Hit NameLength (aa)HSP LengthHSP ScoreHSP Significance
YGL167C (PMR1)95093447740.0
CAGL0I04312g95194138000.0
Kwal_14.149893993535110.0
AEL301W95794033980.0
KLLA0A03157g93893533310.0
Scas_707.48*74174231450.0
CAGL0J01870g94691429600.0
Kwal_23.316011009239561e-113
CAGL0K12034g108710109411e-110
KLLA0E14630g10829049191e-107
YDR040C (ENA1)10919209141e-107
YDR039C (ENA2)10919209111e-106
KLLA0F20658g10829119101e-106
YDR038C (ENA5)10919209091e-106
AGL097C10969159061e-105
Kwal_47.17547124010168321e-94
YGL006W (PMC1)117310308011e-90
CAGL0A00517g11229737603e-85
AFL011W12429907211e-79
KLLA0A08910g12809956787e-74
YGL008C (PMA1)9187425653e-60
AGL085C9096975635e-60
Kwal_47.175228996995547e-59
KLLA0A09031g8997345493e-58
YPL036W (PMA2)9477055487e-58
Scas_688.19136995469e-58
Scas_710.419047005202e-54
CAGL0A00495g9026975023e-52
Scas_569.0d4681893402e-33
Scas_297.18002733482e-33
KLLA0B08217g14398593041e-27
AFR567W14499222807e-25
Kwal_26.920714699212798e-25
Scas_665.3014398182717e-24
CAGL0M11308g14528072672e-23
CAGL0L01419g12147202422e-20
YEL031W (SPF1)12157352271e-18
YOR291W14729482262e-18
Scas_583.14*8755152181e-17
KLLA0F07447g9751712162e-17
YIL048W (NEO1)11516682162e-17
Sklu_2193.111437722021e-15
KLLA0E22352g12067142021e-15
ADL079C11666732011e-15
Scas_704.3811616911974e-15
AFR354C12107631957e-15
CAGL0L00715g11446731948e-15
ACR086C8101671812e-13
Kwal_23.578911337941823e-13
KLLA0C08393g11486521804e-13
ADR350W13114481761e-12
Scas_615.99422771752e-12
Kwal_26.707013156931724e-12
YDR270W (CCC2)10041501715e-12
CAGL0M08602g10121371643e-11
KLLA0A04015g13434511635e-11
Kwal_55.215759892671545e-10
KLLA0D04092g11521411536e-10
AGL041C12331731529e-10
CAGL0G06270g13287061511e-09
YAL026C (DRS2)13553591367e-08
YBR295W (PCA1)12162511303e-07
KLLA0E01650g15502011196e-06
Scas_89.12711921112e-05
AFL191W15751821143e-05
CAGL0H04477g16262331035e-04
Scas_576.815912111035e-04
Scas_669.31638153990.001
YER166W (DNF1)1571182930.007
YMR162C (DNF3)1656200920.012
Kwal_23.35561597180900.016
Scas_636.161554210870.044
KLLA0C17644g1576288860.048
CAGL0L11814g1576293850.077
YDR093W (DNF2)1612225840.084
CAGL0G08085g1578182840.100
Scas_227.0d30732731.2
AGR120C154745741.5
CAGL0M13189g541114686.1
CAGL0E04950g67341677.8
BLASTP 2.2.26 [Sep-21-2011]

Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, 
Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), 
"Gapped BLAST and PSI-BLAST: a new generation of protein database search
programs",  Nucleic Acids Res. 25:3389-3402.

Reference for compositional score matrix adjustment: Altschul, Stephen F., 
John C. Wootton, E. Michael Gertz, Richa Agarwala, Aleksandr Morgulis,
Alejandro A. Schaffer, and Yi-Kuo Yu (2005) "Protein database searches
using compositionally adjusted substitution matrices", FEBS J. 272:5101-5109.

Query= YGL167C
         (934 letters)

Database: blastdb 
           34,618 sequences; 16,596,109 total letters

Searching..................................................done

                                                                 Score    E
Sequences producing significant alignments:                      (bits) Value

