Hit NameLength (aa)HSP LengthHSP ScoreHSP Significance
YGL169W (SUA5)42641922020.0
Kwal_14.150440141014030.0
CAGL0I04290g42240413590.0
AEL300C41840613021e-179
KLLA0A03135g40440312611e-173
Scas_707.4944142012501e-171
YNL097C (PHO23)330113760.23
BLASTP 2.2.26 [Sep-21-2011]

Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, 
Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), 
"Gapped BLAST and PSI-BLAST: a new generation of protein database search
programs",  Nucleic Acids Res. 25:3389-3402.

Reference for compositional score matrix adjustment: Altschul, Stephen F., 
John C. Wootton, E. Michael Gertz, Richa Agarwala, Aleksandr Morgulis,
Alejandro A. Schaffer, and Yi-Kuo Yu (2005) "Protein database searches
using compositionally adjusted substitution matrices", FEBS J. 272:5101-5109.

Query= YGL169W
         (419 letters)

Database: blastdb 
           34,618 sequences; 16,596,109 total letters

Searching..................................................done

                                                                 Score    E
Sequences producing significant alignments:                      (bits) Value

YGL169W (SUA5) [1821] chr7 (186063..187343) Protein involved in ...   852   0.0  
Kwal_14.1504                                                          545   0.0  
CAGL0I04290g 380844..382112 similar to sp|P32579 Saccharomyces c...   528   0.0  
AEL300C [2205] [Homologous to ScYGL169W (SUA5) - SH] (78172..794...   506   e-179
KLLA0A03135g 279951..281165 similar to sp|P32579 Saccharomyces c...   490   e-173
Scas_707.49                                                           486   e-171
YNL097C (PHO23) [4494] chr14 complement(441366..442358) Protein ...    34   0.23 

>YGL169W (SUA5) [1821] chr7 (186063..187343) Protein involved in
           translation initiation, mutation suppresses the effect
           of an aberrant upstream ATG in CYC1 [1281 bp, 426 aa]
          Length = 426

 Score =  852 bits (2202), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 419/419 (100%), Positives = 419/419 (100%)

Query: 1   MYLGRHFLAMTSKALFDTKILKVNPLSIIFSPDAHIDGSLPTITDPETEAALVEAARIIR 60
           MYLGRHFLAMTSKALFDTKILKVNPLSIIFSPDAHIDGSLPTITDPETEAALVEAARIIR
Sbjct: 1   MYLGRHFLAMTSKALFDTKILKVNPLSIIFSPDAHIDGSLPTITDPETEAALVEAARIIR 60

Query: 61  DTDETVAFPTETVYGLGGSALNDNSVLSIYRAKNRPSDNPLITHVSSIDQLNRKVFNQPH 120
           DTDETVAFPTETVYGLGGSALNDNSVLSIYRAKNRPSDNPLITHVSSIDQLNRKVFNQPH
Sbjct: 61  DTDETVAFPTETVYGLGGSALNDNSVLSIYRAKNRPSDNPLITHVSSIDQLNRKVFNQPH 120

Query: 121 LSGTSLFDNIPSIYRPLISSLWPGPLTILLPVPSSEHSALSKLTTADQPTFAVRIPANPV 180
           LSGTSLFDNIPSIYRPLISSLWPGPLTILLPVPSSEHSALSKLTTADQPTFAVRIPANPV
Sbjct: 121 LSGTSLFDNIPSIYRPLISSLWPGPLTILLPVPSSEHSALSKLTTADQPTFAVRIPANPV 180

Query: 181 ARALIALSDTPIAAPSANASTRPSPTLASHVYHDLKDKIPIILDGGACKVGVESTVVDGL 240
           ARALIALSDTPIAAPSANASTRPSPTLASHVYHDLKDKIPIILDGGACKVGVESTVVDGL
Sbjct: 181 ARALIALSDTPIAAPSANASTRPSPTLASHVYHDLKDKIPIILDGGACKVGVESTVVDGL 240

