Hit NameLength (aa)HSP LengthHSP ScoreHSP Significance
YGL170C (SPO74)41340620980.0
Kwal_14.21864651161404e-09
ADL029W5351281253e-07
YGL251C (HFM1)118797740.46
KLLA0D02068g405108710.82
AGR270W29450663.6
YFL018C (LPD1)499113663.9
Scas_571.5*51932664.0
AFR493C32462645.8
KLLA0F26983g46774637.5
BLASTP 2.2.26 [Sep-21-2011]

Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, 
Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), 
"Gapped BLAST and PSI-BLAST: a new generation of protein database search
programs",  Nucleic Acids Res. 25:3389-3402.

Reference for compositional score matrix adjustment: Altschul, Stephen F., 
John C. Wootton, E. Michael Gertz, Richa Agarwala, Aleksandr Morgulis,
Alejandro A. Schaffer, and Yi-Kuo Yu (2005) "Protein database searches
using compositionally adjusted substitution matrices", FEBS J. 272:5101-5109.

Query= YGL170C
         (406 letters)

Database: blastdb 
           34,618 sequences; 16,596,109 total letters

Searching..................................................done

                                                                 Score    E
Sequences producing significant alignments:                      (bits) Value

YGL170C (SPO74) [1820] chr7 complement(184157..185398) Protein i...   812   0.0  
Kwal_14.2186                                                           59   4e-09
ADL029W [1713] [Homologous to ScYGL170C (SPO74) - SH] complement...    53   3e-07
YGL251C (HFM1) [1749] chr7 complement(27921..31426,31579..31636)...    33   0.46 
KLLA0D02068g 177264..178481 no similarity, hypothetical start          32   0.82 
AGR270W [4581] [Homologous to ScYOR174W (MED4) - SH] complement(...    30   3.6  
YFL018C (LPD1) [1664] chr6 complement(101622..103121) Dihydrolip...    30   3.9  
Scas_571.5*                                                            30   4.0  
AFR493C [3685] [Homologous to ScYLR316C (TAD3) - SH] (1325485..1...    29   5.8  
KLLA0F26983g 2489326..2490729 some similarities with sp|P32801 S...    29   7.5  

>YGL170C (SPO74) [1820] chr7 complement(184157..185398) Protein
           involved in sporulation, has similarity to
           phosphoribulokinase precursor (phosphopentokinase) [1242
           bp, 413 aa]
          Length = 413

 Score =  812 bits (2098), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 393/406 (96%), Positives = 393/406 (96%)

Query: 1   MGAGTLLNGLEKENFPNNIHSDLPAYPNMDSQEDGNTSKESKRNSPVXXXXXXXXXXXXX 60
           MGAGTLLNGLEKENFPNNIHSDLPAYPNMDSQEDGNTSKESKRNSPV             
Sbjct: 1   MGAGTLLNGLEKENFPNNIHSDLPAYPNMDSQEDGNTSKESKRNSPVKQKSQKDEEKSSK 60

Query: 61  MGTASNIFHENKDIHERSEHTDDFNDGLKLAPDSSPSLKECQFKNWESFWCNTEGYKTKH 120
           MGTASNIFHENKDIHERSEHTDDFNDGLKLAPDSSPSLKECQFKNWESFWCNTEGYKTKH
Sbjct: 61  MGTASNIFHENKDIHERSEHTDDFNDGLKLAPDSSPSLKECQFKNWESFWCNTEGYKTKH 120

Query: 121 MQPFHFTSGLEEIKEPVMELNISTSPYKGQRPNSAPTEYSAATTAFTKTQLEVSFLKTNL 180
           MQPFHFTSGLEEIKEPVMELNISTSPYKGQRPNSAPTEYSAATTAFTKTQLEVSFLKTNL
Sbjct: 121 MQPFHFTSGLEEIKEPVMELNISTSPYKGQRPNSAPTEYSAATTAFTKTQLEVSFLKTNL 180

