Hit NameLength (aa)HSP LengthHSP ScoreHSP Significance
YGL229C (SAP4)81880440010.0
Kwal_47.1919179077315210.0
Sklu_2433.1791472315000.0
YFR040W (SAP155)100275814820.0
AFR245W89973714700.0
CAGL0C02145g77771214500.0
Scas_687.1995681914530.0
Scas_712.2182885714150.0
KLLA0A01155g99363913201e-168
CAGL0L03586g11236138191e-94
KLLA0F14124g11005668059e-93
AFR089W10315977852e-90
Kwal_26.73467475257474e-87
Scas_711.22*10185927519e-86
YKR028W (SAP190)10986137312e-82
YJL098W (SAP185)10583425483e-58
Scas_675.365572062782e-25
KLLA0A06039g65785694.1
CAGL0H01595g42752684.4
KLLA0A02937g14355647.0
BLASTP 2.2.26 [Sep-21-2011]

Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, 
Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), 
"Gapped BLAST and PSI-BLAST: a new generation of protein database search
programs",  Nucleic Acids Res. 25:3389-3402.

Reference for compositional score matrix adjustment: Altschul, Stephen F., 
John C. Wootton, E. Michael Gertz, Richa Agarwala, Aleksandr Morgulis,
Alejandro A. Schaffer, and Yi-Kuo Yu (2005) "Protein database searches
using compositionally adjusted substitution matrices", FEBS J. 272:5101-5109.

Query= YGL229C
         (804 letters)

Database: blastdb 
           34,618 sequences; 16,596,109 total letters

Searching..................................................done

                                                                 Score    E
Sequences producing significant alignments:                      (bits) Value

YGL229C (SAP4) [1769] chr7 complement(64502..66958) Member of th...  1545   0.0  
Kwal_47.19191                                                         590   0.0  
Sklu_2433.17 YFR040W, Contig c2433 26349-29093 reverse complement     582   0.0  
YFR040W (SAP155) [1722] chr6 (234229..237237) Sit4p-associated p...   575   0.0  
AFR245W [3437] [Homologous to ScYFR040W (SAP155) - SH; ScYGL229C...   570   0.0  
CAGL0C02145g complement(216905..219238) similar to sp|P43612 Sac...   563   0.0  
Scas_687.19                                                           564   0.0  
Scas_712.21                                                           549   0.0  
KLLA0A01155g complement(104687..107668) some similarities with s...   513   e-168
CAGL0L03586g complement(408095..411466) similar to sp|P40856 Sac...   320   1e-94
KLLA0F14124g 1305690..1308992 similar to sp|P36123 Saccharomyces...   314   9e-93
AFR089W [3281] [Homologous to ScYKR028W (SAP190) - SH; ScYJL098W...   306   2e-90
Kwal_26.7346                                                          292   4e-87
Scas_711.22*                                                          293   9e-86
YKR028W (SAP190) [3283] chr11 (493900..497196) Protein that asso...   286   2e-82
YJL098W (SAP185) [2817] chr10 (241999..245175) Protein that asso...   215   3e-58
Scas_675.36                                                           111   2e-25
KLLA0A06039g 557368..559341 weakly similar to sp|P36023 Saccharo...    31   4.1  
CAGL0H01595g complement(155153..156436) similar to tr|Q04418 Sac...    31   4.4  
KLLA0A02937g 259865..260296 some similarities with sp|Q02205 Sac...    29   7.0  

>YGL229C (SAP4) [1769] chr7 complement(64502..66958) Member of the
           SAP family of proteins that associate with Sit4p [2457
           bp, 818 aa]
          Length = 818

 Score = 1545 bits (4001), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 761/804 (94%), Positives = 761/804 (94%)

Query: 1   MSLWPFGETLSHSGIDSILEEYYLIFRSLEGNETSSTDDKKNEPSMESESEFGTESRDRS 60
           MSLWPFGETLSHSGIDSILEEYYLIFRSLEGNETSSTDDKKNEPSMESESEFGTESRDRS
Sbjct: 1   MSLWPFGETLSHSGIDSILEEYYLIFRSLEGNETSSTDDKKNEPSMESESEFGTESRDRS 60

Query: 61  DLNQSFIDRILLETALLDELNGAANDRLVDFICLGYFYDDRSQQVRHMDYLVDMLMAYLK 120
           DLNQSFIDRILLETALLDELNGAANDRLVDFICLGYFYDDRSQQVRHMDYLVDMLMAYLK
Sbjct: 61  DLNQSFIDRILLETALLDELNGAANDRLVDFICLGYFYDDRSQQVRHMDYLVDMLMAYLK 120

Query: 121 DIDRTGYRTPFLLENSFHQTGEYEDQDDEDPMLYVNIISSIFCSKSAPIVEALVQNTPFL 180
           DIDRTGYRTPFLLENSFHQTGEYEDQDDEDPMLYVNIISSIFCSKSAPIVEALVQNTPFL
Sbjct: 121 DIDRTGYRTPFLLENSFHQTGEYEDQDDEDPMLYVNIISSIFCSKSAPIVEALVQNTPFL 180

Query: 181 SSLFEVFQFENIEAENCPILAVFLKINETLLFEQTSSYLEFFKSQPNIVDKFLYHIEVSP 240
           SSLFEVFQFENIEAENCPILAVFLKINETLLFEQTSSYLEFFKSQPNIVDKFLYHIEVSP
Sbjct: 181 SSLFEVFQFENIEAENCPILAVFLKINETLLFEQTSSYLEFFKSQPNIVDKFLYHIEVSP 240

Query: 241 LVEFLIKIMLTDQVESPTNIIDFLYHQDLIPKCLNLLENSKYSPGIQNSSGELLKALISI 300
           LVEFLIKIMLTDQVESPTNIIDFLYHQDLIPKCLNLLENSKYSPGIQNSSGELLKALISI
Sbjct: 241 LVEFLIKIMLTDQVESPTNIIDFLYHQDLIPKCLNLLENSKYSPGIQNSSGELLKALISI 300

Query: 301 STNFKLDTLWIGPNRLTRQLASPQYVDQLINIILFQRGHAMGVAVSIIIELIRKNNSDYD 360
           STNFKLDTLWIGPNRLTRQLASPQYVDQLINIILFQRGHAMGVAVSIIIELIRKNNSDYD
Sbjct: 301 STNFKLDTLWIGPNRLTRQLASPQYVDQLINIILFQRGHAMGVAVSIIIELIRKNNSDYD 360

Query: 361 EVDLLSTTIVDNPPSQRDPVYLGHLLYELTMHMEDFYALLIKLENXXXXXXXTASKALPS 420
           EVDLLSTTIVDNPPSQRDPVYLGHLLYELTMHMEDFYALLIKLEN       TASKALPS
Sbjct: 361 EVDLLSTTIVDNPPSQRDPVYLGHLLYELTMHMEDFYALLIKLENDDDDDHDTASKALPS 420

Query: 421 VKHHLLENQLHESFRPLGFERVKITELISEMLHCSNMGLMNSKRGEKIARTRDKCRDTLD 480
           VKHHLLENQLHESFRPLGFERVKITELISEMLHCSNMGLMNSKRGEKIARTRDKCRDTLD
Sbjct: 421 VKHHLLENQLHESFRPLGFERVKITELISEMLHCSNMGLMNSKRGEKIARTRDKCRDTLD 480

Query: 481 QNSLEKAMKNLNINDNTITSNTLEXXXXXXXXXXXXXXXXXXXXXXXXFHDNELYSTFXX 540
           QNSLEKAMKNLNINDNTITSNTLE                        FHDNELYSTF  
Sbjct: 481 QNSLEKAMKNLNINDNTITSNTLEDKCNNNDSNDSNDNQKQKKNIKKKFHDNELYSTFDT 540

Query: 541 XXXXXXXXXXMSFEIPYVSETQNLKIRKNPTIGDLFKIKLHDLGFFPKFLQLFLRYPWNN 600
                     MSFEIPYVSETQNLKIRKNPTIGDLFKIKLHDLGFFPKFLQLFLRYPWNN
Sbjct: 541 SDDNIDDDDDMSFEIPYVSETQNLKIRKNPTIGDLFKIKLHDLGFFPKFLQLFLRYPWNN 600

Query: 601 FWHNIVFDIIQQIFNGRMDFSYNSFLVYSLFDFKKSTRFIPKPLYGSNQKLPVKDFHIIS 660
           FWHNIVFDIIQQIFNGRMDFSYNSFLVYSLFDFKKSTRFIPKPLYGSNQKLPVKDFHIIS
Sbjct: 601 FWHNIVFDIIQQIFNGRMDFSYNSFLVYSLFDFKKSTRFIPKPLYGSNQKLPVKDFHIIS 660

Query: 661 DFILQGHKDSFEFYEKEKTNLGYMGQLVLIAEEIAKYSKIYKTDLIAPDIYAFLQDEVWM 720
           DFILQGHKDSFEFYEKEKTNLGYMGQLVLIAEEIAKYSKIYKTDLIAPDIYAFLQDEVWM
Sbjct: 661 DFILQGHKDSFEFYEKEKTNLGYMGQLVLIAEEIAKYSKIYKTDLIAPDIYAFLQDEVWM 720

Query: 721 SYSSDILNETRTMCSIILGGGQFCAESDENTNQDFLEKADMSKPAHPSTMDENEIVHEED 780
           SYSSDILNETRTMCSIILGGGQFCAESDENTNQDFLEKADMSKPAHPSTMDENEIVHEED
Sbjct: 721 SYSSDILNETRTMCSIILGGGQFCAESDENTNQDFLEKADMSKPAHPSTMDENEIVHEED 780

Query: 781 VKLHDKVAELIDELGQLTELDIHD 804
           VKLHDKVAELIDELGQLTELDIHD
Sbjct: 781 VKLHDKVAELIDELGQLTELDIHD 804

>Kwal_47.19191
          Length = 790

 Score =  590 bits (1521), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 330/773 (42%), Positives = 472/773 (61%), Gaps = 83/773 (10%)

Query: 1   MSLWPFGETLSHSGIDSILEEYYLIFRSLEGNETSSTD----------DKKNEPSMESES 50
           MS WPFG+   HS I+ +LEEY+ +  SLE  E +  +          ++++  S++   
Sbjct: 1   MSFWPFGQN-EHSNINRVLEEYFQVLHSLEKREETGEEIIRLEADEGEEEEDRGSVKVTQ 59

Query: 51  EFGTESRD----RSDLNQSFIDRILLETALLDELNGAANDRLVDFICLGYFYDDRSQQVR 106
           E G E  +     + L+  +ID IL E+ LL+EL    N  L+DF+C GYFY     +V+
Sbjct: 60  ETGPEGENVEGGTAALSSKYIDGILAESELLNELT-RQNSTLLDFVCFGYFYGADGGKVQ 118

Query: 107 HMDYLVDMLMAYLKDIDRTGYRTPFLLENSFHQTGEYED-----QDDEDPML-YVNIISS 160
           +++YL+D LMA    ++R G       +NS   T   ED     +D + P+L    IIS 
Sbjct: 119 NIEYLIDQLMAC---VERLGAAEAGQEQNSSASTPAAEDSVEGTEDPQQPVLNRATIISE 175

Query: 161 IFCSKSAPIVEALVQNTPFLSSLFEVFQFENIEAENCPILAVFLKINETLLFEQTSSYLE 220
           IF      I E+LV+N  +L+ ++ + + +N  +E   ++ +FLKIN+ LL  +   YL 
Sbjct: 176 IFALDIWLISESLVKNASYLNKIWSILKQQNFASEKSALIPIFLKINQNLLATRQDQYLN 235