Query: 241 CNPPTLLRPGGFTYEEIVKLGGEAWSLCKVENKKTVEKGEKVRTPGMKYRHYSPSAKVVL 300
           CNPPTLLRPGGFTYEEIVKLGGEAWSLCKVENKKTVEKGEKVRTPGMKYRHYSPSAKVVL
Sbjct: 241 CNPPTLLRPGGFTYEEIVKLGGEAWSLCKVENKKTVEKGEKVRTPGMKYRHYSPSAKVVL 300

Query: 301 LVPHCEGDGILKGVDRMERLKRLIETELKANSNIKKIAILTSLKLRDSDLQSKIFNEPDF 360
           LVPHCEGDGILKGVDRMERLKRLIETELKANSNIKKIAILTSLKLRDSDLQSKIFNEPDF
Sbjct: 301 LVPHCEGDGILKGVDRMERLKRLIETELKANSNIKKIAILTSLKLRDSDLQSKIFNEPDF 360

Query: 361 SSKTFIIERLGQSGEEIQTNLFAALRKVDENDKVDLIFVEGINEEGEGLAVMNRLRKAA 419
           SSKTFIIERLGQSGEEIQTNLFAALRKVDENDKVDLIFVEGINEEGEGLAVMNRLRKAA
Sbjct: 361 SSKTFIIERLGQSGEEIQTNLFAALRKVDENDKVDLIFVEGINEEGEGLAVMNRLRKAA 419

>Kwal_14.1504
          Length = 401

 Score =  545 bits (1403), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 280/410 (68%), Positives = 319/410 (77%), Gaps = 20/410 (4%)

Query: 10  MTSKALFDTKILKVNPLSIIFSPDAHIDGSLPTITDPETEAALVEAARIIRDTDETVAFP 69
           + SK  F T+ILKV+P SI+FS  AHIDGSLPTITD ETE  L+EAARIIRDTD TV FP
Sbjct: 5   LISKMSFQTRILKVDPKSIVFSDSAHIDGSLPTITDAETERNLLEAARIIRDTDNTVGFP 64

Query: 70  TETVYGLGGSALNDNSVLSIYRAKNRPSDNPLITHVSSIDQLNRKVFNQPHLSGTSLFDN 129
           TETVYGLGGS+LNDNSVL+IY+AKNRPSDNPLI+HVSSIDQLNR++F Q H   TS+  N
Sbjct: 65  TETVYGLGGSSLNDNSVLNIYKAKNRPSDNPLISHVSSIDQLNRRIFGQSH--ATSILHN 122

Query: 130 IPSIYRPLISSLWPGPLTILLPVPSSEHSALSKLTTADQPTFAVRIPANPVARALIALSD 189
           IP IYRPLI  LWPGPLTILL VP    S LSKLTTADQPTFAVRIP+NPVARALIALSD
Sbjct: 123 IPEIYRPLIEKLWPGPLTILLSVPPK--STLSKLTTADQPTFAVRIPSNPVARALIALSD 180

Query: 190 TPIAAPSANASTRPSPTLASHVYHDLKDKIPIILDGGACKVGVESTVVDGLCNPPTLLRP 249
           TPIAAPSAN STRPSPTLASHV+HDL+ +IP+ILDGGAC VGVESTVVDGL +PP LLRP
Sbjct: 181 TPIAAPSANQSTRPSPTLASHVFHDLQGRIPLILDGGACTVGVESTVVDGLVSPPLLLRP 240

Query: 250 GGFTYEEIVKLGGEAWSLCKVENKKTVEKGEKVRTPGMKYRHYSPSAKVVLLVPHCEGDG 309
           GGFT+E++  +GG  W+ CKVENKKTV  GEKVRTPGMKYRHYSP AKV L VP    + 
Sbjct: 241 GGFTWEQVRSMGGPQWANCKVENKKTVSAGEKVRTPGMKYRHYSPRAKVFLFVPQ---EN 297

Query: 310 ILKGVDRMERLKRLIETELKANSNIKKIAILTSLKLRDSDLQSKIFNEPDFSSKTFIIER 369
            L    R+E + R+I+   K   +IK+ A+L++L           F +        I + 
Sbjct: 298 ELAIEQRLETVSRIIKESTK---DIKRFAVLSTLT----------FPQDLLVDSRGIYKS 344