Query: 181 LTYIKKEIDICLSSVPFFDDAVQMQKKFLEYRDIDLDEEYELKILGELLNDLNFFHMQEN 240
           LTYIKKEIDICLSSVPFFDDAVQMQKKFLEYRDIDLDEEYELKILGELLNDLNFFHMQEN
Sbjct: 181 LTYIKKEIDICLSSVPFFDDAVQMQKKFLEYRDIDLDEEYELKILGELLNDLNFFHMQEN 240

Query: 241 SLLNRELAVRRFSNQPESQNLPSIRDFRNPLLPIDNRPSPPLGLKRNGKSFEETYDFTSN 300
           SLLNRELAVRRFSNQPESQNLPSIRDFRNPLLPIDNRPSPPLGLKRNGKSFEETYDFTSN
Sbjct: 241 SLLNRELAVRRFSNQPESQNLPSIRDFRNPLLPIDNRPSPPLGLKRNGKSFEETYDFTSN 300

Query: 301 TSNFWGEKAELQNSITGGTPYFFHPNNIHQTKPFMSFENQNELLFQRKNSDYKQHFNSGR 360
           TSNFWGEKAELQNSITGGTPYFFHPNNIHQTKPFMSFENQNELLFQRKNSDYKQHFNSGR
Sbjct: 301 TSNFWGEKAELQNSITGGTPYFFHPNNIHQTKPFMSFENQNELLFQRKNSDYKQHFNSGR 360

Query: 361 NIHNGVESKSYRGVGLNDSYQKGYAAMTKSFGNIDLNRMPRRSNEE 406
           NIHNGVESKSYRGVGLNDSYQKGYAAMTKSFGNIDLNRMPRRSNEE
Sbjct: 361 NIHNGVESKSYRGVGLNDSYQKGYAAMTKSFGNIDLNRMPRRSNEE 406

>Kwal_14.2186
          Length = 465

 Score = 58.5 bits (140), Expect = 4e-09,   Method: Compositional matrix adjust.
 Identities = 36/116 (31%), Positives = 66/116 (56%), Gaps = 1/116 (0%)

Query: 143 STSPYKGQRPNSAPTEYSAATTAFTKTQLEVSFLKTNLLTYIKKEIDICLSSVPFFDDAV 202
           S SPYKG R  S     S A+T+ ++ +    F K +++ +++K ID    S  F DDA 
Sbjct: 136 SGSPYKGARVLSQHESASQASTSGSRLRRNHKFFKNSVVPFLQKSIDTFQHSDIFGDDAK 195

Query: 203 QMQKKFLEYRDIDL-DEEYELKILGELLNDLNFFHMQENSLLNRELAVRRFSNQPE 257
            + +K   +++    D++ +++++ E+L+ LN    Q  ++LNREL  ++ S+Q E
Sbjct: 196 TLGRKLEAFKNCGAKDKDSKVQLMVEILDGLNHLQQQCVAVLNRELQSKKISSQLE 251

>ADL029W [1713] [Homologous to ScYGL170C (SPO74) - SH]
           complement(648582..650189) [1608 bp, 535 aa]
          Length = 535

 Score = 52.8 bits (125), Expect = 3e-07,   Method: Compositional matrix adjust.
 Identities = 38/128 (29%), Positives = 63/128 (49%), Gaps = 4/128 (3%)

Query: 143 STSPYKGQRPNSAPTEYSAATTAFTKTQLEVSFLKTNLLTYIKKEIDICLSSVPFFDDAV 202
           S SPY+G RP S  T++SA +       +   F+   L+ Y+++ I I   S  F   A+
Sbjct: 175 SGSPYRGSRPFSHSTKHSAVSVTSNSRHMSYLFVSRQLVPYMREAISIFERSDLFSGQAL 234

Query: 203 QMQKKFLEYRDIDLDEEYELKILGELLNDLNFFHMQENSLLNRELAVRRFSNQPESQNLP 262
           + ++ F++  D  L    +   L ++L++L          LNREL  ++ S Q E   L 
Sbjct: 235 KARRAFVKAIDGALSAVPQFDDLVDVLDELTILQRNAIVCLNRELEYKKVSQQLE--YLA 292