Query: 221 FFKSQPNIVDKFLYHIEVSPLVEFLIKIMLTDQVESPTNIIDFLYHQDLIPKCLNLLENS 280
           F +S+  +VD  L HI++S L++FL+KI+ TD+ ESP+ II+ ++ Q L  K L+ L+N 
Sbjct: 236 FIRSKDTLVDDLLEHIQISVLMDFLLKIISTDKQESPSGIIELVHEQRLPNKLLSYLDND 295

Query: 281 KYSPGIQNSSGELLKALISISTNFKLDTLWIGPNRLTRQLASPQYVDQLINIILFQRGHA 340
           +Y P IQ  + +LLKA+++IS N  LD + IGPN LTR LAS   V  L++ I+ +RG+A
Sbjct: 296 RYEPDIQACAADLLKAIVAISANAPLDDMSIGPNSLTRHLASEDCVSFLLDTIIDKRGNA 355

Query: 341 MGVAVSIIIELIRKNNSDYDEVDLLSTTIVDNPPSQRDPVYLGHLLYELTMHMEDFYALL 400
           +  AVSI+IELIRKNNSDYD+V+LL+TT+  +PPS RDP+YLG +L   T  +   + +L
Sbjct: 356 LINAVSIVIELIRKNNSDYDQVNLLTTTLTSHPPSMRDPIYLGVMLKLFTERLPSIFQIL 415

Query: 401 IKLENXXXXXXXTASKALPSVKHHLLENQLHESFRPLGFERVKITELISEMLHCSNMGLM 460
             +E             L S     LENQL E ++PLGFER K+ ELI+E+LHCSNMGL+
Sbjct: 416 TDIE-------------LDSTTKE-LENQLGEKYKPLGFERFKVVELIAELLHCSNMGLL 461

Query: 461 NSKRGEKIARTRDKCRDTLDQNSLEKAMKNLNINDNTITSNTLEXXXXXXXXXXXXXXXX 520
           NSK+ E+I + R+  R  + +  L+ A+ +L++ DN   SN ++                
Sbjct: 462 NSKKAERIVKERNNARGAVVK-QLQDALADLDLQDNEYASNVVDNNGV------------ 508

Query: 521 XXXXXXXXFHDNELYSTFXXXXXXXXXXXXMSFEIPYVSETQNLKIRKNPTIGDLFKIKL 580
                     D E                  SF+IPYV+  QN K+R+NPTIGDLFKI L
Sbjct: 509 ----------DEE--------------DVDESFDIPYVNPNQNAKLRENPTIGDLFKITL 544

Query: 581 HDLGFFPKFLQLFLRYPWNNFWHNIVFDIIQQIFNGRMDFSYNSFLVYSLFDFKKSTRFI 640
           +D    P+ + LFL+YPWNNFWHN+VFDIIQQ+FNGRMDFSYNSFL+YSLF+   ++RF+
Sbjct: 545 YDNQIIPRIVHLFLQYPWNNFWHNVVFDIIQQLFNGRMDFSYNSFLIYSLFNNHAASRFM 604

Query: 641 PKPLYGSNQKLPVKDFHIISDFILQGHKDSFEFYEKEKTNLGYMGQLVLIAEEIAKYSKI 700
            +    +     V+DF I  D IL+G+K+S+ FYEK  T LG+MG LVLIAEEI K+SK+
Sbjct: 605 SEATAKT-----VRDFQITRDLILKGYKESYAFYEKHNTALGFMGHLVLIAEEIVKFSKV 659

Query: 701 YKTDLIAPDIYAFLQDEVWMSYSSDILNETRTMCSIILGGGQFCAESDENTNQ 753
           YK +LI+PDI A LQ++ W+ YS D+LN+TR M S ILGG  +    D NTN+
Sbjct: 660 YKVELISPDIQAVLQNDDWVFYSEDVLNDTRIMYSKILGGNDYL--EDGNTNE 710

>Sklu_2433.17 YFR040W, Contig c2433 26349-29093 reverse complement
          Length = 914

 Score =  582 bits (1500), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 327/723 (45%), Positives = 447/723 (61%), Gaps = 53/723 (7%)

Query: 62  LNQSFIDRILLETALLDELNGAANDRLVDFICLGYFYDDRSQQVRHMDYLVDMLMAYLKD 121
           LN SFID +L ET LL+EL    N+ L+DFIC GYFYD    +V +++YL+D LM  +  
Sbjct: 128 LNNSFIDNLLQETELLNELT-RQNNTLLDFICFGYFYDAYGTKVENIEYLIDQLMICIDK 186

Query: 122 IDRTGYRTPFLLENSFHQ------------------TGEYEDQDDEDPMLYVN---IISS 160
           I+      P   +    Q                  T   ++Q+++D   Y+N   IIS 
Sbjct: 187 INEHDDNEPDDKDLQVEQEDGPSTQTQPNDDSNDISTPSVDNQEEDDQSSYLNKATIISE 246

Query: 161 IFCSKSAPIVEALVQNTPFLSSLFEVFQFENIEAENCPILAVFLKINETLLFEQTSSYLE 220
           IF      I E+LV+N+ +L++++ +    N  +E  P++ +FLKIN+ LL  +   YL 
Sbjct: 247 IFSLDIWLISESLVKNSTYLATIWSILHHPNFSSEKSPLIPIFLKINQNLLLTRQDQYLN 306

Query: 221 FFKSQPNIVDKFLYHIEVSPLVEFLIKIMLTDQVESPTNIIDFLYHQDLIPKCLNLLENS 280
           F +++ N+V  FL HI +S L++F +K++ TD+ ESPT II+ +Y Q LI K LN L+N 
Sbjct: 307 FIRTRENLVGDFLKHIGISVLMDFFLKVISTDKQESPTGIIELVYEQGLISKLLNYLDNG 366

Query: 281 KYSPGIQNSSGELLKALISISTNFKLDTLWIGPNRLTRQLASPQYVDQLINIILFQRGHA 340
            Y   IQ  +G+ +KALI+IS N  LD + IGPN LTRQL S Q +D L+N I+ +RG A
Sbjct: 367 -YHADIQACAGDFIKALIAISANAPLDDMSIGPNSLTRQLCSEQCIDLLLNAIVNKRGAA 425

Query: 341 MGVAVSIIIELIRKNNSDYDEVDLLSTTIVDNPPSQRDPVYLGHLLYELTMHMEDFYALL 400
           +  AVSI+IELIRKNNSDYD+V+LL+TT+  +PPS RDP+YLG +L +  +++ +FY +L
Sbjct: 426 LTTAVSIVIELIRKNNSDYDQVNLLTTTVKTHPPSIRDPIYLGVMLKKFAVNLPEFYRIL 485

Query: 401 IKLENXXXXXXXTASKALPSVKHHLLENQLHESFRPLGFERVKITELISEMLHCSNMGLM 460
           + +EN            +P VK     NQL++ ++PLGFER K+ ELI+E+LHCSNMGLM
Sbjct: 486 LDVEN---------DDRIPLVK-----NQLNQEYKPLGFERFKVVELIAELLHCSNMGLM 531

Query: 461 NSKRGEKIARTRDKCRDTLDQNSLEKAMKNLNINDNTITSNTLEXXXXXXXXXXXXXXXX 520
           NSK+ E+I + RD+ R  L +  LE A+  L++ +     N                   
Sbjct: 532 NSKKAERIVKERDEVRQGLTK-QLEDALAELDMGEENDNINDANNNNSTTTTNNTITDNN 590

Query: 521 XXXXXXXXFHD------NELYSTFXXXXXXXXXXXXMSFEIPYVSETQNLKIRKNPTIGD 574
                    +D      NE  +               SFEIPYV+ +QN K+R NPT GD
Sbjct: 591 DTVTTSNENNDEVYEKVNEQNNKESPDDANDEEEIDESFEIPYVNPSQNAKLRLNPTTGD 650

Query: 575 LFKIKLHDLGFFPKFLQLFLRYPWNNFWHNIVFDIIQQIFNGRMDFSYNSFLVYSLFDFK 634
           LFKI L+D    PK ++LFLRYPWNNFWHN++FDIIQQIF+GRMDFSYNSFLVYSLF+ K
Sbjct: 651 LFKINLYDTQILPKIIELFLRYPWNNFWHNVLFDIIQQIFSGRMDFSYNSFLVYSLFNNK 710

Query: 635 KSTRFI--PKPLYGSNQKLPVKDFHIISDFILQGHKDSFEFYEKEKTNLGYMGQLVLIAE 692
            S +F+   KP +       V+DF I +D ILQG++DS +FYE  +TNLGYMG LVLIAE
Sbjct: 711 GSAQFMLTAKPTH-------VRDFRITADLILQGYRDSHDFYEVHETNLGYMGHLVLIAE 763

Query: 693 EIAKYSKIYKTDLIAPDIYAFLQDEVWMSYSSDILNETRTMCSIILGGGQFCAESDENTN 752
           EI K+SK+YK +LI+PDIY  LQDE W+ YS D+LN+TR M S ILGGG +  +  EN  
Sbjct: 764 EIVKFSKVYKVELISPDIYEVLQDEAWIFYSEDVLNDTRVMYSKILGGGDYMDDGGENAI 823

Query: 753 QDF 755
            D 
Sbjct: 824 HDL 826

 Score = 42.4 bits (98), Expect = 0.002,   Method: Compositional matrix adjust.
 Identities = 19/51 (37%), Positives = 30/51 (58%), Gaps = 3/51 (5%)

Query: 1  MSLWPFGETLSHSGIDSILEEYYLIFRSLEGNETSST---DDKKNEPSMES 48
          MS WPFG+ +++S I+ +L++Y+ + R LE     ST   DD K   +  S
Sbjct: 1  MSFWPFGQNINNSNINKLLDDYFHVLRDLEAQSKDSTGGVDDNKQSQTSAS 51

>YFR040W (SAP155) [1722] chr6 (234229..237237) Sit4p-associated
           protein [3009 bp, 1002 aa]
          Length = 1002

 Score =  575 bits (1482), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 320/758 (42%), Positives = 452/758 (59%), Gaps = 100/758 (13%)

Query: 61  DLNQSFIDRILLETALLDELNGAANDRLVDFICLGYFYDDRS-QQVRHMDYLVDMLMAYL 119
           +L+ SFI+R+L+ET LL+EL    N  L+DFIC G+F+D ++ ++V +M+YLVD LM  +
Sbjct: 136 NLDNSFIERMLVETELLNEL-SRQNKTLLDFICFGFFFDKKTNKKVNNMEYLVDQLMECI 194

Query: 120 KDIDRT---------GYRTPFLLENSFHQ-------TGEYEDQDDEDP------------ 151
             I             Y+    L++S  +       T + E+++D++             
Sbjct: 195 SKIKTATTVDLNNLIDYQEQQQLDDSSQEDVYVESDTEQEEEKEDDNNSNNKKRRKRGSS 254

Query: 152 ------------------------MLYVNIISSIFCSKSAPIVEALVQNTPFLSSLFEVF 187
                                   +    IIS IF      I E+LV+N  +L+ ++ + 
Sbjct: 255 SFGNDDINNNDDDDDANEDDESAYLTKATIISEIFSLDIWLISESLVKNQSYLNKIWSII 314

Query: 188 QFENIEAENCPILAVFLKINETLLFEQTSSYLEFFKSQPNIVDKFLYHIEVSPLVEFLIK 247
              N  +EN P++ +FLKIN+ LL  +   YL F +++ + VD  L H+++S L++F +K
Sbjct: 315 NQPNFNSENSPLVPIFLKINQNLLLTRQDQYLNFIRTERSFVDDMLKHVDISLLMDFFLK 374