Query: 370 LGQSGEEIQTNLFAALRKVDENDKVDLIFVEGINEEGEGLAVMNRLRKAA 419
           LG +  EIQ NLFA LR+VDE D VD+IFVEGI+EEGEGLAVMNRLRKAA
Sbjct: 345 LGHTNIEIQANLFALLREVDEKDNVDIIFVEGIDEEGEGLAVMNRLRKAA 394

>CAGL0I04290g 380844..382112 similar to sp|P32579 Saccharomyces
           cerevisiae YGL169w SUA5 translation initiation protein,
           start by similarity
          Length = 422

 Score =  528 bits (1359), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 265/404 (65%), Positives = 322/404 (79%), Gaps = 9/404 (2%)

Query: 18  TKILKVNPLSIIFSPDAHIDGSLPTITDPETEAALVEAARIIRDTDETVAFPTETVYGLG 77
           T++LKV+ LSI+F  +AHIDG LP + D  +  AL++AA IIRDT+ETVAFPTETVYGLG
Sbjct: 19  TEVLKVDALSIVFPENAHIDGKLPEVNDAPSRDALLKAAHIIRDTEETVAFPTETVYGLG 78

Query: 78  GSALNDNSVLSIYRAKNRPSDNPLITHVSSIDQLNRKVFNQPHLSGTSLFDNIPSIYRPL 137
           GS+LNDNSV +IY+AKNRPSDNPLITHVSSIDQLNRK++N        +  NIP IY PL
Sbjct: 79  GSSLNDNSVRNIYKAKNRPSDNPLITHVSSIDQLNRKIYND--YEDGDILRNIPKIYHPL 136

Query: 138 ISSLWPGPLTILLPVPSSEHSALSKLTTADQPTFAVRIPANPVARALIALSDTPIAAPSA 197
           I  LWPGPLTILLP+P   + +LSKLTT DQPTFAVRIPAN +ARALIAL+DTPIAAPSA
Sbjct: 137 IEKLWPGPLTILLPIPPERNVSLSKLTTGDQPTFAVRIPANSIARALIALADTPIAAPSA 196

Query: 198 NASTRPSPTLASHVYHDLKDKIPIILDGGACKVGVESTVVDGLCNPPTLLRPGGFTYEEI 257
           NASTRPSPTLASHVYHDLK +IP+I+DGGAC VGVESTVVDGLC PP LLRPGGFTYE+I
Sbjct: 197 NASTRPSPTLASHVYHDLKGRIPLIIDGGACNVGVESTVVDGLCLPPALLRPGGFTYEDI 256

Query: 258 VKLGGEAWSLCKVENKKTVEKGEKVRTPGMKYRHYSPSAKVVLLVPHCEGDGILKGVDRM 317
           + LGGE+W  CKVENKKT+ +GEKVRTPGMKY+HY+PSAKV++L+P+ + D  ++ +D+M
Sbjct: 257 LHLGGESWRNCKVENKKTLSEGEKVRTPGMKYKHYAPSAKVIVLLPN-DSDTQMQLIDKM 315

Query: 318 ERLKRLIETELKANSNIKKIAILTSLKLRDSDLQSKIFNEPDF-SSKT-FIIERLGQSGE 375
               ++  +  + +   KK+AI+T+LKL     +  +F   ++  +KT F++  LG SGE
Sbjct: 316 ----KVFLSSHQPDIIDKKVAIMTTLKLTPILNEISLFASSNYKGTKTEFLVSELGASGE 371

Query: 376 EIQTNLFAALRKVDENDKVDLIFVEGINEEGEGLAVMNRLRKAA 419
            IQ NLFAALRK DE D VD I VEGI+E  EGLAVMNRLRKA+
Sbjct: 372 AIQANLFAALRKADETDNVDTIIVEGISETSEGLAVMNRLRKAS 415

>AEL300C [2205] [Homologous to ScYGL169W (SUA5) - SH] (78172..79428)
           [1257 bp, 418 aa]
          Length = 418