Query: 263 SIRDFRNP 270
           +I  FR+P
Sbjct: 293 TI--FRDP 298

>YGL251C (HFM1) [1749] chr7 complement(27921..31426,31579..31636)
            DNA/RNA helicase involved in meiotic recombination,
            member of the DExH-box type helicase family with Ski2p
            and Brr2p [3564 bp, 1187 aa]
          Length = 1187

 Score = 33.1 bits (74), Expect = 0.46,   Method: Compositional matrix adjust.
 Identities = 22/97 (22%), Positives = 46/97 (47%), Gaps = 6/97 (6%)

Query: 74   IHERSEHTDDFNDGLKLAPDSS-PSLKECQFKNWESFWCNTEGYKTKHMQ-----PFHFT 127
            IH  +  +  F++G ++  + +      C+ K      C  EG   K+++          
Sbjct: 1015 IHPEAHSSSHFSNGRQVRSNGNYECFHSCKDKTQCRHLCCKEGIPVKYIKEKGPSSIKPV 1074

Query: 128  SGLEEIKEPVMELNISTSPYKGQRPNSAPTEYSAATT 164
            S  ++I++P++  NI+T+P+  +R NS P ++    T
Sbjct: 1075 SKPDQIRQPLLAKNINTTPHLEKRLNSKPKQWQEENT 1111

>KLLA0D02068g 177264..178481 no similarity, hypothetical start
          Length = 405

 Score = 32.0 bits (71), Expect = 0.82,   Method: Compositional matrix adjust.
 Identities = 27/108 (25%), Positives = 55/108 (50%), Gaps = 1/108 (0%)

Query: 143 STSPYKGQRPNSAPTEYSAATTAFTKTQLEVSFLKTNLLTYIKKEIDICLSSVPFFDDAV 202
           S+S Y G R +   T   A+TT   K +  + F + N+L +I+  I++  +S    ++ V
Sbjct: 143 SSSSYDGNRNDVRETSTVASTTISRKEKNHMLFTR-NILPFIRDSINMYKNSHVLNEEVV 201

Query: 203 QMQKKFLEYRDIDLDEEYELKILGELLNDLNFFHMQENSLLNRELAVR 250
            ++K+  ++ D  L ++ + ++   +L  L        + LNREL ++
Sbjct: 202 PIEKELDKFYDNSLKKDEKCEVFSNVLLGLLRVQRLNIAALNRELELK 249

>AGR270W [4581] [Homologous to ScYOR174W (MED4) - SH]
           complement(1244270..1245154) [885 bp, 294 aa]
          Length = 294

 Score = 30.0 bits (66), Expect = 3.6,   Method: Compositional matrix adjust.
 Identities = 21/50 (42%), Positives = 26/50 (52%), Gaps = 3/50 (6%)

Query: 192 LSSVPFFDDAVQMQKKFLEYRDIDLDEEYE--LKILGELLNDLNFFHMQE 239
           L+ +P +D  +  Q K LE    D+DE     L ILGE  NDLN   M E
Sbjct: 94  LAQLPKYD-LIDSQLKKLEEESKDIDERTAKILGILGECYNDLNSLPMVE 142

>YFL018C (LPD1) [1664] chr6 complement(101622..103121)
           Dihydrolipoamide dehydrogenase, (E3) component of
           pyruvate dehydrogenase complex, 2-oxoglutarate
           dehydrogenase complex (alpha-ketogluterate dehydrogense
           complex), branched chain 2-oxoacid dehydrogenase
           complex, and glycine carboxylase complex [1500 bp, 499
           aa]
          Length = 499

 Score = 30.0 bits (66), Expect = 3.9,   Method: Compositional matrix adjust.
 Identities = 25/113 (22%), Positives = 46/113 (40%), Gaps = 12/113 (10%)