Query: 248 IMLTDQVESPTNIIDFLYHQDLIPKCLNLLENSKYSPGIQNSSGELLKALISISTNFKLD 307
           I+ TD++ESPT II+ +Y Q+LI KCL+ L N +    IQ   G+ LKALI+IS N  LD
Sbjct: 375 IISTDKIESPTGIIELVYDQNLISKCLSFLNNKESPADIQACVGDFLKALIAISANAPLD 434

Query: 308 TLWIGPNRLTRQLASPQYVDQLINIILFQRGHAMGVAVSIIIELIRKNNSDYDEVDLLST 367
            + IGPN LTRQLASP+ + +L++I++ QRG A+   VSI+IELIRKNNSDYD+V+LL+T
Sbjct: 435 DISIGPNSLTRQLASPESIAKLVDIMINQRGAALNTTVSIVIELIRKNNSDYDQVNLLTT 494

Query: 368 TIVDNPPSQRDPVYLGHLLYELTMHMEDFYALLIKLENXXXXXXXTASKALPSVKHHLLE 427
           TI  +PPS RDP+YLG+LL + + H+ DF+ +++ +EN            +P     L E
Sbjct: 495 TIKTHPPSNRDPIYLGYLLRKFSNHLSDFFQIILDIEN---------DANIP-----LHE 540

Query: 428 NQLHESFRPLGFERVKITELISEMLHCSNMGLMNSKRGEKIARTRDKCRDTLDQNSLEKA 487
           NQLHE F+PLGFER K+ ELI+E+LHCSNMGLMNSKR E+IAR RDK R  L  + L+ A
Sbjct: 541 NQLHEKFKPLGFERFKVVELIAELLHCSNMGLMNSKRAERIARRRDKVRSQLSHH-LQDA 599

Query: 488 MKNLNIND----NTITSNTLEXXXXXXXXXXXXXXXXXXXXXXXXFHDNELYSTFXXXXX 543
           + +L+I +     T  S T +                        + D            
Sbjct: 600 LNDLSIEEKEQLKTKHSPTRDTDHDLKNNNGKIDNDNNDNDDESDYGD------------ 647

Query: 544 XXXXXXXMSFEIPYVSETQNLKIRKNPTIGDLFKIKLHDLGFFPKFLQLFLRYPWNNFWH 603
                   SFEIPY++  Q +K+R +PT+GDLFKIKL+D     K ++LFL +PWNNFWH
Sbjct: 648 ----EIDESFEIPYINMKQTIKLRTDPTVGDLFKIKLYDTRIVSKIMELFLTHPWNNFWH 703

Query: 604 NIVFDIIQQIFNGRMDFSYNSFLVYSLFDFKKSTRFIPKPLYGSNQKLPVK--------- 654
           N++FDIIQQIFNGRMDFSYNSFLV SLF+ K S +F+   +    +   V          
Sbjct: 704 NVIFDIIQQIFNGRMDFSYNSFLVLSLFNLKSSYQFMTDIVISDEKGTDVSRFSPVIRDP 763

Query: 655 --DFHIISDFILQGHKDSFEFYEKEKTNLGYMGQLVLIAEEIAKYSKIYKTDLIAPDIYA 712
             DF I +DFIL+G++DS++FYE  K NLGYMG +VLIAEE+ K+SK+YK +LI+PDI  
Sbjct: 764 NFDFKITTDFILRGYQDSYKFYELRKMNLGYMGHIVLIAEEVVKFSKLYKVELISPDIQV 823

Query: 713 FLQDEVWMSYSSDILNETRTMCSIILGGGQFCAESDEN 750
            LQ E W  YS ++LNETR M S ILGGG +  + + N
Sbjct: 824 ILQTEEWQYYSEEVLNETRMMYSKILGGGSYIDDGNGN 861

 Score = 42.7 bits (99), Expect = 0.001,   Method: Compositional matrix adjust.
 Identities = 16/30 (53%), Positives = 22/30 (73%)

Query: 1  MSLWPFGETLSHSGIDSILEEYYLIFRSLE 30
          MS WPFG+ L+HS I+ IL+EY+ +   LE
Sbjct: 1  MSFWPFGQNLNHSNINKILDEYFHVLHELE 30

>AFR245W [3437] [Homologous to ScYFR040W (SAP155) - SH; ScYGL229C
           (SAP4) - SH] complement(880258..882957) [2700 bp, 899
           aa]
          Length = 899

 Score =  570 bits (1470), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 324/737 (43%), Positives = 444/737 (60%), Gaps = 82/737 (11%)

Query: 62  LNQSFIDRILLETALLDELNGAANDRLVDFICLGYFYDDRSQQVRHMDYLVDMLMAYL-- 119
           LN SFID IL E+ LL+EL    N+ L+DF+C G+FYD    ++ +++YL+D LM  +  
Sbjct: 131 LNYSFIDSILKESELLNELT-RQNNTLLDFVCFGFFYDTDGNKIDNIEYLIDQLMFCIDR 189

Query: 120 -----KDIDRTGYRTP-FLLENSFH-------QTGEYEDQDDE----------------D 150
                K+ D T  RTP    EN  H       Q G  E QD E                D
Sbjct: 190 VNEEQKENDET--RTPGHEQENEQHDDFLPPQQAGFLEGQDSEFIKRAVFPEPPSHEGDD 247

Query: 151 PML----------------YVNIISSIFCSKSAPIVEALVQNTPFLSSLFEVFQFENIEA 194
            +L                 VN IS IF      I E+LV++   LS ++ V   ++ +A
Sbjct: 248 AILPFLHGRRDTRQSSLLNRVNTISEIFALDIWLISESLVKDPSHLSKIWSVLNHKDFKA 307

Query: 195 ENCPILAVFLKINETLLFEQTSSYLEFFKSQPNIVDKFLYHIEVSPLVEFLIKIMLTDQV 254
           E  P++ +FLKIN+ LL  +    L F +++ ++VD+FL H+E+S L++F +KI+ TD+ 
Sbjct: 308 EKSPLVPIFLKINQNLLLTRQDQLLNFIRARESLVDEFLQHLEISVLMDFFLKIISTDKQ 367

Query: 255 ESPTNIIDFLYHQDLIPKCLNLLENSKYSPGIQNSSGELLKALISISTNFKLDTLWIGPN 314
           ESPT II+ +Y Q LIPK L+ L+N KYS  IQ  +G+L+KALISISTN  LD L IGPN
Sbjct: 368 ESPTGIIELVYDQGLIPKMLSFLDNHKYSADIQACAGDLMKALISISTNAPLDELSIGPN 427

Query: 315 RLTRQLASPQYVDQLINIILFQRGHAMGVAVSIIIELIRKNNSDYDEVDLLSTTIVDNPP 374
            LTRQL S + +D  ++ I+ +RGHA+  AVS++IELIRKNNSDYD+++LL T++  +PP
Sbjct: 428 ALTRQLCSEESIDCFLDAIINKRGHALTTAVSVVIELIRKNNSDYDQINLLCTSVKTHPP 487

Query: 375 SQRDPVYLGHLLYELTMHMEDFYALLIKLENXXXXXXXTASKALPSVKHHLLENQLHESF 434
           S RDP+YLG +L +    + +F  +L+++EN              S+K   + NQL   +
Sbjct: 488 STRDPIYLGRMLKKFAEKLPNFKRVLLEIENDG------------SIKD--IRNQLGIEY 533

Query: 435 RPLGFERVKITELISEMLHCSNMGLMNSKRGEKIARTRDKCRDTLDQNSLEKAMKNLNIN 494
           +PLGFER KI ELI+E+LHCSNMGLMNSK+ E+I + RD+ R+ + +  L+ A+  LN+N
Sbjct: 534 KPLGFERFKIVELIAELLHCSNMGLMNSKKAERIVKERDEVRNHMVK-QLQDALTELNMN 592

Query: 495 DNTITSNTLEXXXXXXXXXXXXXXXXXXXXXXXXFHDNELYSTFXXXXXXXXXXXXMSFE 554
           D    +   E                          +  + +               SFE
Sbjct: 593 DGNDRTKGDEKGLTGLCAT-----------------NTSMSTQTTAVNDNADEEIDESFE 635

Query: 555 IPYVSETQNLKIRKNPTIGDLFKIKLHDLGFFPKFLQLFLRYPWNNFWHNIVFDIIQQIF 614
           IPY++  QN K+  NPTIGDLFKI+L+D    PK +QLF+ +PWNNFWHN+VFDIIQQIF
Sbjct: 636 IPYLNMNQNSKLPHNPTIGDLFKIQLYDTQLLPKIIQLFIEHPWNNFWHNVVFDIIQQIF 695

Query: 615 NGRMDFSYNSFLVYSLFDFKKSTRFIPKPLYGSNQKLPVKDFHIISDFILQGHKDSFEFY 674
           NGRMDFSYNSFLVYSLF+ K + +F+       N+     DF I  D +LQG+K+S  FY
Sbjct: 696 NGRMDFSYNSFLVYSLFNNKDAGQFVIDVKPEENRAQDFTDFAITRDLVLQGYKNSHAFY 755

Query: 675 EKEKTNLGYMGQLVLIAEEIAKYSKIYKTDLIAPDIYAFLQDEVWMSYSSDILNETRTMC 734
           E+  TNLGYMG LVLIAEEI K+SK+YK +LI+PDI+  LQD  W+ YS D LN+TR M 
Sbjct: 756 EQYNTNLGYMGHLVLIAEEIVKFSKVYKVELISPDIHRVLQDPDWIFYSEDALNDTRMMY 815

Query: 735 SIILGGGQFCAESDENT 751
           S ILGG ++  E +  T
Sbjct: 816 SKILGGSEYLGEENGCT 832

 Score = 39.3 bits (90), Expect = 0.013,   Method: Compositional matrix adjust.
 Identities = 14/41 (34%), Positives = 28/41 (68%)

Query: 1  MSLWPFGETLSHSGIDSILEEYYLIFRSLEGNETSSTDDKK 41
          MS WPFG+ +++S I+ IL++Y+ +  SLE +    + +++
Sbjct: 1  MSFWPFGQNVNNSNINRILDDYFRVLHSLEEDGAGESGERE 41

>CAGL0C02145g complement(216905..219238) similar to sp|P43612
           Saccharomyces cerevisiae YFR040w SAP155 SIT4P-associated
           protein, hypothetical start
          Length = 777

 Score =  563 bits (1450), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 307/712 (43%), Positives = 443/712 (62%), Gaps = 45/712 (6%)

Query: 53  GTESRDRSDLNQSFIDRILLETALLDELNGAANDRLVDFICLGYFY-DDRSQQVRHMDYL 111
           G E+  R  L+ SFIDR+L E  LL+EL  A N  L+DFIC G+F+ ++  ++V ++DYL
Sbjct: 17  GEETEQR--LDSSFIDRMLKEGELLNEL-AAQNKGLIDFICFGFFFKENEKERVENIDYL 73

Query: 112 VDMLM----------AYLKDIDRTGYRTPFLLENSFHQTGEYEDQDDEDPMLYVNIISSI 161
           +D L+          A   ++ R        +E  F++  E   +D+++ +   N+I+ I
Sbjct: 74  LDQLLFCVDQFKMVEADTVNVTRENSPADEGIEMDFNKVIEDNAEDEDEYLSRANLIAEI 133

Query: 162 FCSKSAPIVEALVQNTPFLSSLFEVFQFENIEAENCPILAVFLKINETLLFEQTSSYLEF 221
           F      I E+LV+N   LS ++ +    N + E  P++ +FLK+N+ LL  +   YL F
Sbjct: 134 FSLDIWLITESLVKNKEHLSKIWNLLHNPNFKFERSPLIPIFLKMNQNLLITRQDQYLNF 193