YGL167C (PMR1) [1823] chr7 complement(187620..190472) Ca2+-trans...  1843   0.0  
CAGL0I04312g complement(382354..385209) highly similar to sp|P13...  1468   0.0  
Kwal_14.1498                                                         1357   0.0  
AEL301W [2204] [Homologous to ScYGL167C (PMR1) - SH] complement(...  1313   0.0  
KLLA0A03157g complement(281313..284129) gi|3288523|emb|CAA04476....  1287   0.0  
Scas_707.48*                                                         1216   0.0  
CAGL0J01870g 181666..184506 highly similar to sp|P13586 Saccharo...  1144   0.0  
Kwal_23.3160                                                          372   e-113
CAGL0K12034g complement(1161299..1164562) highly similar to sp|P...   367   e-110
KLLA0E14630g complement(1297636..1300884) similar to sp|Q01896 S...   358   e-107
YDR040C (ENA1) [893] chr4 complement(535187..538462) P-type ATPa...   356   e-107
YDR039C (ENA2) [892] chr4 complement(531302..534577) Member of t...   355   e-106
KLLA0F20658g 1919851..1923099 similar to sp|Q12691 Saccharomyces...   355   e-106
YDR038C (ENA5) [891] chr4 complement(527417..530692) Member of t...   354   e-106
AGL097C [4215] [Homologous to ScYDR039C (ENA2 ) - NSH] (520915.....   353   e-105
Kwal_47.17547                                                         325   1e-94
YGL006W (PMC1) [1966] chr7 (485923..489444) Vacuolar Ca2+-transp...   313   1e-90
CAGL0A00517g 58830..62198 similar to sp|P38929 Saccharomyces cer...   297   3e-85
AFL011W [3182] [Homologous to ScYGL006W (PMC1) - SH] complement(...   282   1e-79
KLLA0A08910g complement(779526..783368) similar to sp|P38929 Sac...   265   7e-74
YGL008C (PMA1) [1965] chr7 complement(479913..482669) H+-transpo...   222   3e-60
AGL085C [4226] [Homologous to ScYGL008C (PMA1) - SH; ScYPL036W (...   221   5e-60
Kwal_47.17522                                                         218   7e-59
KLLA0A09031g 787768..790467 gi|1346734|sp|P49380|PMA1_KLULA Kluy...   216   3e-58
YPL036W (PMA2) [5403] chr16 (482839..485682) H[+]-transporting P...   215   7e-58
Scas_688.1                                                            214   9e-58
Scas_710.41                                                           204   2e-54
CAGL0A00495g complement(55014..57722) highly similar to sp|P0503...   197   3e-52
Scas_569.0d                                                           135   2e-33
Scas_297.1                                                            138   2e-33
KLLA0B08217g complement(724364..728683) similar to sp|Q12697 Sac...   121   1e-27
AFR567W [3759] [Homologous to ScYOR291W - SH] complement(1455295...   112   7e-25
Kwal_26.9207                                                          112   8e-25
Scas_665.30                                                           108   7e-24
CAGL0M11308g 1110211..1114569 similar to sp|Q12697 Saccharomyces...   107   2e-23
CAGL0L01419g 156123..159767 highly similar to sp|P39986 Saccharo...    98   2e-20
YEL031W (SPF1) [1394] chr5 (90258..93905) Putative Ca2+-transpor...    92   1e-18
YOR291W (YOR291W) [5075] chr15 (861172..865590) Member of the ca...    92   2e-18
Scas_583.14*                                                           89   1e-17
KLLA0F07447g 700685..703612 similar to sp|P38995 Saccharomyces c...    88   2e-17
YIL048W (NEO1) [2619] chr9 (261436..264891) Member of the Drs2p-...    88   2e-17
Sklu_2193.1 YIL048W, Contig c2193 334-3765 reverse complement          82   1e-15
KLLA0E22352g 1984522..1988142 highly similar to sp|P39986 Saccha...    82   1e-15
ADL079C [1662] [Homologous to ScYIL048W (NEO1) - SH] (544854..54...    82   1e-15
Scas_704.38                                                            80   4e-15
AFR354C [3546] [Homologous to ScYEL031W (SPF1) - SH] (1078275..1...    80   7e-15
CAGL0L00715g 86810..90244 highly similar to sp|P40527 Saccharomy...    79   8e-15
ACR086C [1133] [Homologous to ScYDR270W (CCC2) - SH] (511968..51...    74   2e-13
Kwal_23.5789                                                           75   3e-13
KLLA0C08393g 734655..738101 highly similar to sp|P40527 Saccharo...    74   4e-13
ADR350W [2091] [Homologous to ScYAL026C (DRS2) - SH] complement(...    72   1e-12
Scas_615.9                                                             72   2e-12
Kwal_26.7070                                                           71   4e-12
YDR270W (CCC2) [1102] chr4 (1005667..1008681) Copper-transportin...    70   5e-12
CAGL0M08602g complement(856349..859387) similar to sp|P38995 Sac...    68   3e-11
KLLA0A04015g complement(355624..359655) similar to sp|P39524 Sac...    67   5e-11
Kwal_55.21575                                                          64   5e-10
KLLA0D04092g complement(344666..348124) some similarities with s...    64   6e-10
AGL041C [4270] [Homologous to ScYDR270W - NSH] (628428..632129) ...    63   9e-10
CAGL0G06270g 598357..602343 highly similar to sp|P39524 Saccharo...    63   1e-09
YAL026C (DRS2) [42] chr1 complement(95633..99700) Membrane-spann...    57   7e-08
YBR295W (PCA1) [472] chr2 (792805..796455) P-type copper-transpo...    55   3e-07
KLLA0E01650g complement(155975..160627) similar to sp|Q12674 Sac...    50   6e-06
Scas_89.1                                                              47   2e-05
AFL191W [3004] [Homologous to ScYMR162C (DNF3) - SH] complement(...    49   3e-05
CAGL0H04477g 421857..426737 similar to sp|Q12674 Saccharomyces c...    44   5e-04
Scas_576.8                                                             44   5e-04
Scas_669.3                                                             43   0.001
YER166W (DNF1) [1594] chr5 (512739..517454) Member of the haloac...    40   0.007
YMR162C (DNF3) [4117] chr13 complement(578950..583920) Member of...    40   0.012
Kwal_23.3556                                                           39   0.016
Scas_636.16                                                            38   0.044
KLLA0C17644g 1557138..1561868 similar to sp|P32660 Saccharomyces...    38   0.048
CAGL0L11814g 1262124..1266854 highly similar to sp|P32660 Saccha...    37   0.077
YDR093W (DNF2) [945] chr4 (631276..636114) Member of the haloaci...    37   0.084
CAGL0G08085g 763185..767921 highly similar to sp|Q12675 Saccharo...    37   0.100
Scas_227.0d                                                            33   1.2  
AGR120C [4431] [Homologous to ScYER166W (DNF1) - SH; ScYDR093W (...    33   1.5  
CAGL0M13189g complement(1294293..1295918) weakly similar to sp|P...    31   6.1  
CAGL0E04950g 478626..480647 similar to sp|P53118 Saccharomyces c...    30   7.8  

>YGL167C (PMR1) [1823] chr7 complement(187620..190472)
           Ca2+-transporting P-type ATPase of Golgi membrane
           involved in Ca2+ and Mn2+ import into Golgi [2853 bp,
           950 aa]
          Length = 950

 Score = 1843 bits (4774), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 903/934 (96%), Positives = 903/934 (96%)

Query: 1   MSDNPFNASLLDEDSNREREILDATAEALSKPSPSLEYCTLSVDEALEKLDTDKNGGLRS 60
           MSDNPFNASLLDEDSNREREILDATAEALSKPSPSLEYCTLSVDEALEKLDTDKNGGLRS
Sbjct: 1   MSDNPFNASLLDEDSNREREILDATAEALSKPSPSLEYCTLSVDEALEKLDTDKNGGLRS 60