Query: 296 DFTSNTSNFWGEKAELQNSITGGTPYFFHPNNIHQTKPFMSFENQNELLFQ----RKNSD 351
           D   N +NF   K +    +TGG    F  N +   K   SFE++ ++        + + 
Sbjct: 100 DIKINVANFQKAKDDAVKQLTGGIELLFKKNKVTYYKGNGSFEDETKIRVTPVDGLEGTV 159

Query: 352 YKQHFNSGRNI--HNGVESKSYRGVGLNDSYQKGYAAMTKSFGNIDLNRMPRR 402
            + H    +NI    G E   + G+ +++        +  S G + L  +P+R
Sbjct: 160 KEDHILDVKNIIVATGSEVTPFPGIEIDEE------KIVSSTGALSLKEIPKR 206

>Scas_571.5*
          Length = 519

 Score = 30.0 bits (66), Expect = 4.0,   Method: Compositional matrix adjust.
 Identities = 14/32 (43%), Positives = 20/32 (62%)

Query: 364 NGVESKSYRGVGLNDSYQKGYAAMTKSFGNID 395
           +G   KSYRG+G  D+ QKG A+ ++ F   D
Sbjct: 408 DGKRLKSYRGMGSVDAMQKGAASASRYFSEAD 439

>AFR493C [3685] [Homologous to ScYLR316C (TAD3) - SH]
           (1325485..1326459) [975 bp, 324 aa]
          Length = 324

 Score = 29.3 bits (64), Expect = 5.8,   Method: Compositional matrix adjust.
 Identities = 20/62 (32%), Positives = 31/62 (50%), Gaps = 7/62 (11%)

Query: 227 ELLNDLNFFHMQENSLLNRELAVRRFSNQPESQNLPSIRDFRNPLLP------IDNRPSP 280
           ++LND  F   +  S+L R+++      + +S NLP +  F NPL P      +D R   
Sbjct: 148 QILNDYTFDMARIRSIL-RQISDTASEKRDQSGNLPVVSAFVNPLAPEQPIIAVDQRGGN 206

Query: 281 PL 282
           PL
Sbjct: 207 PL 208

>KLLA0F26983g 2489326..2490729 some similarities with sp|P32801
           Saccharomyces cerevisiae YKL048c ELM1 ser/thr-specific
           protein kinase, hypothetical start
          Length = 467

 Score = 28.9 bits (63), Expect = 7.5,   Method: Compositional matrix adjust.
 Identities = 22/74 (29%), Positives = 39/74 (52%), Gaps = 6/74 (8%)

Query: 200 DAVQMQKKFLEYR-DIDLDEEYELKILGELLNDLNFFHMQENSLLNRELAVRRFSNQPES 258
           D ++  K F  YR  +D  EE+ +K+LG++ N L +  +Q   +++R+L  +     P  
Sbjct: 191 DLIEQWKSF--YRGQLDSVEEFAVKVLGDISNGLQY--LQGQGIIHRDLKPQNILLDPVY 246

Query: 259 QNLPSIRDFRNPLL 272
            +L  I DF   L+
Sbjct: 247 HSL-RISDFGCSLI 259

  Database: blastdb
    Posted date:  Apr 3, 2006  3:33 PM
  Number of letters in database: 16,596,109
  Number of sequences in database:  34,618
  
Lambda     K      H
   0.313    0.131    0.386 

Gapped
Lambda     K      H
   0.267   0.0410    0.140 

Matrix: BLOSUM62
Gap Penalties: Existence: 11, Extension: 1
Number of Sequences: 34618
Number of Hits to DB: 15,191,388
Number of extensions: 733774
Number of successful extensions: 1823
Number of sequences better than 10.0: 42
Number of HSP's gapped: 1820
Number of HSP's successfully gapped: 42
Length of query: 406
Length of database: 16,596,109
Length adjustment: 104
Effective length of query: 302
Effective length of database: 12,995,837
Effective search space: 3924742774
Effective search space used: 3924742774
Neighboring words threshold: 11
Window for multiple hits: 40
X1: 16 ( 7.2 bits)
X2: 38 (14.6 bits)
X3: 64 (24.7 bits)
S1: 42 (21.9 bits)
S2: 63 (28.9 bits)