Query: 222 FKSQPNIVDKFLYHIEVSPLVEFLIKIMLTDQVESPTNIIDFLYHQDLIPKCLNLLENSK 281
            +SQ ++VD  L HI+++ L++F +K++ TD++ESPT +I+ +  Q LI K L  L N+ 
Sbjct: 194 IRSQSSLVDDMLMHIDIALLMDFFLKLISTDKIESPTGVIELVSDQKLIDKLLKFLNNNL 253

Query: 282 YSPGIQNSSGELLKALISISTNFKLDTLWIGPNRLTRQLASPQYVDQLINIILFQRGHAM 341
           YS  IQ    + LKALI IS N  LD L IGPN LTR+LASP+ +D++I I+L +RG A+
Sbjct: 254 YSADIQACVCDFLKALIVISANAPLDELSIGPNSLTRRLASPKSIDKMIKIVLNERGAAL 313

Query: 342 GVAVSIIIELIRKNNSDYDEVDLLSTTIVDNPPSQRDPVYLGHLLYELTMHMEDFYALLI 401
              +SI+IELIRKNNSDYD+V+LL TT+  +PPS RDP++LG+LL     ++   + ++ 
Sbjct: 314 NSTISIVIELIRKNNSDYDQVNLLDTTLETHPPSDRDPIFLGYLLRRFAANLPKLFEIID 373

Query: 402 KLENXXXXXXXTASKALPSVKHHLLENQLHESFRPLGFERVKITELISEMLHCSNMGLMN 461
            + +              +    LL NQ++E F P+GFER KI ELI+E+LHCSNMGL+N
Sbjct: 374 DIYDNN-----------DTNDDMLLTNQMNEKFIPIGFERFKIVELIAELLHCSNMGLLN 422

Query: 462 SKRGEKIARTRDKCRDTLDQNSLEKAMKNLNIN---DNTITSNTLEXXXXXXXXXXXXXX 518
           +KR E+IAR RDK R  +    L+ A+ +L IN   DN   S+T +              
Sbjct: 423 TKRAERIARVRDKVRKQV-SFQLQDALNDLTINPSVDNKRKSDTAQQNDKHDAFDGIQ-- 479

Query: 519 XXXXXXXXXXFHDNELYSTFXXXXXXXXXXXXMSFEIPYVSETQNLKIRKNPTIGDLFKI 578
                       +NE +  F             +FEIPY++E QN K+R NPTIGDLFKI
Sbjct: 480 -----------SENESHDEFEHINQDENDEIDETFEIPYINENQNSKLRTNPTIGDLFKI 528

Query: 579 KLHDLGFFPKFLQLFLRYPWNNFWHNIVFDIIQQIFNGRMDFSYNSFLVYSLFDFKKSTR 638
           KL+D    PK ++LFL +PWNNFWHN++FDIIQQIFNGRMDFSYNSFLV+SLF+ + S +
Sbjct: 529 KLYDCQIIPKIMKLFLNHPWNNFWHNVIFDIIQQIFNGRMDFSYNSFLVFSLFNLEGSFQ 588

Query: 639 FIPKPLYGSNQKLPVKDFHIISDFILQGHKDSFEFYEKEKTNLGYMGQLVLIAEEIAKYS 698
           ++      + +   +KDF I  DFIL+G+  S++FYE++ TNLG+MG LVLIAEE+ K+S
Sbjct: 589 YMDSE---AAKDAKLKDFSITKDFILEGYHKSYKFYEEKNTNLGFMGHLVLIAEEVVKFS 645

Query: 699 KIYKTDLIAPDIYAFLQDEVWMSYSSDILNETRTMCSIILGGGQFCAESDEN 750
           K+YK +LI+ DI   LQ++ W  YS ++LN TR M S ILGGG F  +++ N
Sbjct: 646 KLYKVELISTDIQDSLQEDDWQYYSEEVLNRTRLMYSKILGGGNFVEDANGN 697

>Scas_687.19
          Length = 956

 Score =  564 bits (1453), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 328/819 (40%), Positives = 488/819 (59%), Gaps = 75/819 (9%)

Query: 33  ETSSTDDKKNEPSMESESEFGTESRDRSDLNQSFIDRILLETALLDELNGAANDRLVDFI 92
           E SS  D  +E   E+ +      ++   L+ SF+DR+++++  L+EL    N  L+DFI
Sbjct: 107 ENSSATDLNSEDISETTTPLNVSIKN---LDNSFVDRLIIDSEFLNELT-RQNSTLLDFI 162

Query: 93  CLGYFYDD-RSQQVRHMDYLVDMLMAYLKDIDRTGYRTPFLLENSFHQTGEYEDQDDED- 150
           C G+F+D    ++V+++DYL+D L+AY+ +I     +T    E   + T E +  ++E  
Sbjct: 163 CYGFFFDPITKEKVQNLDYLIDSLLAYVDEIPMEIAKTEKKEEVKIYATDEEKQTEEEQA 222

Query: 151 -------------PMLYVNIISSIFCSKSAPIVEALVQNTPFLSSLFEVFQFENIEAENC 197
                         +    IIS         + +AL++N  +LS L+ + + + +++E+ 
Sbjct: 223 EAANEELANEVPTSLSKATIISEALALDLWMLTDALIKNESYLSKLWSIIRHDGLDSESS 282

Query: 198 PILAVFLKINETLLFEQTSSYLEFFKSQPNIVDKFLYHIEVSPLVEFLIKIMLTDQVESP 257
            ++++FLKIN+ LLF +T +Y+ F  + PN+VD+ L HI+VS +++F +KI+ TD++ESP
Sbjct: 283 SLVSIFLKINQNLLFSRTENYIAFICTNPNLVDEILDHIDVSMIMDFFLKIIATDRIESP 342

Query: 258 TNIIDFLYHQDLIPKCLNLLENSKYSPGIQNSSGELLKALISISTNFKLDTLWIGPNRLT 317
           T +I  +  Q LI K L  L+N+KYS  +Q+ SG+ LKALI IS N  +D + IGPN LT
Sbjct: 343 TGVIQLVCDQKLIYKSLQFLDNTKYSSDVQSCSGDFLKALIGISANAPIDDIAIGPNSLT 402

Query: 318 RQLASPQYVDQLINIILFQRGHAMGVAVSIIIELIRKNNSDYDEVDLLSTTIVDNPPSQR 377
           R+LAS + +D LI+IIL +RG+A+  AVSI+IELIRKNNSDYD+V+LL TTI+DNPP  R
Sbjct: 403 RELASNEAIDILIDIILNKRGYALDTAVSIVIELIRKNNSDYDQVNLLETTIIDNPPIDR 462

Query: 378 DPVYLGHLLYELTMHMEDFYALLIKLENXXXXXXXTASKALPSVKHHLLENQLHESFRPL 437
           DP+YLG+LL + ++++ +F  +++ +E            ++P     L ENQLHE F+PL
Sbjct: 463 DPIYLGYLLKKFSINLPNFLKIIVDIE---------TDDSIP-----LRENQLHEKFKPL 508

Query: 438 GFERVKITELISEMLHCSNMGLMNSKRGEKIARTRDKCRDTLDQNSLEKAMKNLNIND-N 496
           GFER KI ELI+E+LHCSNMGLMNS++ EKIA  RDK R   +   +   + NL+I D N
Sbjct: 509 GFERFKIVELIAELLHCSNMGLMNSRKAEKIALKRDKYRKRANSYDVHHTLSNLSIRDKN 568

Query: 497 TIT------SNTLEXXXXXXXXXXXXXXXXXXXXXXXXFHDNELYSTFXXXXXXXXXXXX 550
           +IT      SN L+                         +D  + ++             
Sbjct: 569 SITTLTGSDSNDLKSNNDNSNDFNENDDTKAVKKPKTN-NDPNINTSINASEEQEEVNEE 627

Query: 551 MSFEIPYVSET---------QNLKIRKNPTIGDLFKIKLHDLGFFPKFLQLFLRYPWNNF 601
               I  + E+         QN+K+R+ PT+GDLFKI L+D    P+ ++LFL +PWNNF
Sbjct: 628 SDSSIEEIDESFEIPYINESQNMKLREYPTMGDLFKISLYDTQVMPQIMKLFLAHPWNNF 687

Query: 602 WHNIVFDIIQQIFNGRMDFSYNSFLVYSLFDFKKSTRFIPKPLYGSNQKLPVKDFHIISD 661
           WHN++FDIIQQIFNGRMDFSYNSFLVYSLF+ K S +++P  +    + +   +F I +D
Sbjct: 688 WHNVIFDIIQQIFNGRMDFSYNSFLVYSLFNLKGSLQYMPPDVIAGIENIEDVNFAITTD 747

Query: 662 FILQGHKDSFEFYEKEKTNLGYMGQLVLIAEEIAKYSKIYKTDLIAPDIYAFLQDEVWMS 721
           FIL+G+ DSF+FYE  KTNLGYMG LVL+AEEI K+S++YK +LI+PDI     D+ W  
Sbjct: 748 FILKGYHDSFKFYETRKTNLGYMGHLVLVAEEIIKFSRLYKVELISPDIQEATVDKDWRY 807

Query: 722 YSSDILNETRTMCSIILGGGQFC------------------------AESDENTNQDFLE 757
           YS+D+LNETR M S ILGGG +                         +  D+  N +F E
Sbjct: 808 YSNDVLNETRIMYSKILGGGTYVDDGNGNIVPQLATDGTPEENMGIPSSDDQEFNTNFQE 867

Query: 758 KADMSKPAHPSTMDENEIVHEEDVKLHDKVAELIDELGQ 796
             D  +  +   ++E  ++  E   LH+K+ E++   GQ
Sbjct: 868 MKDGGELINVEALEEQLMLSTES-DLHNKLREMLASQGQ 905

 Score = 43.5 bits (101), Expect = 7e-04,   Method: Compositional matrix adjust.
 Identities = 17/30 (56%), Positives = 23/30 (76%)

Query: 1  MSLWPFGETLSHSGIDSILEEYYLIFRSLE 30
          MS WPFG+ L+HS I+ IL+EY+ I  +LE
Sbjct: 1  MSFWPFGQNLNHSDINKILDEYFQILHTLE 30

>Scas_712.21
          Length = 828

 Score =  549 bits (1415), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 340/857 (39%), Positives = 484/857 (56%), Gaps = 101/857 (11%)

Query: 1   MSLWPFGETLSHSGIDSILEEYYLIFRSLEGNETSSTDDK-----------------KNE 43
           MS WPF +  S S +  IL+EY+ I  SL        DD                  K +
Sbjct: 1   MSFWPFPQD-STSNVSKILDEYFDILNSLRKANLIEDDDNDVPLRGEEQIHDSYGSSKFQ 59

Query: 44  P-----------------SMESESEFGTESRDRSD-------LNQSFIDRILLETALLDE 79
           P                 S ES  +  TES+  +D       L+ SFI+RIL E  L+DE
Sbjct: 60  PRKHKHRTRKRKRKLAVTSEESSCDRDTESKKSNDVVVSKVSLDNSFIERILDELDLMDE 119

Query: 80  LNGAANDRLVDFICLGYFYDDRSQQVRHMDYLVDMLMA---YLKDIDRTGYRTPFLLENS 136
           L G  N+ L+DF+C GYF+D  S+++ +M YL+D L++   YL +   T        +N 
Sbjct: 120 L-GKKNNVLLDFLCFGYFFDSDSKKIMNMQYLIDQLISCVQYLTNASITSVDEDKANDNM 178