Query: 61  SNEANNRRSLYGPNEITVEDDESLFKKFLSNFIEDRMILLLIGSAVVSLFMGNIDDAVSI 120
           SNEANNRRSLYGPNEITVEDDESLFKKFLSNFIEDRMILLLIGSAVVSLFMGNIDDAVSI
Sbjct: 61  SNEANNRRSLYGPNEITVEDDESLFKKFLSNFIEDRMILLLIGSAVVSLFMGNIDDAVSI 120

Query: 121 TLAIFIVVTVGFVQEYRSEKSLEALNKLVPAECHLMRCGQESHVLASTLVPGDLVHFRIG 180
           TLAIFIVVTVGFVQEYRSEKSLEALNKLVPAECHLMRCGQESHVLASTLVPGDLVHFRIG
Sbjct: 121 TLAIFIVVTVGFVQEYRSEKSLEALNKLVPAECHLMRCGQESHVLASTLVPGDLVHFRIG 180

Query: 181 DRIPADIRIIEAIDLSIDESNLTGENEPVHKTSQTIEKSSFNDQPNSIVPISERSCIAYM 240
           DRIPADIRIIEAIDLSIDESNLTGENEPVHKTSQTIEKSSFNDQPNSIVPISERSCIAYM
Sbjct: 181 DRIPADIRIIEAIDLSIDESNLTGENEPVHKTSQTIEKSSFNDQPNSIVPISERSCIAYM 240

Query: 241 GTLVKEGHGKGIVVGTGTNTSFGAVFEMMNNIEKPKTPLQLTMDKLGKDLSLVSFIVIGM 300
           GTLVKEGHGKGIVVGTGTNTSFGAVFEMMNNIEKPKTPLQLTMDKLGKDLSLVSFIVIGM
Sbjct: 241 GTLVKEGHGKGIVVGTGTNTSFGAVFEMMNNIEKPKTPLQLTMDKLGKDLSLVSFIVIGM 300

Query: 301 ICLVGIIQGRSWLEMFQISVSLAVAAIPEGLPIIVTVTLALGVLRMAKRKAIVRRLPSVE 360
           ICLVGIIQGRSWLEMFQISVSLAVAAIPEGLPIIVTVTLALGVLRMAKRKAIVRRLPSVE
Sbjct: 301 ICLVGIIQGRSWLEMFQISVSLAVAAIPEGLPIIVTVTLALGVLRMAKRKAIVRRLPSVE 360

Query: 361 TLGSVNVICSDKTGTLTSNHMTVSKLWCLDSMSNKLNVLSLDKNKKTKNSNGNLKNYLTE 420
           TLGSVNVICSDKTGTLTSNHMTVSKLWCLDSMSNKLNVLSLDKNKKTKNSNGNLKNYLTE
Sbjct: 361 TLGSVNVICSDKTGTLTSNHMTVSKLWCLDSMSNKLNVLSLDKNKKTKNSNGNLKNYLTE 420

Query: 421 DVRETLTIGNLCNNASFSQEHAIFLGNPTDVALLEQLANFEMPDIRNTVQKVQELPFNSK 480
           DVRETLTIGNLCNNASFSQEHAIFLGNPTDVALLEQLANFEMPDIRNTVQKVQELPFNSK
Sbjct: 421 DVRETLTIGNLCNNASFSQEHAIFLGNPTDVALLEQLANFEMPDIRNTVQKVQELPFNSK 480

Query: 481 RKLMATKILNPVDNKCTVYVKGAFERILEYSTSYLKSKGKKTEKLTEAQKATINECANSM 540
           RKLMATKILNPVDNKCTVYVKGAFERILEYSTSYLKSKGKKTEKLTEAQKATINECANSM
Sbjct: 481 RKLMATKILNPVDNKCTVYVKGAFERILEYSTSYLKSKGKKTEKLTEAQKATINECANSM 540

Query: 541 ASEGLRVFGFAKLTLSDSSTPLTEDLIKDLTFTGLIGMNDPPRPNVKFAIEQLLQGGVHI 600
           ASEGLRVFGFAKLTLSDSSTPLTEDLIKDLTFTGLIGMNDPPRPNVKFAIEQLLQGGVHI
Sbjct: 541 ASEGLRVFGFAKLTLSDSSTPLTEDLIKDLTFTGLIGMNDPPRPNVKFAIEQLLQGGVHI 600

Query: 601 IMITGDSENTAVNIAKQIGIPVIDPKLSVLSGDKLDEMSDDQLANVIDHVNIFARATPEH 660
           IMITGDSENTAVNIAKQIGIPVIDPKLSVLSGDKLDEMSDDQLANVIDHVNIFARATPEH
Sbjct: 601 IMITGDSENTAVNIAKQIGIPVIDPKLSVLSGDKLDEMSDDQLANVIDHVNIFARATPEH 660

Query: 661 KLNIVRALRKRGDVVAMTGDGVNDAPALKLSDIGVSMGRIGTDVAKEASDMVLTDDDFST 720
           KLNIVRALRKRGDVVAMTGDGVNDAPALKLSDIGVSMGRIGTDVAKEASDMVLTDDDFST
Sbjct: 661 KLNIVRALRKRGDVVAMTGDGVNDAPALKLSDIGVSMGRIGTDVAKEASDMVLTDDDFST 720

Query: 721 ILTAIEEGKGIFNNIQNFLTFQXXXXXXXXXXXXXXXXFKLPNPLNAMQILWINILMDGP 780
           ILTAIEEGKGIFNNIQNFLTFQ                FKLPNPLNAMQILWINILMDGP
Sbjct: 721 ILTAIEEGKGIFNNIQNFLTFQLSTSVAALSLVALSTAFKLPNPLNAMQILWINILMDGP 780

Query: 781 PAQSLGVEPVDHEVMKKPPRKRTDKILTHDVMKRLLTTAACIIVGTVYIFVKEMAEDGKV 840
           PAQSLGVEPVDHEVMKKPPRKRTDKILTHDVMKRLLTTAACIIVGTVYIFVKEMAEDGKV
Sbjct: 781 PAQSLGVEPVDHEVMKKPPRKRTDKILTHDVMKRLLTTAACIIVGTVYIFVKEMAEDGKV 840