 Score =  506 bits (1302), Expect = e-179,   Method: Compositional matrix adjust.
 Identities = 259/406 (63%), Positives = 314/406 (77%), Gaps = 15/406 (3%)

Query: 16  FDTKILKVNPLSIIFSPDAHIDGSLPTITDPETEAALVEAARIIRDTDETVAFPTETVYG 75
           ++TK+L+V+P +I FS  AHIDGSLP I+DPETE  L+EAAR+IRD  ETVAFPTETVYG
Sbjct: 19  YNTKVLRVDPSAIHFSATAHIDGSLPRISDPETEKHLLEAARLIRDDGETVAFPTETVYG 78

Query: 76  LGGSALNDNSVLSIYRAKNRPSDNPLITHVSSIDQLNRKVFNQPHLSGTSLFDNIPSIYR 135
           LGGS+LND SV +IY+AKNRPSDNPLI+HVSSI QLNR+++ Q       +  NIP +Y 
Sbjct: 79  LGGSSLNDASVRNIYKAKNRPSDNPLISHVSSIAQLNRRIYQQDREG--DVLRNIPVVYH 136

Query: 136 PLISSLWPGPLTILLPVPSSEHSALSKLTTADQPTFAVRIPANPVARALIALSDTPIAAP 195
            L+  LWPGPLTILLP+  +E +ALS LTTA QPTFAVRIPA+PVARALIALSDTPIAAP
Sbjct: 137 ELVRQLWPGPLTILLPI--NEETALSVLTTAGQPTFAVRIPADPVARALIALSDTPIAAP 194

Query: 196 SANASTRPSPTLASHVYHDLKDKIPIILDGGACKVGVESTVVDGLCNPPTLLRPGGFTYE 255
           SAN STRPSPT A HVYHDLK KIP+ILDGG+C+VGVESTV+DGL NPP LLRPGGFTYE
Sbjct: 195 SANVSTRPSPTAAEHVYHDLKGKIPLILDGGSCRVGVESTVIDGLVNPPMLLRPGGFTYE 254

Query: 256 EIVKLGGEAWSLCKVENKKTVEKGEKVRTPGMKYRHYSPSAKVVLLVPHCEGDGILKGVD 315
           EI++LGGE WS CKVEN+ TV  GEKVRTPGMKY+HYSP A  V   P  +    L   +
Sbjct: 255 EIIELGGEQWSHCKVENRMTVGSGEKVRTPGMKYKHYSPRASTVAFAPINDD---LPTSE 311

Query: 316 RMERLKRLIETELKANSNIK--KIAILTSLKLRDSDLQSKIFNEPDFSSKTFIIERLGQS 373
           RM+ +   I   + ++   K  K+ +LTS+   ++ L+S I +E D      ++  LG S
Sbjct: 312 RMKIVTSEIMKYMTSHGTDKRQKVGLLTSIMFPNNLLES-ITDEVD-----VVVYSLGSS 365

Query: 374 GEEIQTNLFAALRKVDENDKVDLIFVEGINEEGEGLAVMNRLRKAA 419
           G+E+Q+NLFA LR++DE D+VDLIFVEGI++  EGLAVMNRLRKAA
Sbjct: 366 GKEVQSNLFAMLRRLDEEDEVDLIFVEGISDRNEGLAVMNRLRKAA 411

>KLLA0A03135g 279951..281165 similar to sp|P32579 Saccharomyces
           cerevisiae YGL169w SUA5 translation initiation protein
           singleton, start by similarity
          Length = 404

 Score =  490 bits (1261), Expect = e-173,   Method: Compositional matrix adjust.
 Identities = 256/403 (63%), Positives = 295/403 (73%), Gaps = 16/403 (3%)

Query: 18  TKILKVNPLSIIFSPDAHIDGSLPTITDPETEAALVEAARIIRDTDETVAFPTETVYGLG 77
           T+ILKV+P +I FS  AHIDGSLPT T  ETE  L+EAA IIRDT ETVAFPTETVYGLG
Sbjct: 10  TRILKVDPAAIHFSDSAHIDGSLPTFTCAETEKNLLEAAGIIRDTSETVAFPTETVYGLG 69