Query: 137 FHQTGEYEDQDDEDPMLYVNIISSIFCSKSAPIVEALVQNTPFLSSLFEVFQFENIEAEN 196
             Q G        + +    IIS+I       I E+L++N  +L+ ++ V     +E E+
Sbjct: 179 RSQEGP-------NFLHKATIISNILSFDEWLISESLIKNMNYLNEIWSVLSNVKLETED 231

Query: 197 CPILAVFLKINETLLFEQTSSYLEFFKSQPNIVDKFLYHIEVSPLVEFLIKIMLTDQVES 256
            P+L +FLK+NE+LL  +   YL F +++  +VD+F  H+ +  L++FL+K++ TD+ + 
Sbjct: 232 SPLLPIFLKVNESLLLSRKDQYLNFIRTRKTLVDEFFKHMNIPVLLDFLLKLIATDKPDY 291

Query: 257 PTNIIDFLYHQDLIPKCLNLLENSKYSPGIQNSSGELLKALISISTNFKLDTLWIGPNRL 316
           PT II+ L  Q +I KCL   +N +YS  +Q  + + LKALI IS N  LD + +GPN L
Sbjct: 292 PTGIIELLDDQRVIQKCLKFFKNDQYSADVQACASDFLKALIGISANVPLDEMSVGPNLL 351

Query: 317 TRQLASPQYVDQLINIILFQRGHAMGVAVSIIIELIRKNNSDYDEVDLLSTTIVDNPPSQ 376
           +R LASP  VD LINIIL + G A+   +S++IELIRKNNSDYDE++LL TT   + PS 
Sbjct: 352 SRALASPDVVDHLINIILNENGTALNHTISVVIELIRKNNSDYDEINLLETTTRSHLPSN 411

Query: 377 RDPVYLGHLLYELTMHMEDFYALLIKLENXXXXXXXTASKALPSVKHHLLENQLHESFRP 436
           RDP+YLG+LL + +  +E+ +AL+  +             A  ++   +  NQ+++ F+P
Sbjct: 412 RDPIYLGYLLKKFSDKIENIFALVDDM-------------ADKTIMKRIRINQINQEFQP 458

Query: 437 LGFERVKITELISEMLHCSNMGLMNSKRGEKIARTRDKCRDTLDQNSLEKAMKNLN---- 492
           LGFER+KI ELI+E+LHCSNMGLMNSKR E IA  RD  R  L  + L+ A+++L     
Sbjct: 459 LGFERIKIVELIAELLHCSNMGLMNSKRAEHIALKRDHLRLQL-PHQLQDALQDLEINKT 517

Query: 493 -----INDNTITSNTLEXXXXXXXXXXXXXXXXXXXXXXXXFHDNELYSTFXXXXXXXXX 547
                I+DN   +N L                            +               
Sbjct: 518 EHSDIISDNNSINNDLTTGSVTDEDEDVLIENVSEHPERSFIDSDSDDDLDTIDVAEIDD 577

Query: 548 XXXMSFEIPYVSETQNLKIRKNPTIGDLFKIKLHDLGFFPKFLQLFLRYPWNNFWHNIVF 607
               SFEIPY++E QN K+R  PTIGD FKI L+D     K L LFL+ PWNNFWHN++F
Sbjct: 578 ----SFEIPYINEKQNSKLRNGPTIGDRFKINLYDNQIIIKILILFLKNPWNNFWHNVIF 633

Query: 608 DIIQQIFNGRMDFSYNSFLVYSLFDFKKSTRFIPKPLYG-SNQKLPVKDFHIISDFILQG 666
           DIIQQ+FNGRMDFSYNSF+VYSLF+ +K+++F        SN ++ + +F+I  DFIL G
Sbjct: 634 DIIQQLFNGRMDFSYNSFIVYSLFNLEKASQFKKTDSNANSNNQILLGNFNITKDFILLG 693

Query: 667 HKDSFEFYEKEKTNLGYMGQLVLIAEEIAKYSKIYKTDLIAPDIYAFLQDEVWMSYSSDI 726
           ++ S+EFYEK KTNLGYMG LVLIAEE+ K+SK+YK +LI+PDI   LQ++ W+ Y  ++
Sbjct: 694 YQKSYEFYEKWKTNLGYMGHLVLIAEEVVKFSKLYKVELISPDIQKILQEKEWIFYMDEV 753

Query: 727 LNETRTMCSIILGGGQFCAESDENTNQDFLEKADMSKPAHPSTMDENEIVHEEDVKLHDK 786
           L+ TR M S ILGGG F  + + N    F+E +D                +EE ++ +D+
Sbjct: 754 LHSTRIMYSKILGGGSFVDDGNGNVVPQFIESSD---------------PYEEHLETNDE 798

Query: 787 VAELIDELGQLTELDIH 803
            +E +     LTELDIH
Sbjct: 799 TSESL-----LTELDIH 810

>KLLA0A01155g complement(104687..107668) some similarities with
           sp|P43612 Saccharomyces cerevisiae YFR040w SAP155
           SIT4P-associated protein, hypothetical start
          Length = 993

 Score =  513 bits (1320), Expect = e-168,   Method: Compositional matrix adjust.
 Identities = 280/639 (43%), Positives = 391/639 (61%), Gaps = 56/639 (8%)

Query: 155 VNIISSIFCSKSAPIVEALVQNTPFLSSLFEVFQFENIEAENCPILAVFLKINETLLFEQ 214
            NIIS IF      I E+LV+NT +L+ ++ +        E  P++ +FLKIN+ LL  +
Sbjct: 397 ANIISEIFALDIWLISESLVKNTEYLNKIWSILYHPKFTQEKSPLIPIFLKINQNLLLTR 456

Query: 215 TSSYLEFFKSQPNIVDKFLYHIEVSPLVEFLIKIMLTDQVESPTNIIDFLYHQDLIPKCL 274
              YL F +++ N+V   L HI++S L++F +KI+ TD+ E+PT II+ +  Q LI    
Sbjct: 457 QDQYLNFIRTRDNLVIDMLKHIDISLLMDFFLKIVATDKQEAPTGIIELVSEQKLIDHLF 516

Query: 275 NLLENSKYSPGIQNSSGELLKALISISTNFKLDTLWIGPNRLTRQLASPQYVDQLINIIL 334
             L N KYS  IQ  +G+ +K++I++S N  LD + IGPN LTR++AS + +D L+  I+
Sbjct: 517 AFLVNEKYSADIQACAGDFIKSIIAVSANAPLDEMSIGPNALTREIASEKCIDYLLGCII 576

Query: 335 FQRGHAMGVAVSIIIELIRKNNSDYDEVDLLSTTIVDNPPSQRDPVYLGHLLYELTMHME 394
            +RG A+  AVSI IELIRKNNSDYD+V+LL+TTI  +PPS RDPVYLG +L + + ++ 
Sbjct: 577 NERGPALMTAVSITIELIRKNNSDYDQVNLLTTTIKSHPPSMRDPVYLGVMLRKFSENLV 636

Query: 395 DFYALLIKLENXXXXXXXTASKALPSVKHHLLENQLHESFRPLGFERVKITELISEMLHC 454
           +   +L  +EN           ++P +K     NQ+ ES++PLGFER K+ ELI+E+LHC
Sbjct: 637 NLKQILFDIEN---------DASIPIIK-----NQMGESYKPLGFERFKVVELIAELLHC 682

Query: 455 SNMGLMNSKRGEKIARTRDKCRDTLDQNSLEKAMKNLNINDNTITSNTLEXXXXXXXXXX 514
           SNMGLMNSK+ E+I + RD+ R  L Q  LE A+ +LNI       N             
Sbjct: 683 SNMGLMNSKKAERIVKERDQVRTELVQ-QLEDALTDLNIKSKLTADN------------- 728

Query: 515 XXXXXXXXXXXXXXFHDNELYSTFXXXXXXXXXXXXMSFEIPYVSETQNLKIRKNPTIGD 574
                               +++              SFE+PYV++ QN K+R NPTIGD
Sbjct: 729 --------------------HNSDSPTELSLDDDIDESFEVPYVNDNQNAKLRSNPTIGD 768

Query: 575 LFKIKLHDLGFFPKFLQLFLRYPWNNFWHNIVFDIIQQIFNGRMDFSYNSFLVYSLFDFK 634
           LFKI+L++    P  +QLF++YPWNNFWHN++FDIIQQIFNGRMDFSYNSFLVY+LF  K
Sbjct: 769 LFKIELYNSQLLPIIIQLFIKYPWNNFWHNVIFDIIQQIFNGRMDFSYNSFLVYALFSNK 828

Query: 635 KSTRFIPKPLYGSNQKLPVKDFHIISDFILQGHKDSFEFYEKEKTNLGYMGQLVLIAEEI 694
            + RF            P+ DF I  D +L G+++S +FYEK  T LG+MG LVLIAEEI
Sbjct: 829 NAERFATDKTL---DDAPI-DFQITRDLVLLGYRNSHKFYEKHNTTLGFMGHLVLIAEEI 884

Query: 695 AKYSKIYKTDLIAPDIYAFLQDEVWMSYSSDILNETRTMCSIILGGGQFCAESDENTNQD 754
            K+SK+YK DLI+PDI+  L DE W  YS+DILN+TR M S ILGGG +  + + N   D
Sbjct: 885 VKFSKVYKVDLISPDIHEVLLDEDWDFYSNDILNDTRIMYSKILGGGDYIEDGNLNGG-D 943

Query: 755 FLEKADMSKPAHPSTMDENEIVHEEDVKLHDKVAELIDE 793
            +   D    +  + MD ++ + E   KL +K  + +DE
Sbjct: 944 IVMGNDQDPTSFSTQMDLHDKLRE---KLIEKSRQEVDE 979

 Score = 41.2 bits (95), Expect = 0.003,   Method: Compositional matrix adjust.
 Identities = 16/39 (41%), Positives = 26/39 (66%)

Query: 85  NDRLVDFICLGYFYDDRSQQVRHMDYLVDMLMAYLKDID 123
           N+ L+DF+C GYFY +   +V ++ YL+D L+  +  ID
Sbjct: 237 NNTLLDFVCFGYFYTETGDKVENIAYLIDRLLDCIDKID 275

 Score = 40.8 bits (94), Expect = 0.005,   Method: Compositional matrix adjust.
 Identities = 18/45 (40%), Positives = 23/45 (51%)

Query: 1  MSLWPFGETLSHSGIDSILEEYYLIFRSLEGNETSSTDDKKNEPS 45
          MS WPFG+  + S I+ ILEEY+ +   LE         K N  S
Sbjct: 1  MSFWPFGQNFNSSNINGILEEYFHVMHGLENQTQKIAGSKSNNSS 45

>CAGL0L03586g complement(408095..411466) similar to sp|P40856
           Saccharomyces cerevisiae YJL098w SAP185 or sp|P36123
           Saccharomyces cerevisiae YKR028w SAP190, start by
           similarity
          Length = 1123

 Score =  320 bits (819), Expect = 1e-94,   Method: Compositional matrix adjust.
 Identities = 212/613 (34%), Positives = 308/613 (50%), Gaps = 69/613 (11%)

Query: 144 EDQDDEDPMLYVNIISSIFCSKSAPIVEALVQNTPFLSSLFEVFQFENIEAENCP----I 199
           +D +++D +    + + +  +   PI  A++QN   L  L+ + Q+        P    I
Sbjct: 239 QDYEEQDELRRARMAAEVLSADVWPISSAIIQNEDLLEKLWSIMQYP------APLPIEI 292