Query: 841 TARDTTMTFTCFVFFDMFNALACRHNTKSIFEIGFFTNKMFNYAVGLSLLGQMCAIYIPF 900
           TARDTTMTFTCFVFFDMFNALACRHNTKSIFEIGFFTNKMFNYAVGLSLLGQMCAIYIPF
Sbjct: 841 TARDTTMTFTCFVFFDMFNALACRHNTKSIFEIGFFTNKMFNYAVGLSLLGQMCAIYIPF 900

Query: 901 FQSIFKTEKXXXXXXXXXXXXXXXVFIVDELRKL 934
           FQSIFKTEK               VFIVDELRKL
Sbjct: 901 FQSIFKTEKLGISDILLLLLISSSVFIVDELRKL 934

>CAGL0I04312g complement(382354..385209) highly similar to sp|P13586
           Saccharomyces cerevisiae YGL167c PMR1 Ca2+-transporting
           P-type ATPase, start by similarity
          Length = 951

 Score = 1468 bits (3800), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 726/941 (77%), Positives = 814/941 (86%), Gaps = 15/941 (1%)

Query: 1   MSDNPFNASLLDEDS--------NREREILDATAEALSKPSPSLEYCTLSVDEALEKLDT 52
           MSDNPF     D+D+        ++E+EIL+AT  AL+KP+PSLEYCTLSV+E L KLDT
Sbjct: 1   MSDNPFTYYDKDKDAGGSSASLNSQEKEILEATNAALTKPNPSLEYCTLSVEETLHKLDT 60

Query: 53  DKNGGLRSSNEANNRRSLYGPNEITVEDDESLFKKFLSNFIEDRMILLLIGSAVVSLFMG 112
           D   GL S  EA  RR  YGPNEI+V+DDESL KKFLSNF+EDR+ILLL+GSA++S+F+G
Sbjct: 61  DAKLGLSSVEEATKRRQYYGPNEISVDDDESLVKKFLSNFVEDRLILLLMGSAIISVFLG 120

Query: 113 NIDDAVSITLAIFIVVTVGFVQEYRSEKSLEALNKLVPAECHLMRCGQESHVLASTLVPG 172
           NIDDA+SIT+AI IVVTVGFVQEYRSEKSLEALNKLVP ECHL+R G+ES+VLA+ LVPG
Sbjct: 121 NIDDAISITMAIVIVVTVGFVQEYRSEKSLEALNKLVPQECHLIRGGRESNVLATNLVPG 180

Query: 173 DLVHFRIGDRIPADIRIIEAIDLSIDESNLTGENEPVHKTSQTIEKSSFNDQPNSIVPIS 232
           DLV FRIGDRIPADIRIIE  DL+IDESNLTGE +PVHK+ + + + S+NDQPNSIVP++
Sbjct: 181 DLVRFRIGDRIPADIRIIECNDLTIDESNLTGETDPVHKSYKALSRDSYNDQPNSIVPVA 240

Query: 233 ERSCIAYMGTLVKEGHGKGIVVGTGTNTSFGAVFEMMNNIEKPKTPLQLTMDKLGKDLSL 292
           ER+ IAYMGTLVKEG+G+GIVVGTG  TSFG VFEMM++IEKPKTPLQLTMDKLGKDLSL
Sbjct: 241 ERTNIAYMGTLVKEGNGRGIVVGTGRETSFGNVFEMMSSIEKPKTPLQLTMDKLGKDLSL 300

Query: 293 VSFIVIGMICLVGIIQGRSWLEMFQISVSLAVAAIPEGLPIIVTVTLALGVLRMAKRKAI 352
            SF+VIG+IC+VGIIQGRSWLEMFQISVSLAVAAIPEGLPIIVTVTLALGVLRMAKRKAI
Sbjct: 301 ASFVVIGIICVVGIIQGRSWLEMFQISVSLAVAAIPEGLPIIVTVTLALGVLRMAKRKAI 360

Query: 353 VRRLPSVETLGSVNVICSDKTGTLTSNHMTVSKLWCLDSMSNKLNVLSLDKNKKTKNSNG 412
           VRRLPSVETLGSVNVICSDKTGTLTSNHMTVSK+WCL SM+NKLNVLSLDKNK      G
Sbjct: 361 VRRLPSVETLGSVNVICSDKTGTLTSNHMTVSKIWCLGSMANKLNVLSLDKNK-----GG 415

Query: 413 NLKNYLTEDVRETLTIGNLCNNASFSQEHAIFLGNPTDVALLEQLANFEMPDIRNTVQKV 472
           NLKNYLT+DV+ TL  GNLCNNAS+SQEHA +LGNPTDVALLEQL  FE+ D+R+   KV
Sbjct: 416 NLKNYLTDDVKTTLLCGNLCNNASYSQEHAKYLGNPTDVALLEQLQKFELADVRSEYTKV 475

Query: 473 QELPFNSKRKLMATKILNPVDNKCTVYVKGAFERILEYSTSYLKSKGKKTEKLTEAQKAT 532
           +EL FNSKRK+MATKI +  + K T+++KGAFERIL+ S+SYL  KG K EKLT   + T
Sbjct: 476 KELSFNSKRKMMATKIQDN-EKKTTLFIKGAFERILDKSSSYLTEKG-KIEKLTAGHRET 533

Query: 533 INECANSMASEGLRVFGFAKLTLSDSSTPLTEDLIKDLTFTGLIGMNDPPRPNVKFAIEQ 592
           I +CAN++ASEGLRV  FAK  ++DSS+ L ED I DL FTGLIGMNDPPR +VKFAI+Q
Sbjct: 534 IIDCANTLASEGLRVLAFAKRAMTDSSSKLVEDDISDLVFTGLIGMNDPPRSSVKFAIDQ 593