Query: 78  GSALNDNSVLSIYRAKNRPSDNPLITHVSSIDQLNRKVFNQPHLSGTSLFDNIPSIYRPL 137
           GSALND SV +IY+AKNRPSDNPLITH+SS+ QLNR +++        L  ++P IY PL
Sbjct: 70  GSALNDESVKNIYKAKNRPSDNPLITHISSLSQLNRVIYSDISDDCKPL-SHVPEIYHPL 128

Query: 138 ISSLWPGPLTILLPVP-SSEHSALSKLTTADQPTFAVRIPANPVARALIALSDTPIAAPS 196
           +  LWPGPLTILL +P  S  + LSKLTTA+QPTFA RIPANP+ARALIALSDTPIAAPS
Sbjct: 129 VEKLWPGPLTILLSIPDGSNRNTLSKLTTANQPTFACRIPANPIARALIALSDTPIAAPS 188

Query: 197 ANASTRPSPTLASHVYHDLKDKIPIILDGGACKVGVESTVVDGLCNPPTLLRPGGFTYEE 256
           ANASTRPSPT A HV+HDL  +IP+ILDGG C VGVESTVVDGL  PP LLRPGGFTYE 
Sbjct: 189 ANASTRPSPTTAEHVFHDLNGRIPLILDGGKCSVGVESTVVDGLVTPPMLLRPGGFTYEN 248

Query: 257 IVKLGGEAWSLCKVENKKTVEKGEKVRTPGMKYRHYSPSAKVVLLVPHCEGDGILKGVDR 316
           I+ +GG  W  C VE K  ++  EKV+TPGMKYRHYSP AKV+LLVP  EGD  +   +R
Sbjct: 249 ILNIGGPLWKECLVETKVNIKDDEKVKTPGMKYRHYSPKAKVILLVP--EGDSQIISSER 306

Query: 317 MERLKRLIETELKANSNIKKIAILTSLKLRDSDLQSKIFNEPDFSSKTFIIERLGQSGEE 376
           + RLK L++ E+      KK+A L SL L    +  K  +           E LG +G+E
Sbjct: 307 LGRLKSLVDKEI-IQQGAKKVAFLNSLHLNKHFIDGKCIH-----------ESLGTTGKE 354

Query: 377 IQTNLFAALRKVDENDKVDLIFVEGINEEGEGLAVMNRLRKAA 419
           IQ NLFA LRKVDE D VDLI VEG     EGLA+MNRLRKAA
Sbjct: 355 IQANLFALLRKVDEEDNVDLIVVEGTEANEEGLAIMNRLRKAA 397

>Scas_707.49
          Length = 441

 Score =  486 bits (1250), Expect = e-171,   Method: Compositional matrix adjust.
 Identities = 258/420 (61%), Positives = 312/420 (74%), Gaps = 19/420 (4%)

Query: 3   LGRHFLAMTSKAL--FDTKILKVNPLSIIFSPDAHIDGSLPTITDPETEAALVEAARIIR 60
           L R  +  T+ A   F TKI KV+P  I F  ++HIDG+LP ITDP TE+AL+EAA+IIR
Sbjct: 30  LARRLITTTTMASPSFQTKIAKVDPTKIFFPENSHIDGTLPIITDPITESALLEAAQIIR 89

Query: 61  DTDETVAFPTETVYGLGGSALNDNSVLSIYRAKNRPSDNPLITHVSSIDQLNRKVFNQPH 120
           DTD+TVAFPTETVYGLGGSALND SV++IY+AKNRPSDNPLITHVSSI+QLNRK+F + H
Sbjct: 90  DTDQTVAFPTETVYGLGGSALNDQSVINIYKAKNRPSDNPLITHVSSINQLNRKIF-KSH 148

Query: 121 LSGTSLFDNIPSIYRPLISSLWPGPLTILLPVPSSEHSALSKLTTADQPTFAVRIPANPV 180
            + +SL  NIP IY  LI +LWPGPLTILLP  ++    LS  TT  QPTFAVRIP+N +
Sbjct: 149 KTDSSL-QNIPIIYHKLIKTLWPGPLTILLPTENTR-GTLSVKTTNSQPTFAVRIPSNVI 206

