITVLQVQKAW 74
           + N+     L S PG     +   V R+ +   S+T+   + +++   QV+  W
Sbjct: 52  RQNMDTKQNLTSRPGSSSTPTTPQVYRRSKTVNSKTSRSEENSKVRTSQVRSGW 105

>YHR056C (RSC30) [2344] chr8 complement(215184..217835) Component of
           the abundant RSC chromatin remodeling complex [2652 bp,
           883 aa]
          Length = 883

 Score = 27.7 bits (60), Expect = 6.4,   Method: Compositional matrix adjust.
 Identities = 24/76 (31%), Positives = 35/76 (46%), Gaps = 8/76 (10%)

Query: 20  EKYNIQNSNTLPSPPGFEG-NSSKGNVTRKQQDATSQTTSLAQKNQ-----ITVLQVQKA 73
           EK N+   NT  +     G NS KG V  K+     QT+  +Q +Q     +T+  VQ  
Sbjct: 233 EKSNLNADNTTANKINKTGENSKKGKVDGKRAGFDHQTSRTSQSSQKYFTALTITDVQSL 292

Query: 74  WQIALQPAKSIPMNIF 89
            Q+  +P K  P  +F
Sbjct: 293 VQV--KPLKDTPNYLF 306

>Sklu_2275.4 YLL005C, Contig c2275 4812-7850
          Length = 1012

 Score = 27.7 bits (60), Expect = 6.8,   Method: Compositional matrix adjust.
 Identities = 31/106 (29%), Positives = 47/106 (44%), Gaps = 13/106 (12%)

Query: 81  AKSIPM----NIFMSYMSGTSLQIIPIMTALMLLSGPIKAIFSTRSAFKPVLGNKATQSQ 136
           AK IP+    N F S +SG    I+PI+T L+ L+  +  IF   S  K        +  
Sbjct: 647 AKLIPLFSWVNNFPSLLSGLVSSILPIVT-LVFLTEIVPFIFRWISLLKCKRTGSEIELD 705

Query: 137 VQTAMFMYIVFQGVLM--------YIGYRKLNSMGLIPNAKGDWLP 174
           VQ   F+++     L+         I  + +N+   IPN  G+ LP
Sbjct: 706 VQKWFFVFLFVHIFLVVTVSSGISVIVEKIVNNPVSIPNLLGNNLP 751

>YCL049C (YCL049C) [497] chr3 complement(39786..40724) Protein of
           unknown function, localizes to cytoplasm and present in
           membrane fractions [939 bp, 312 aa]
          Length = 312

 Score = 27.3 bits (59), Expect = 8.0,   Method: Compositional matrix adjust.
 Identities = 21/86 (24%), Positives = 38/86 (44%), Gaps = 9/86 (10%)

Query: 104 MTALMLLSG-----PIKAIFSTRSAFKPVLGNKATQSQVQTAMFMYIVFQGVLMYIGYRK 158
           + AL+LL G      +  +FST+  ++         + V +++  + V +GV M      
Sbjct: 25  LDALLLLPGVESHDGVDTVFSTKDFYQVSFVKSIAPAIVNSSVIFHDVSRGVAM----GN 80

Query: 159 LNSMGLIPNAKGDWLPWERIAHYNNG 184
           + S   I N +  +  WE+    NNG
Sbjct: 81  VKSRASIFNPEETYYDWEQYQVVNNG 106

  Database: blastdb
    Posted date:  Apr 3, 2006  3:33 PM
  Number of letters in database: 16,596,109
  Number of sequences in database:  34,618
  
Lambda     K      H
   0.317    0.130    0.388 

Gapped
Lambda     K      H
   0.267   0.0410    0.140 

Matrix: BLOSUM62
Gap Penalties: Existence: 11, Extension: 1
Number of Sequences: 34618
Number of Hits to DB: 5,871,584
Number of extensions: 217456
Number of successful extensions: 713
Number of sequences better than 10.0: 16
Number of HSP's gapped: 708
Number of HSP's successfully gapped: 16
Length of query: 188
Length of database: 16,596,109
Length adjustment: 96
Effective length of query: 92
Effective length of database: 13,272,781
Effective search space: 1221095852
Effective search space used: 1221095852
Neighboring words threshold: 11
Window for multiple hits: 40
X1: 16 ( 7.3 bits)
X2: 38 (14.6 bits)
X3: 64 (24.7 bits)
S1: 41 (21.7 bits)
S2: 58 (26.9 bits)