Query: 593 LLQGGVHIIMITGDSENTAVNIAKQIGIPVIDPKLSVLSGDKLDEMSDDQLANVIDHVNI 652
            LQGG+HIIMITGDSENTAVNIA+QIGIPVIDPKLSVLSGDKL+EM+DDQLANVIDHVNI
Sbjct: 594 FLQGGIHIIMITGDSENTAVNIARQIGIPVIDPKLSVLSGDKLNEMTDDQLANVIDHVNI 653

Query: 653 FARATPEHKLNIVRALRKRGDVVAMTGDGVNDAPALKLSDIGVSMGRIGTDVAKEASDMV 712
           FARATPEHKLNIVRALR+RGDVVAMTGDGVNDAPALKL+DIGVSMGR+GTDVAKEASDM+
Sbjct: 654 FARATPEHKLNIVRALRRRGDVVAMTGDGVNDAPALKLADIGVSMGRMGTDVAKEASDMI 713

Query: 713 LTDDDFSTILTAIEEGKGIFNNIQNFLTFQXXXXXXXXXXXXXXXXFKLPNPLNAMQILW 772
           LTDDDFSTILTAIEEGKGIFNNIQNFL+FQ                F LPNPLNAMQILW
Sbjct: 714 LTDDDFSTILTAIEEGKGIFNNIQNFLSFQLSTSIAALSLVALSTAFMLPNPLNAMQILW 773

Query: 773 INILMDGPPAQSLGVEPVDHEVMKKPPRKRTDKILTHDVMKRLLTTAACIIVGTVYIFVK 832
           INILMDGPPAQSLGVEPVDHEVMKKPPRKRTDKILT +++KRL+ TA+CII+GTVY+FVK
Sbjct: 774 INILMDGPPAQSLGVEPVDHEVMKKPPRKRTDKILTAELLKRLIGTASCIILGTVYVFVK 833

Query: 833 EMAEDGKVTARDTTMTFTCFVFFDMFNALACRHNTKSIFEIGFFTNKMFNYAVGLSLLGQ 892
           EMAEDG+VTARDTTMTFTCFVFFDMFNALACRH TKSIFEIGFFTNKMFN AVG SLLGQ
Sbjct: 834 EMAEDGQVTARDTTMTFTCFVFFDMFNALACRHTTKSIFEIGFFTNKMFNLAVGFSLLGQ 893

Query: 893 MCAIYIPFFQSIFKTEKXXXXXXXXXXXXXXXVFIVDELRK 933
           MCAIYIPFFQ+IFKTE                VFI+DE+RK
Sbjct: 894 MCAIYIPFFQAIFKTESLAFSDLIFLAMISSSVFIIDEIRK 934

>Kwal_14.1498
          Length = 939

 Score = 1357 bits (3511), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 658/935 (70%), Positives = 770/935 (82%), Gaps = 13/935 (1%)

Query: 1   MSDNPFNASLLDEDSNREREILDATAEALSKPSPSLEYCTLSVDEALEKLDTDKNGGLRS 60
           MSDNPFN S LD   +RE     +TAE LS+P PSLE+C+LSV+E  + L TD   GL +
Sbjct: 1   MSDNPFN-SYLDRSKDREA----STAEVLSRPQPSLEFCSLSVEETAQSLGTDTQNGLPT 55

Query: 61  SNEANNRRSLYGPNEITVEDDESLFKKFLSNFIEDRMILLLIGSAVVSLFMGNIDDAVSI 120
            +    RR+ YG NEI+ E+DE L+ KF++ F+ D +ILLLIGSAV+S  MGNIDDAVSI
Sbjct: 56  MSVVEERRAQYGKNEISSEEDEPLWWKFVTTFVGDPLILLLIGSAVISFIMGNIDDAVSI 115

Query: 121 TLAIFIVVTVGFVQEYRSEKSLEALNKLVPAECHLMRCGQESHVLASTLVPGDLVHFRIG 180
           TLAI IVVTVGFVQEYRSEKSLEALN+LVP +CHL+RCGQES +LAS LVPGD+V FR+G
Sbjct: 116 TLAIVIVVTVGFVQEYRSEKSLEALNRLVPDQCHLIRCGQESKLLASVLVPGDVVRFRVG 175

Query: 181 DRIPADIRIIEAIDLSIDESNLTGENEPVHKTSQTIEKSSFNDQPNSIVPISERSCIAYM 240
           DRIPAD+RIIEA+DLSI+ESNLTGENEPVHK++ T+ K  + +   SIVP+SERSCIA+M
Sbjct: 176 DRIPADLRIIEAVDLSIEESNLTGENEPVHKSTATVNKEFYKENLGSIVPVSERSCIAFM 235

Query: 241 GTLVKEGHGKGIVVGTGTNTSFGAVFEMMNNIEKPKTPLQLTMDKLGKDLSLVSFIVIGM 300
           GTLV+EGHG+GIV+GT  NT+FG VFEMMN IEKPKTPLQ  MDKLGKDLS +SFIVIG+
Sbjct: 236 GTLVREGHGRGIVIGTAKNTAFGKVFEMMNAIEKPKTPLQTAMDKLGKDLSFMSFIVIGI 295

Query: 301 ICLVGIIQGRSWLEMFQISVSLAVAAIPEGLPIIVTVTLALGVLRMAKRKAIVRRLPSVE 360
           ICL+G+IQGRSWLEMFQISVSLAVAAIPEGLPIIVTVTLALGVLRMAKR+AI+RRLPSVE
Sbjct: 296 ICLIGVIQGRSWLEMFQISVSLAVAAIPEGLPIIVTVTLALGVLRMAKRRAIIRRLPSVE 355

Query: 361 TLGSVNVICSDKTGTLTSNHMTVSKLWCLDSMSNKLNVLSLDKNKKTKNSNGNLKNYLTE 420
           TLGSVNVICSDKTGTLT+NHM+V+K+WCL SMSNK N+L LD     K ++G+ K  LTE
Sbjct: 356 TLGSVNVICSDKTGTLTANHMSVNKVWCLGSMSNKSNILKLD-----KATSGSFKKNLTE 410