Query: 200 LAVFLKINETLLFEQTSSYLEFFKSQPNIVDKFLYHIEVSPLVEFLIKIMLTDQVESPTN 259
              F+KINE LL    +  L F  + PN++D FL HI+  PL++FL+K++ TD+ ++PT 
Sbjct: 293 STYFMKINERLLDMDLNGILAFILNHPNLLDIFLTHIDNPPLMDFLLKVISTDKADTPTG 352

Query: 260 IIDFLYHQDLIPKCLNLLENSKYSPGIQNSSGELLKALISISTNFKLD-TLWIGPNRLTR 318
           II  L  Q +IPK L+ L + +Y    Q+++G+ +KAL++IS N   +    IGPN + R
Sbjct: 353 IIKILKEQGMIPKLLDFL-SPEYDKSTQSAAGDFIKALVTISGNCNNEIASSIGPNEMIR 411

Query: 319 QLASPQYVDQLINIILFQRGHAMGVAVSIIIELIRKNNSDYDEVDLLSTTIVDNPPSQRD 378
           +L SP  V++LI+I+L + G ++   V I+IELIRKNNSDYD V L  TTI  +PP+ RD
Sbjct: 412 ELVSPPMVEKLISIML-KAGSSLSNGVGIVIELIRKNNSDYDFVQLAYTTIKTHPPNDRD 470

Query: 379 PVYLGHLLYELTMHMEDFYALLIKLENXXXXXXXTASKALPSVKHHLLENQLHESFRPLG 438
           P+YLG+LL     HM +F  +L  +E             LP ++    E        PLG
Sbjct: 471 PIYLGYLLKAFAAHMAEFTQMLTSIE-------------LPPLQTPQGE------IEPLG 511

Query: 439 FERVKITELISEMLHCSNMGLMNSKRGEKIARTRDKCRD---TLDQNSLEKAMKNLNIND 495
           FER KI ELI+E+LHCSNM L+N   GE I + RD+ R+    L+   L     N  I D
Sbjct: 512 FERFKICELIAELLHCSNMTLLNDPNGESIVKERDEERERILKLENQKLNDESDN-EIED 570

Query: 496 NTITSNTLEXXXXXXXXXXXXXXXXXXXXXXXXFHDNELYSTFXXXXXXXXXXXXMSFEI 555
           N I +  L+                          D +                  + E 
Sbjct: 571 NNIPTTDLKSDTSQEDEKIANEMNDLQLDSEGNADDTDGSEQAKSDTVRDEFESKETNEE 630

Query: 556 PYV------SETQNLKIRKNPTIGDLFKIKLHDLGFFPKFLQLFLRYPWNNFWHNIVFDI 609
            Y+      SET++ K+R+NPT+GD  KI L D       L++F  Y WNNF HN+VFDI
Sbjct: 631 EYLENISDDSETEH-KLRENPTVGDQLKIALEDTRVIEVILEMFFHYVWNNFLHNVVFDI 689

Query: 610 IQQIFNGRMDFSYNSFLVYSLFDFKKSTRFIPKPLYGSNQKLPVKDFHIISDFILQGHKD 669
           IQQIFNG +   YN FL+  L                      +K+ H ++D I++G++ 
Sbjct: 690 IQQIFNGPLMTGYNRFLLIDL----------------------LKNIH-MTDLIIKGNEQ 726

Query: 670 SFEFYEKEKTNLGYMGQLVLIAEEIAKYSKI---YKTDLIAPDIYAFLQDEVWMSYSSDI 726
           S  + EK    LGYMG L L+AEEI K+       K       I   L +  W  Y+   
Sbjct: 727 SGVYEEKHVLRLGYMGHLTLMAEEIVKFEAYLDEMKITFTTDTIPTCLSEAKWKYYAETE 786

Query: 727 LNETRTMCSIILG 739
           L + R   + ILG
Sbjct: 787 LADLREKYNTILG 799

>KLLA0F14124g 1305690..1308992 similar to sp|P36123 Saccharomyces
           cerevisiae YKR028w SAP190 SIT4P-associated protein,
           start by similarity
          Length = 1100

 Score =  314 bits (805), Expect = 9e-93,   Method: Compositional matrix adjust.
 Identities = 204/566 (36%), Positives = 286/566 (50%), Gaps = 64/566 (11%)

Query: 203 FLKINETLLFEQTSSYLEFFKSQPNIVDKFLYHIEVSPLVEFLIKIMLTDQVESPTNIID 262
           F+KINE LL    S  + F   Q NIVD+F+ HI+  PL++FL+K++ TD+ ++PT II 
Sbjct: 331 FMKINERLLDMDISGMINFILKQENIVDRFIAHIDNPPLMDFLLKVISTDKPDAPTGIIA 390

Query: 263 FLYHQDLIPKCLNLLENSKYSPGIQNSSGELLKALISISTNFKLD-TLWIGPNRLTRQLA 321
            L  Q LI K L+ L + ++   IQ+++G+ LKALI+IS N   +    IGPN LTR+L 
Sbjct: 391 LLKKQHLISKLLDYL-SIEHDSSIQSAAGDFLKALITISANSNNEIASAIGPNELTRELV 449

Query: 322 SPQYVDQLINIILFQRGHAMGVAVSIIIELIRKNNSDYDEVDLLSTTIVDNPPSQRDPVY 381
           S + V +L+NI+L Q G ++   V I+IELIRKNNSDYD V ++ TT+  +PPS RDPVY
Sbjct: 450 SAEMVSKLVNIML-QCGTSLSNGVGIVIELIRKNNSDYDFVQVMYTTLETHPPSDRDPVY 508

Query: 382 LGHLLYELTMHMEDFYALLIKLENXXXXXXXTASKALPSVKHHLLENQLHESFRPLGFER 441
           LGHL+      M+ F  +L++                   K   LE     S  PLGFER
Sbjct: 509 LGHLVRCFANKMDRFNKILLE------------------TKLDPLETPFG-SIEPLGFER 549

Query: 442 VKITELISEMLHCSNMGLMNSKRGEKIARTRDKCRDTLDQNSLEKAMKNLNIN------- 494
            KI EL++E+LHCSNMGL+    GE I   RD  R+ +    +E+ ++N N +       
Sbjct: 550 FKICELVAELLHCSNMGLLGEPSGEAIVLERDLKREEI-LKEMEEQLENENASDAETGYY 608

Query: 495 ---DNTITSNTLEXXXXXXXXXXXXXXXXXXXXXXXXFHDNELYSTFXXXXXXXXXXXXM 551
              D+T  +N L                           D +                 +
Sbjct: 609 DGEDDTAHANNLH----RELQDLNINATLKDSEATDEVEDVKDVGDAGDVDASLAERTDI 664

Query: 552 SFEIPYVSETQNLKIRKNPTIGDLFKIKLHDLGFFPKFLQLFLRYPWNNFWHNIVFDIIQ 611
             E    SE     +R+NP +GDL KI L D       L +F R+PWNNF HN+VFDI+Q
Sbjct: 665 HSETSSDSEVTEKVLRENPVVGDLLKISLQDNNIITTILDMFFRFPWNNFLHNVVFDIVQ 724

Query: 612 QIFNGRMDFSYNSFLVYSLFDFKKSTRFIPKPLYGSNQKLPVKDFHIISDFILQGHKDSF 671
           QIFNG +   YN FL+  LF                           I+D I++G +   
Sbjct: 725 QIFNGPLKSGYNKFLLADLFSSAH-----------------------ITDVIMEGDRKCL 761

Query: 672 EFYEKEKTNLGYMGQLVLIAEEIAKYSKIYK---TDLIAPDIYAFLQDEVWMSYSSDILN 728
           E+ ++    LGYMG L LIAEE+AK++   +       +P +   L +  W  Y   IL 
Sbjct: 762 EYEKETGIRLGYMGHLTLIAEEVAKFAAYIEEANVTFASPVVQEGLNEPKWKEYCDTILT 821

Query: 729 ETRTMCSIILGGGQFC-AESDENTNQ 753
           ETR   S +LG   F   E+DE  ++
Sbjct: 822 ETREKYSSLLGDDGFDEGENDEGDDE 847

>AFR089W [3281] [Homologous to ScYKR028W (SAP190) - SH; ScYJL098W
           (SAP185) - SH] complement(590137..593232) [3096 bp, 1031
           aa]
          Length = 1031

 Score =  306 bits (785), Expect = 2e-90,   Method: Compositional matrix adjust.
 Identities = 197/597 (32%), Positives = 299/597 (50%), Gaps = 67/597 (11%)

Query: 155 VNIISSIFCSKSAPIVEALVQNTPFLSSLFEVFQFENIEAENCPILAV----FLKINETL 210
             + + I  +   PI  A +++   L  L+ +           P+  V    F+KINE L
Sbjct: 212 ARMAAEILSADVWPISSAFIEHDELLYKLWSILDHP------APLSIVASTYFMKINERL 265

Query: 211 LFEQTSSYLEFFKSQPNIVDKFLYHIEVSPLVEFLIKIMLTDQVESPTNIIDFLYHQDLI 270
           L    +S + F  +Q N+VD++L HI+  PL++FL+K++ TD+ ++PT++I  L +Q LI
Sbjct: 266 LDMDIASMIRFILNQDNLVDRYLTHIDNPPLMDFLLKVISTDKPDTPTHVIGLLKYQKLI 325

Query: 271 PKCLNLLENSKYSPGIQNSSGELLKALISISTNFKLD-TLWIGPNRLTRQLASPQYVDQL 329
            K L+ L + ++S  +Q+++G+ LKALI+IS N   +    IGPN LTR+L SP    +L
Sbjct: 326 SKLLDHL-SPEWSSSVQSAAGDFLKALITISANSNNEIASAIGPNELTRELVSPAMASKL 384

Query: 330 INIILFQRGHAMGVAVSIIIELIRKNNSDYDEVDLLSTTIVDNPPSQRDPVYLGHLLYEL 389
            +I+L   G ++   V I+IELIRKNNSDYD   ++ TT+  +PP+ RDPVYLGHL+   
Sbjct: 385 GDIML-NGGTSLSNGVGIVIELIRKNNSDYDFFQVMYTTLKTHPPNDRDPVYLGHLVKSF 443

Query: 390 TMHMEDFYALLIKLENXXXXXXXTASKALPSVKHHLLENQLHESFRPLGFERVKITELIS 449
              + +F A+L+  +             LP ++          +  PLGFER KI ELI+
Sbjct: 444 ANKLPEFNAMLLDTK-------------LPPLETPF------GTIEPLGFERFKICELIA 484

Query: 450 EMLHCSNMGLMNSKRGEKIARTRDKCRDTLDQNSLEKAMKNLNINDNTITSNTLEXXXXX 509
           E+LHCSNMGL+N  +GE+I   RD  R+ + +       KN +  + +++ + +E     
Sbjct: 485 ELLHCSNMGLLNEPKGEEIVNERDIDRECVLRLEGYGIPKNCHDEERSVSVSPIEEEDLA 544

Query: 510 XXXXXXXXXXXXXXXXXXXFHDNELYSTFXXXXXXXXXXXXMSFEI----PYVSETQNLK 565
                                DN + S              +  EI       +E     
Sbjct: 545 KKIRDLQLVTDKRPSS-----DNSVESLNSDSQQATTPIHQLGTEIHSEDSSDAELSEQA 599

Query: 566 IRKNPTIGDLFKIKLHDLGFFPKFLQLFLRYPWNNFWHNIVFDIIQQIFNGRMDFSYNSF 625
           +R+ P +GD  KI L D       L +F +YPWNNF HN+VFDI+QQIFNG +   YN F
Sbjct: 600 LREKPVVGDQLKIALQDNKIITTILGMFFKYPWNNFLHNVVFDIVQQIFNGPLKTGYNRF 659