Query: 181 ARALIALSDTPIAAPSANASTRPSPTLASHVYHDLKDKIPIILDGGACKVGVESTVVDGL 240
           ARALIALSDTPIAAPSAN ST+PSPTLASHV+HDLK KIP+ILDGG C VGVESTV+DGL
Sbjct: 207 ARALIALSDTPIAAPSANTSTKPSPTLASHVFHDLKGKIPLILDGGPCNVGVESTVLDGL 266

Query: 241 CNPPTLLRPGGFTYEEIVKLGGEAWSLCKVENKKTVEKGEKVRTPGMKYRHYSPSAKVVL 300
             PP LLRPGG T E I++LGG+ W  CKVENK+ V++GE VRTPGMKY+HYSP AKV+L
Sbjct: 267 SRPPMLLRPGGLTLEHILELGGQDWIDCKVENKQNVKQGETVRTPGMKYKHYSPDAKVIL 326

Query: 301 LVPHCEGDGILKGVDRMERLKRLIETELKANSNIKKIAILTSLKLRDSDLQSKIF-NEPD 359
           L+P  + +        +  L  ++  E       KKIAILT   L   + + K+F N  D
Sbjct: 327 LIPPPDSNQRPTVKSYLHELNEIVGQEKG-----KKIAILTGPIL---NREEKLFPNNTD 378

Query: 360 FSSKTFIIERLGQSGEEIQTNLFAALRKVDENDKVDLIFVEGINEEGEGLAVMNRLRKAA 419
                 I++ LG  G EIQ NLFA LR+ DE D VD++ VEG +E+GEGLA+MNRL+KA+
Sbjct: 379 -----IIVKHLGDEGNEIQANLFAMLREADEIDNVDVMIVEGSSEDGEGLAIMNRLKKAS 433

>YNL097C (PHO23) [4494] chr14 complement(441366..442358) Protein
           involved in chromatin remodeling and possibly
           transcription regulation, involved in expression of PHO5
           [993 bp, 330 aa]
          Length = 330

 Score = 33.9 bits (76), Expect = 0.23,   Method: Compositional matrix adjust.
 Identities = 30/113 (26%), Positives = 49/113 (43%), Gaps = 22/113 (19%)

Query: 108 IDQLNRKVFNQPHLSGTSLFDNIPSIYRPLISSLWPGPLTILLPVPSSEHSALSKLTTAD 167
           ID+  +K FN+ H +   L +NI  IY  L+ SL        + V S     L +LT+  
Sbjct: 50  IDKFLKKDFNKDHQTQVRLLNNINKIYEELMPSLEEK-----MHVSSIMLDNLDRLTSRL 104

Query: 168 QPTFAVRIPANPVARAL-IALSDTPIAAPSANASTRPSPTLASHVYHDLKDKI 219
           +  + V I    + R L + + + P                A H++H+L +KI
Sbjct: 105 ELAYEVAIKNTEIPRGLRLGVDNHP----------------AMHLHHELMEKI 141

  Database: blastdb
    Posted date:  Apr 3, 2006  3:33 PM
  Number of letters in database: 16,596,109
  Number of sequences in database:  34,618
  
Lambda     K      H
   0.316    0.134    0.384 

Gapped
Lambda     K      H
   0.267   0.0410    0.140 

Matrix: BLOSUM62
Gap Penalties: Existence: 11, Extension: 1
Number of Sequences: 34618
Number of Hits to DB: 13,817,956
Number of extensions: 615711
Number of successful extensions: 2014
Number of sequences better than 10.0: 29
Number of HSP's gapped: 2030
Number of HSP's successfully gapped: 30
Length of query: 419
Length of database: 16,596,109
Length adjustment: 104
Effective length of query: 315
Effective length of database: 12,995,837
Effective search space: 4093688655
Effective search space used: 4093688655
Neighboring words threshold: 11
Window for multiple hits: 40
X1: 16 ( 7.3 bits)
X2: 38 (14.6 bits)
X3: 64 (24.7 bits)
S1: 41 (21.6 bits)
S2: 63 (28.9 bits)