Query: 421 DVRETLTIGNLCNNASFSQEHAIFLGNPTDVALLEQLANFEMPDIRNTVQKVQELPFNSK 480
           D+R TL  GNLCNN+++S EHA +LGNPTD+ALLE L  F + D R  V +  E+ FNSK
Sbjct: 411 DLRATLRTGNLCNNSTYSHEHAKYLGNPTDIALLEVLHKFGLEDERPQVTRSDEISFNSK 470

Query: 481 RKLMATKILNPVDNKCTVYVKGAFERILEYSTSYLKSKGKKTEKLTEAQKATINECANSM 540
           RK MA K+    + K  V+VKGA+E+ILE ST ++ ++ K   KL    +  I + A+++
Sbjct: 471 RKFMAVKV-KEANGKFVVHVKGAYEKILEKSTHFINAENKVV-KLDSNLRQAITDSADAL 528

Query: 541 ASEGLRVFGFAKLTLSD-SSTPLTEDLIKDLTFTGLIGMNDPPRPNVKFAIEQLLQGGVH 599
           AS+GLR   FA+L LS+ +S  LTED I  LTF GL+GMNDPPRP+VK A+E+L +G VH
Sbjct: 529 ASDGLRTLAFAQLELSNGNSKKLTEDDINGLTFAGLLGMNDPPRPSVKAAVERLSEGSVH 588

Query: 600 IIMITGDSENTAVNIAKQIGIPVIDPKLSVLSGDKLDEMSDDQLANVIDHVNIFARATPE 659
           IIMITGD+ENTAV+IA+QIGIPV++P+ +VL+GDKLD MS+DQLA++IDHVNIFARATPE
Sbjct: 589 IIMITGDAENTAVSIARQIGIPVVNPETAVLTGDKLDHMSEDQLASIIDHVNIFARATPE 648

Query: 660 HKLNIVRALRKRGDVVAMTGDGVNDAPALKLSDIGVSMGRIGTDVAKEASDMVLTDDDFS 719
           HKLNIVRAL+KRGD+VAMTGDGVNDAPALKL+DIGVSMG++GTDVAKEASDMVLTDDDFS
Sbjct: 649 HKLNIVRALQKRGDIVAMTGDGVNDAPALKLADIGVSMGKMGTDVAKEASDMVLTDDDFS 708

Query: 720 TILTAIEEGKGIFNNIQNFLTFQXXXXXXXXXXXXXXXXFKLPNPLNAMQILWINILMDG 779
           TILTAIEEGKGIFNNIQNFLTFQ                FKLPNPLNAMQILWINILMDG
Sbjct: 709 TILTAIEEGKGIFNNIQNFLTFQLSTSVAALSLVAIATAFKLPNPLNAMQILWINILMDG 768

Query: 780 PPAQSLGVEPVDHEVMKKPPRKRTDKILTHDVMKRLLTTAACIIVGTVYIFVKEMAEDGK 839
           PPAQSLGVEPVDHEVMKKPPRKR DKILT  V +RLL +AA II+GT+Y+F+KEMAEDG+
Sbjct: 769 PPAQSLGVEPVDHEVMKKPPRKRADKILTKAVFQRLLQSAALIIIGTIYVFIKEMAEDGE 828

Query: 840 VTARDTTMTFTCFVFFDMFNALACRHNTKSIFEIGFFTNKMFNYAVGLSLLGQMCAIYIP 899
           VTARDTTMTFTCFVFFDMFNALACRH+TKSIFE+G F NKMFNYAVG SLLGQ+CAIY+P
Sbjct: 829 VTARDTTMTFTCFVFFDMFNALACRHSTKSIFEVGIFANKMFNYAVGCSLLGQVCAIYVP 888

Query: 900 FFQSIFKTEKXXXXXXXXXXXXXXXVFIVDELRKL 934
           FFQSIFKTE+               VFI DELRKL
Sbjct: 889 FFQSIFKTERLSLGDLAFLLLLSSTVFIADELRKL 923

>AEL301W [2204] [Homologous to ScYGL167C (PMR1) - SH]
           complement(75104..77977) [2874 bp, 957 aa]
          Length = 957

 Score = 1313 bits (3398), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 647/940 (68%), Positives = 763/940 (81%), Gaps = 13/940 (1%)

Query: 1   MSDNPFNASLLDEDSNREREILDATAEALSKPSPSLEYCTLSVDEALEKLDTDKNGGLRS 60
           MSDNPF++ L     +   E     +EA  KP+ SLEYCT++VDE L +L+TD   GL  
Sbjct: 7   MSDNPFDSYLNRSKDDSSMETKSLASEAFLKPNASLEYCTMTVDETLRQLNTDSAKGLCD 66

Query: 61  SNEANNRRSLYGPNEITVEDDESLFKKFLSNFIEDRMILLLIGSAVVSLFMGNIDDAVSI 120
             +       +G NE+TV+ ++ ++K+F+S F+ED +ILLLIGSAV+S  MGNIDDAVSI
Sbjct: 67  QQQVRASEQEWGTNEVTVDGEDPVWKRFMSTFVEDPLILLLIGSAVLSFLMGNIDDAVSI 126

Query: 121 TLAIFIVVTVGFVQEYRSEKSLEALNKLVPAECHLMRCGQESHVLASTLVPGDLVHFRIG 180
           TLA+ IVV+VGFVQEYRSEKSLEAL+KLVPA CHL+R G E+HVLAS LVPGDLV+F++G
Sbjct: 127 TLAVVIVVSVGFVQEYRSEKSLEALHKLVPASCHLIRFGAETHVLASCLVPGDLVYFKVG 186

Query: 181 DRIPADIRIIEAIDLSIDESNLTGENEPVHKTSQTIEKSSFNDQPNSIVPISERSCIAYM 240
           DRIPAD+RIIE+ DLS+DES LTGE EPVHK+   +  ++++D P  I+PI ER+ IAYM
Sbjct: 187 DRIPADVRIIESTDLSLDESTLTGETEPVHKSCTPVNSATYSDVPGGIIPIGERTSIAYM 246