Query: 626 LVYSLFDFKKSTRFIPKPLYGSNQKLPVKDFHIISDFILQGHKDSFEFYEKEKTNLGYMG 685
           L+  LF                           I++ I++G +   E+  +    LGYMG
Sbjct: 660 LLADLFASAH-----------------------ITEAIIEGDRKCHEYERETGLRLGYMG 696

Query: 686 QLVLIAEEIAKYSKI---YKTDLIAPDIYAFLQDEVWMSYSSDILNETRTMCSIILG 739
            L L+AEE+ K++      K     P I   L D+ W  Y+  +L ETR   S +LG
Sbjct: 697 HLTLVAEEVTKFASYIDEMKISFSNPVISESLNDQRWREYTELVLAETRGKYSTVLG 753

>Kwal_26.7346
          Length = 747

 Score =  292 bits (747), Expect = 4e-87,   Method: Compositional matrix adjust.
 Identities = 185/525 (35%), Positives = 270/525 (51%), Gaps = 62/525 (11%)

Query: 219 LEFFKSQPNIVDKFLYHIEVSPLVEFLIKIMLTDQVESPTNIIDFLYHQDLIPKCLNLLE 278
           L F  +Q N+VD+FL HI+  PL+++L+K++ TD+ ++ T +I+ L  QDLIPK L+ L 
Sbjct: 2   LHFILAQDNLVDRFLKHIDNPPLMDYLLKVISTDKPDTTTGVIERLDSQDLIPKLLDHLA 61

Query: 279 NSKYSPGIQNSSGELLKALISISTNFKLD-TLWIGPNRLTRQLASPQYVDQLINIILFQR 337
            S +SP  ++++G+ LKALI+IS N   +    IGPN LTR+L SP  V++L+NI+L   
Sbjct: 62  -SVHSPSTKSAAGDFLKALITISANSNNEIASAIGPNGLTRKLVSPSMVEKLMNIML-SG 119

Query: 338 GHAMGVAVSIIIELIRKNNSDYDEVDLLSTTIVDNPPSQRDPVYLGHLLYELTMHMEDFY 397
           G ++   V IIIELIRKNNSDYD V ++ TT+  +PP+ RDP+YLG+L+     H+ +F 
Sbjct: 120 GTSLSNGVGIIIELIRKNNSDYDFVQVMYTTLETHPPNDRDPIYLGYLIKCSAKHLPEFN 179

Query: 398 ALLIKLENXXXXXXXTASKALPSVKHHLLENQLHESFRPLGFERVKITELISEMLHCSNM 457
            +L++ E             LP ++          S  PLGFER KI EL++E+LHCSNM
Sbjct: 180 KILVETE-------------LPPLETPF------GSIEPLGFERFKICELVAELLHCSNM 220

Query: 458 GLMNSKRGEKIARTRDKCRDTLDQNSLEKAMKNLNINDNTITSNTLEXXXXXXXXXXXXX 517
            L+N   GE+I   RD  R        EK++     ++N  T++T +             
Sbjct: 221 TLLNEPNGEEIVSERDAVR--------EKSLHAEQTDNNEGTADTEDESEDVLDKMSDLR 272

Query: 518 XXXXXXXXXXXFHDNELYSTFXXXXXXXXXXXXMSFEIPYVSETQNLKIRKNPTIGDLFK 577
                       +++ +                   EIP         +R+NP +GD  K
Sbjct: 273 IATTTSSSSDEDNNSHMKEDDDEVGGEIHSEGSADSEIP------EKVLRENPVVGDQLK 326

Query: 578 IKLHDLGFFPKFLQLFLRYPWNNFWHNIVFDIIQQIFNGRMDFSYNSFLVYSLFDFKKST 637
           I L D       L++F  +PWNNF HN+VFDI+QQIFNG +   +N FL+  LF   K T
Sbjct: 327 IALQDNRVITTILEMFFAFPWNNFLHNVVFDIVQQIFNGPLKTGFNRFLIADLFTGAKLT 386

Query: 638 RFIPKPLYGSNQKLPVKDFHIISDFILQGHKDSFEFYEKEKTNLGYMGQLVLIAEEIAK- 696
                                    I++G K   ++  +    LGYMG L LIAEE+AK 
Sbjct: 387 H-----------------------MIMEGDKKCEDYENETGLRLGYMGHLTLIAEEVAKF 423

Query: 697 --YSKIYKTDLIAPDIYAFLQDEVWMSYSSDILNETRTMCSIILG 739
             Y +  K       I   L +  W  Y+  +L +TR   S +LG
Sbjct: 424 AAYVEEMKISFSNQAITDSLDEPSWKEYTETVLADTRENYSSVLG 468

>Scas_711.22*
          Length = 1018

 Score =  293 bits (751), Expect = 9e-86,   Method: Compositional matrix adjust.
 Identities = 199/592 (33%), Positives = 294/592 (49%), Gaps = 66/592 (11%)

Query: 155 VNIISSIFCSKSAPIVEALVQNTPFLSSLFEVFQFE---NIEAENCPILAVFLKINETLL 211
            ++ S I  ++   I  A+++N   L+ L+ +       +IE         F+KINE LL
Sbjct: 205 AHMASEILSAEVWGISNAILENDELLTKLWSILDHPIPLSIETS-----TYFMKINERLL 259

Query: 212 FEQTSSYLEFFKSQPNIVDKFLYHIEVSPLVEFLIKIMLTDQVESPTNIIDFLYHQDLIP 271
               +  + F  SQ  +V +FL HI+  PL++FL+K++ +D+ ++PT +I  L  Q LIP
Sbjct: 260 DTDITGMVTFILSQSTLVARFLKHIDNPPLLDFLLKVISSDKPDAPTRVIQCLKEQGLIP 319

Query: 272 KCLNLLENSKYSPGIQNSSGELLKALISISTNFKLDTLW-IGPNRLTRQLASPQYVDQLI 330
           + L+ L + +Y P  Q ++ + LKA ++IS N   +    IGPN LTRQL SP+ +++LI
Sbjct: 320 RLLDCLSH-EYDPSTQTAAADFLKAFVTISGNCNSEIASSIGPNELTRQLVSPEMMEKLI 378

Query: 331 NIILFQRGHAMGVAVSIIIELIRKNNSDYDEVDLLSTTIVDNPPSQRDPVYLGHLLYELT 390
            I+L   G ++   V IIIELIRKNNSDYD V ++ TT+  +PP+ RDP+YLG+L+    
Sbjct: 379 KIML-TGGTSLSNGVGIIIELIRKNNSDYDFVQVMYTTLETHPPNDRDPIYLGYLVSLFA 437

Query: 391 MHMEDFYALLIKLENXXXXXXXTASKALPSVKHHLLENQLHESFRPLGFERVKITELISE 450
            +M +F   L+           T S  L +   ++          PLGFER K+ ELI+E
Sbjct: 438 QYMPEFNKFLLD----------TNSTMLRTSFGNIT---------PLGFERFKVCELIAE 478

Query: 451 MLHCSNMGLMNSKRGEKIARTRDKCRDTLDQNSLEKAMKNLNINDNTITSNTLEXXXXXX 510
           +LHCSNM L+N  +GE I + RD+ R  +   S     +  N+N +T T    E      
Sbjct: 479 LLHCSNMSLLNEPKGEAIVKERDEERKRVLNFSHISDSEEANMNGDTTTIEGEE------ 532

Query: 511 XXXXXXXXXXXXXXXXXXFHDNELYSTFXXXXXXXXXXXXMSFEIPYVSETQNLKIRKNP 570
                              ++ E  S+                + P   ++    IR   
Sbjct: 533 ITERIDSLKLESEEEIRELNEKEDESSVAESSDVEAAPEDHISDSPATEKS----IRDEK 588

Query: 571 TIGDLFKIKLHDLGFFPKFLQLFLRYPWNNFWHNIVFDIIQQIFNGRMDFSYNSFLVYSL 630
            +GD+ K  L+D G     +++F ++PWNNF HN+VFDIIQQIFNG +   YN FL+  L
Sbjct: 589 IVGDVLKTLLYDTGIVVNIVKMFFQFPWNNFLHNVVFDIIQQIFNGPLKTGYNIFLLKDL 648

Query: 631 FDFKKSTRFIPKPLYGSNQKLPVKDFHIISDFILQGHKDSFEFYEKEKTNLGYMGQLVLI 690
                 TR                  H ++  +L G   S E+ E+    LGYMG L LI
Sbjct: 649 L-----TR-----------------AH-LTQLLLDGDTRSREYEERTHFRLGYMGHLTLI 685

Query: 691 AEEI---AKYSKIYKTDLIAPDIYAFLQDEVWMSYSSDILNETRTMCSIILG 739
            EEI   A Y +  K      DI   LQD  W+ Y+  IL +TR      LG
Sbjct: 686 GEEILKFAAYLEETKVVFTEDDIVDALQDSAWIEYADTILADTREKYETALG 737

>YKR028W (SAP190) [3283] chr11 (493900..497196) Protein that
           associates with and contributes to function of the
           protein phosphatase Sit4p [3297 bp, 1098 aa]
          Length = 1098

 Score =  286 bits (731), Expect = 2e-82,   Method: Compositional matrix adjust.
 Identities = 202/613 (32%), Positives = 305/613 (49%), Gaps = 68/613 (11%)

Query: 155 VNIISSIFCSKSAPIVEALVQNTPFLSSLFEVFQFENIEAENCPILAVFLKINETLLFEQ 214
             I + I  +   PI  A++QN   L  L+ +   ++      P    F+KINE LL   
Sbjct: 216 ARIAAEILSADVWPISAAIMQNKDLLGRLWSIL--DHPAPLPIPASTYFMKINERLLDMD 273

Query: 215 TSSYLEFFKSQPNIVDKFLYHIEVSPLVEFLIKIMLTDQVESPTNIIDFLYHQDLIPKCL 274
            +  LEF  S+ ++V +FL H++   L++FL+K++ TD+ +SPT +I  L  Q+LIPK L
Sbjct: 274 ITGMLEFILSRDSLVARFLTHVDNPSLMDFLLKVISTDKPDSPTGVIKILKSQELIPKLL 333

Query: 275 NLLENSKYSPGIQNSSGELLKALISISTNFKLD-TLWIGPNRLTRQLASPQYVDQLINII 333
           + L N +Y    Q+++G+ +KA +++STN   +    IGPN LTRQL S + +++LI I+
Sbjct: 334 DHL-NPEYGISTQSAAGDFIKAFVTLSTNSSNELASGIGPNELTRQLVSEEMIEKLIKIM 392

Query: 334 LFQRGHAMGVAVSIIIELIRKNNSDYDEVDLLSTTIVDNPPSQRDPVYLGHLLYELTMHM 393
           L + G ++   V IIIELIRKNNSDYD + L+ TT+  +PP+ RDP++L HL+     HM
Sbjct: 393 L-KGGTSLSNGVGIIIELIRKNNSDYDFIQLVYTTLESHPPTDRDPIHLIHLVKLFAKHM 451

Query: 394 EDFYALLIKLENXXXXXXXTASKALPSVKHHLLENQLHESFRPLGFERVKITELISEMLH 453
            DF  +L K +             LP     L+E     +  PLGFER KI ELI+E+LH
Sbjct: 452 PDFADMLDKTK-------------LP-----LMEMPFG-NIEPLGFERFKICELIAELLH 492

Query: 454 CSNMGLMNSKRGEKIARTRDKCRDTLDQNSLEKAMKNLN-INDNTITSNTLEXXXXXXXX 512
           CSNM L+N   GE IA+ RD  R    + S EK  +N+  I DN  +    +        
Sbjct: 493 CSNMTLLNEPNGEMIAQERDIERAKELETSTEK--ENITAIVDNKSSYYDKDCVEKDITE 550