Query: 241 GTLVKEGHGKGIVVGTGTNTSFGAVFEMMNNIEKPKTPLQLTMDKLGKDLSLVSFIVIGM 300
           GTLV+EGHGKGIVV TG +T FGAVFEMMN+IEKPKTPLQ+ MD L +DLS V F++ G+
Sbjct: 247 GTLVREGHGKGIVVATGKHTMFGAVFEMMNSIEKPKTPLQMAMDTLRRDLSYVRFVLSGI 306

Query: 301 ICLVGIIQGRSWLEMFQISVSLAVAAIPEGLPIIVTVTLALGVLRMAKRKAIVRRLPSVE 360
           I L+G+IQGRSWLEMFQISVSLAVAAIPEGLPIIVTVTLALGVLRMA RKAIVRRLPSVE
Sbjct: 307 IFLLGVIQGRSWLEMFQISVSLAVAAIPEGLPIIVTVTLALGVLRMANRKAIVRRLPSVE 366

Query: 361 TLGSVNVICSDKTGTLTSNHMTVSKLWCLDSMSNKLNVLSLDKNKKTKNSNG------NL 414
           TLGSVNVICSDKTGTLT+NHMT SK+WCL SM+NK NVLSL+     K+S G      NL
Sbjct: 367 TLGSVNVICSDKTGTLTANHMTASKIWCLGSMANKNNVLSLE----AKSSGGLPGKLPNL 422

Query: 415 KNYLTEDVRETLTIGNLCNNASFSQEHAIFLGNPTDVALLEQLANFEMPDIRNTVQKVQE 474
           KNYL++DV+ TL IG++CNNASFS EH  +LGNPTD+ALLE L  F++ D R T  +V E
Sbjct: 423 KNYLSDDVKATLRIGSICNNASFSHEHGKYLGNPTDIALLEVLQKFDLVDERPTTTRVDE 482

Query: 475 LPFNSKRKLMATKILNPVDN-KCTVYVKGAFERILEYSTSYLKSKGKKTEKLTEAQKATI 533
           L FNSKRK MA K+ +P ++ K  +YVKGAFERILE S S++   G K EKL+++ K+ I
Sbjct: 483 LTFNSKRKYMAVKVDSPANSGKHIIYVKGAFERILERSASFIGGAG-KVEKLSDSHKSLI 541

Query: 534 NECANSMASEGLRVFGFAKLTLSDSSTPLTEDLIKDLTFTGLIGMNDPPRPNVKFAIEQL 593
           N+CA S+ASEGLR   FA+L  S ++ P+ +  I++LTF GLIGM DPPR  V+ AIE+L
Sbjct: 542 NDCAKSLASEGLRTLAFAQLECS-TNKPMNDSTIQNLTFVGLIGMKDPPRSTVRPAIEEL 600

Query: 594 LQGGVHIIMITGDSENTAVNIAKQIGIPVIDPKLSVLSGDKLDEMSDDQLANVIDHVNIF 653
           LQGGVH+IMITGD+ENTAVNIA+QIGIPVI+P++SVL+GD+LD+M+DDQLA VIDHVNIF
Sbjct: 601 LQGGVHVIMITGDAENTAVNIARQIGIPVINPEISVLTGDRLDQMTDDQLAGVIDHVNIF 660

Query: 654 ARATPEHKLNIVRALRKRGDVVAMTGDGVNDAPALKLSDIGVSMGRIGTDVAKEASDMVL 713
           ARATPEHKLNIVRAL+KRGD+VAMTGDGVNDAPALKL+DIGV+MG +GTDVAKEASDMVL
Sbjct: 661 ARATPEHKLNIVRALQKRGDIVAMTGDGVNDAPALKLADIGVAMGHMGTDVAKEASDMVL 720

Query: 714 TDDDFSTILTAIEEGKGIFNNIQNFLTFQXXXXXXXXXXXXXXXXFKLPNPLNAMQILWI 773
           TDDDFSTILTAIEEGKGIFNNIQ+FLTFQ                FKL NPLNAMQILWI
Sbjct: 721 TDDDFSTILTAIEEGKGIFNNIQSFLTFQLSTSVAALSLVAIATAFKLQNPLNAMQILWI 780

Query: 774 NILMDGPPAQSLGVEPVDHEVMKKPPRKRTDKILTHDVMKRLLTTAACIIVGTVYIFVKE 833
           NILMDGPPAQSLGVEPVDHEVM+KPPRKR+DKILT  VM+RLL  AA II GT+Y+F+KE
Sbjct: 781 NILMDGPPAQSLGVEPVDHEVMRKPPRKRSDKILTPQVMRRLLINAAFIIGGTIYVFIKE 840

Query: 834 MAEDGKVTARDTTMTFTCFVFFDMFNALACRHNTKSIFEIGFFTNKMFNYAVGLSLLGQM 893
           M EDG+VTARDTTMTFTCFVFFDMF+ALACRH TKSIFEIG F NKMFNYAVG SLLGQ+
Sbjct: 841 MTEDGQVTARDTTMTFTCFVFFDMFSALACRHATKSIFEIGIFNNKMFNYAVGFSLLGQL 900

Query: 894 CAIYIPFFQSIFKTEKXXXXXXXXXXXXXXXVFIVDELRK 933
           CAIYIPFFQ+IFKTE+               VFI DE+RK
Sbjct: 901 CAIYIPFFQNIFKTERLSLGDLIYLIVISSSVFIADEVRK 940

>KLLA0A03157g complement(281313..284129) gi|3288523|emb|CAA04476.1
           Kluyveromyces lactis Ca++ ATPase, start by similarity
          Length = 938

 Score = 1287 bits (3331), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 643/935 (68%), Positives = 762/935 (81%), Gaps = 16/935 (1%)