Query: 513 XXXXXXXXXXXXXXXXFHDNELYSTFXXXXXXXXXXXXMSFEIPYV-------SETQNLK 565
                            +D  + S              +  +   V       S+T++++
Sbjct: 551 NLGALQINNQGSEEDELNDTGVSSVKLDVKSDAKVVEGLENDASGVELYDETLSDTESVR 610

Query: 566 --IRKNPTIGDLFKIKLHDLGFFPKFLQLFLRYPWNNFWHNIVFDIIQQIFNGRMDFSYN 623
             +R+ P +GD  KI L D       L +F  +PWNNF HN++FDI QQIFNG +   YN
Sbjct: 611 ECLREKPLVGDRLKIALEDTKILISILDMFTEFPWNNFLHNVIFDIAQQIFNGPLKTGYN 670

Query: 624 SFLVYSLFDFKKSTRFIPKPLYGSNQKLPVKDFHI---ISDFILQGHKDSFEFYEKEKTN 680
            FL                          +KD+ +   ++  I+   K   ++ +K    
Sbjct: 671 RFL--------------------------LKDYLVDAYLTKKIVDADKACQDYEKKTGLR 704

Query: 681 LGYMGQLVLIAEEIAKYSKI---YKTDLIAPDIYAFLQDEVWMSYSSDILNETRTMCSII 737
            GYMG L L+AEEI+K+ +     K       +   L++  W  YS  IL +TR   + +
Sbjct: 705 YGYMGHLTLVAEEISKFKEYIDEMKLTFCNTAVSDRLEEPFWKEYSETILADTREKYNTV 764

Query: 738 LGGGQFCAESDEN 750
           LG      ESD++
Sbjct: 765 LGDFGNDQESDDD 777

>YJL098W (SAP185) [2817] chr10 (241999..245175) Protein that
           associates with and contributes to function of the
           protein phosphatase Sit4p [3177 bp, 1058 aa]
          Length = 1058

 Score =  215 bits (548), Expect = 3e-58,   Method: Compositional matrix adjust.
 Identities = 134/342 (39%), Positives = 195/342 (57%), Gaps = 33/342 (9%)

Query: 142 EYEDQDDEDPMLYVNIISSIFCSKSAPIVEALVQNTPFLSSLFEVFQFEN---IEAENCP 198
           E E+ DD        I + I  +   PI  AL++N   L+ L+ + +  +   IEA    
Sbjct: 199 ELEEHDD---TRRARIAAEILSADVWPISSALIENEGLLAKLWSILRLPSPLSIEAS--- 252

Query: 199 ILAVFLKINETLLFEQTSSYLEFFKSQPNIVDKFLYHIEVSPLVEFLIKIMLTDQVESPT 258
               F+KINE LL       +EF   + +IVD FL HI+  PL++FL+K++ TD+ E   
Sbjct: 253 --TYFMKINERLLDMNMDGIIEFILKKEHIVDDFLAHIDNPPLMDFLLKVISTDKPEISN 310

Query: 259 NIIDFLYHQDLIPKCLNLLENSKYSPGIQNSSGELLKALISISTNFKLD-TLWIGPNRLT 317
            +I     Q+L+PK ++LL+   +    Q+++G+ LKAL++IS N   + T  IGPN LT
Sbjct: 311 GVIQLFKKQNLVPKLIHLLD-PVFDSCTQSAAGDFLKALVTISGNCPNEITSSIGPNELT 369

Query: 318 RQLASPQYVDQLINIILFQRGHAMGVAVSIIIELIRKNNSDYDEVDLLSTTIVDNPPSQR 377
           RQL SP  + QL++I+L + G+++   V IIIELIRKNNSDYD +    TTI  +PP+ R
Sbjct: 370 RQLVSPNMMKQLMDIML-KGGNSLNNGVGIIIELIRKNNSDYDTIQTNYTTIESHPPTDR 428

Query: 378 DPVYLGHLLYELTMHMEDFYALLIKLENXXXXXXXTASKALPSVKHHLLENQLHESFRPL 437
           DP+YLG+L+   + HM DF  +L +             K +P     LL+   + +  PL
Sbjct: 429 DPIYLGYLVKMFSEHMADFNKILTE-------------KKIP-----LLQTS-YGTIEPL 469

Query: 438 GFERVKITELISEMLHCSNMGLMNSKRGEKIARTRDKCRDTL 479
           GFER KI ELI+E+LHCSNM L+N      I R RD  R+ +
Sbjct: 470 GFERFKICELIAELLHCSNMTLLNEPSAYDIVRERDAERERI 511

 Score =  105 bits (261), Expect = 8e-23,   Method: Compositional matrix adjust.
 Identities = 55/176 (31%), Positives = 91/176 (51%), Gaps = 26/176 (14%)

Query: 567 RKNPTIGDLFKIKLHDLGFFPKFLQLFLRYPWNNFWHNIVFDIIQQIFNGRMDFSYNSFL 626
           R +P +GD  KI L D       L++F  + WNNF HN+V+D++QQIFNG +   YN FL
Sbjct: 623 RVSPNVGDQLKISLQDTRVIDTMLEMFFHFQWNNFLHNVVYDVVQQIFNGPLKIGYNRFL 682

Query: 627 VYSLFDFKKSTRFIPKPLYGSNQKLPVKDFHIISDFILQGHKDSFEFYEKEKTNLGYMGQ 686
           +  L                    + ++    ++D I+ G+ +  E+ +   T LGYMG 
Sbjct: 683 LDDLL-------------------INIR----LTDMIINGNNECIEYEKGHDTRLGYMGH 719

Query: 687 LVLIAEEIAKYSKIYKTDLIA---PDIYAFLQDEVWMSYSSDILNETRTMCSIILG 739
           L LIAEE+ K++   +   I     ++ + L +  W++Y+ D+L + +   + ILG
Sbjct: 720 LTLIAEEVTKFTAYIEEMNITFENTEVMSSLFESKWIAYTEDVLEDLKEKYNAILG 775

>Scas_675.36
          Length = 557

 Score =  111 bits (278), Expect = 2e-25,   Method: Compositional matrix adjust.
 Identities = 74/206 (35%), Positives = 99/206 (48%), Gaps = 31/206 (15%)

Query: 559 SETQNLKIRKNPTIGDLFKIKLHDLGFFPKFLQLFLRYPWNNFWHNIVFDIIQQIFNGRM 618
           SE     +R+NP  GD  KI L + G     L++F  + WNNF HN+VFDI+QQIFNG +
Sbjct: 137 SEATEALLRENPIPGDQLKISLRETGIIRTILEMFFHFEWNNFLHNVVFDIVQQIFNGPL 196

Query: 619 DFSYNSFLVYSLFDFKKSTRFIPKPLYGSNQKLPVKDFHIISDFILQGHKDSFEFYEKEK 678
             +YN FL+  L             L GS           I   +L G K      EK  
Sbjct: 197 RTTYNRFLLGDL-------------LTGSE----------IIHLVLDGDKKCAAQQEKHG 233

Query: 679 TNLGYMGQLVLIAEEIAK---YSKIYKTDLIAPDIYAFLQDEVWMSYSSDILNETRTMCS 735
             +GYMG L+LIAEEIAK   Y +  K     P I   L +  W  Y + IL +TR   +
Sbjct: 234 LRIGYMGHLMLIAEEIAKFIEYIEEMKISFSNPAIQECLNEPQWREYMATILADTRVKYN 293

Query: 736 IILGGGQFCAESDENTNQDFLEKADM 761
            +L  G F +   E+ + D +  AD+
Sbjct: 294 TVL--GDFVS---EDGSGDLIHNADL 314

 Score = 52.0 bits (123), Expect = 1e-06,   Method: Compositional matrix adjust.
 Identities = 24/40 (60%), Positives = 28/40 (70%)

Query: 437 LGFERVKITELISEMLHCSNMGLMNSKRGEKIARTRDKCR 476
           LGFE+ KI ELI+E+LHCSNM L+N   GE I   RD  R
Sbjct: 1   LGFEKFKICELIAELLHCSNMTLLNEPNGEAIVTERDLER 40

>KLLA0A06039g 557368..559341 weakly similar to sp|P36023
           Saccharomyces cerevisiae YKR064w singleton, start by
           similarity
          Length = 657

 Score = 31.2 bits (69), Expect = 4.1,   Method: Compositional matrix adjust.
 Identities = 26/85 (30%), Positives = 36/85 (42%), Gaps = 5/85 (5%)

Query: 95  GYFYD----DRSQQVRHMDYLVDMLM-AYLKDIDRTGYRTPFLLENSFHQTGEYEDQDDE 149
           G F D    DR   +R  + ++D+L  +  K IDR+   T   L NS      Y   +  
Sbjct: 96  GLFSDIAICDRDPYLRITNAVIDILRKSASKGIDRSERDTVLQLPNSLKTVTMYNRSEKS 155

Query: 150 DPMLYVNIISSIFCSKSAPIVEALV 174
           +  LY  I       +SAPI E  V
Sbjct: 156 EDQLYHQIAREFSALRSAPIPETYV 180

>CAGL0H01595g complement(155153..156436) similar to tr|Q04418
           Saccharomyces cerevisiae YDR527w, start by similarity
          Length = 427

 Score = 30.8 bits (68), Expect = 4.4,   Method: Compositional matrix adjust.
 Identities = 15/52 (28%), Positives = 29/52 (55%)

Query: 444 ITELISEMLHCSNMGLMNSKRGEKIARTRDKCRDTLDQNSLEKAMKNLNIND 495
           + E  ++ +H  N+  M     E+IAR R +  ++LD   ++K +KN+  +D
Sbjct: 67  VEESAAQRIHRENLETMRKMSPEEIARERQELLESLDPKLIQKLLKNVQKSD 118

>KLLA0A02937g 259865..260296 some similarities with sp|Q02205
          Saccharomyces cerevisiae YKR007w singleton,
          hypothetical start
          Length = 143

 Score = 29.3 bits (64), Expect = 7.0,   Method: Compositional matrix adjust.
 Identities = 14/55 (25%), Positives = 32/55 (58%), Gaps = 1/55 (1%)

Query: 38 DDKKNEPSMESESEFGTESR-DRSDLNQSFIDRILLETALLDELNGAANDRLVDF 91
          D  +N+P ++ +  +G++++ D +++ Q   +R+L     L E+    ND+L+D 
Sbjct: 12 DSDENDPLLQEQDRYGSQAQLDYNEMEQRQKERVLARELELTEIVNNTNDKLIDI 66

  Database: blastdb
    Posted date:  Apr 3, 2006  3:33 PM
  Number of letters in database: 16,596,109
  Number of sequences in database:  34,618
  
Lambda     K      H
   0.320    0.137    0.398 

Gapped
Lambda     K      H
   0.267   0.0410    0.140 

Matrix: BLOSUM62
Gap Penalties: Existence: 11, Extension: 1
Number of Sequences: 34618
Number of Hits to DB: 26,397,538
Number of extensions: 1215525
Number of successful extensions: 4141
Number of sequences better than 10.0: 31
Number of HSP's gapped: 4170
Number of HSP's successfully gapped: 54
Length of query: 804
Length of database: 16,596,109
Length adjustment: 110
Effective length of query: 694
Effective length of database: 12,788,129
Effective search space: 8874961526
Effective search space used: 8874961526
Neighboring words threshold: 11
Window for multiple hits: 40
X1: 16 ( 7.4 bits)
X2: 38 (14.6 bits)
X3: 64 (24.7 bits)
S1: 41 (21.8 bits)
S2: 66 (30.0 bits)