Query: 1   MSDNPFNASLLDEDSNREREILDATAEALSKPSPSLEYCTLSVDEALEKLDTDKNGGLRS 60
           MSDNPF + L      R+++      + LS+P+ SLEYCT+SV++ + +L TD + GL +
Sbjct: 1   MSDNPFESYLA-----RDQQPPQPAVDVLSQPNASLEYCTVSVEDTIAQLGTDFDNGLSN 55

Query: 61  SNEANNRRSLYGPNEITVEDDESLFKKFLSNFIEDRMILLLIGSAVVSLFMGNIDDAVSI 120
            +E   R+S++G NE+  ++  SL+KKFLS FIED +ILLLIGSAV+S  MGNIDD++SI
Sbjct: 56  PSEIAYRKSIWGSNEVLPDEKVSLWKKFLSTFIEDPLILLLIGSAVISFLMGNIDDSISI 115

Query: 121 TLAIFIVVTVGFVQEYRSEKSLEALNKLVPAECHLMRCGQESHVLASTLVPGDLVHFRIG 180
            LAI IVVTVGFVQEY+SEKSLEALNKLVPAECHL R GQ SHVLAS LVPGDLV F++G
Sbjct: 116 ALAIIIVVTVGFVQEYKSEKSLEALNKLVPAECHLTRSGQLSHVLASNLVPGDLVRFKVG 175

Query: 181 DRIPADIRIIEAIDLSIDESNLTGENEPVHKTSQTIEKSSFNDQPNSIVPISERSCIAYM 240
           DRIPAD+RI+E+IDL +DESNLTGENEPVHK+S  ++  +++  P SI+P+ +R+CI +M
Sbjct: 176 DRIPADLRIVESIDLCVDESNLTGENEPVHKSSGAVDPKNYSHIPGSIIPVGDRNCIGFM 235

Query: 241 GTLVKEGHGKGIVVGTGTNTSFGAVFEMMNNIEKPKTPLQLTMDKLGKDLSLVSFIVIGM 300
           GTLV+EGHGKGIV+ TG +T FG+VFEMM+ I+KPKTPLQ  MDKLG+DLS +SF++IG+
Sbjct: 236 GTLVREGHGKGIVIATGKHTVFGSVFEMMSGIDKPKTPLQTAMDKLGQDLSYMSFVLIGI 295

Query: 301 ICLVGIIQGRSWLEMFQISVSLAVAAIPEGLPIIVTVTLALGVLRMAKRKAIVRRLPSVE 360
           ICL+GIIQGRSWLEMFQI+VSLAVAAIPEGLPIIVTVTLALGVLRMAKRKAIVRRLPSVE
Sbjct: 296 ICLIGIIQGRSWLEMFQIAVSLAVAAIPEGLPIIVTVTLALGVLRMAKRKAIVRRLPSVE 355

Query: 361 TLGSVNVICSDKTGTLTSNHMTVSKLWCLDSMSNKLNVLSLDKNKKTKNSNGNLKNYLTE 420
           TLGSVNVICSDKTGTLT+NHMTVSK+WCL SM NK N L+L K K+           + +
Sbjct: 356 TLGSVNVICSDKTGTLTANHMTVSKIWCLGSMENKTNCLALSKVKERPIK-------MEQ 408

Query: 421 DVRETLTIGNLCNNASFSQEHAIFLGNPTDVALLEQLANFEMPDIRNTVQKVQELPFNSK 480
           DV  TL IGN+CNN ++SQEH  +LGNPTD+A+LE L +F + D RN+V K+ E+PFNSK
Sbjct: 409 DVATTLRIGNICNNGTYSQEHLKYLGNPTDIAILESLQHFGINDCRNSVNKINEIPFNSK 468

Query: 481 RKLMATKILNPVDNKCTVYVKGAFERILEYSTSYLKSKGKKTEKLTEAQKATINECANSM 540
           RK MA K ++  ++K  VYVKGAFE+I+E S +Y+   G K  KL    KA IN+ A ++
Sbjct: 469 RKFMAVKTID-ANDKVVVYVKGAFEKIVEKSINYIGRDG-KVHKLKPNDKAIINDAAVAL 526

Query: 541 ASEGLRVFGFAKLTLSDSS--TPLTEDLIKDLTFTGLIGMNDPPRPNVKFAIEQLLQGGV 598
           ASEGLR   FA+L +S +       ED+++ LTFTGLI MNDPPRP V+ AIE+LLQG V
Sbjct: 527 ASEGLRTLAFAELEVSATHGDKEFNEDMVEGLTFTGLIAMNDPPRPTVRSAIEELLQGSV 586

Query: 599 HIIMITGDSENTAVNIAKQIGIPVIDPKLSVLSGDKLDEMSDDQLANVIDHVNIFARATP 658
           H+IMITGD+ENTAV+IA+QIGIPVI+P+ SVLSGDKLD+M+DDQLA+VIDHVN+FARATP
Sbjct: 587 HVIMITGDAENTAVSIARQIGIPVINPEYSVLSGDKLDQMTDDQLASVIDHVNVFARATP 646

Query: 659 EHKLNIVRALRKRGDVVAMTGDGVNDAPALKLSDIGVSMGRIGTDVAKEASDMVLTDDDF 718
           EHKLNIVRAL+KRGD+VAMTGDGVNDAPALKL+DIGVSMG++GTDVAKEASDMVLTDDDF
Sbjct: 647 EHKLNIVRALQKRGDIVAMTGDGVNDAPALKLADIGVSMGKMGTDVAKEASDMVLTDDDF 706

Query: 719 STILTAIEEGKGIFNNIQNFLTFQXXXXXXXXXXXXXXXXFKLPNPLNAMQILWINILMD 778
           STILTAIEEGKGIFNNIQNFLTFQ                 KLPNPLNAMQILWINILMD
Sbjct: 707 STILTAIEEGKGIFNNIQNFLTFQLSTSVAALSLVAISTSLKLPNPLNAMQILWINILMD 766

Query: 779 GPPAQSLGVEPVDHEVMKKPPRKRTDKILTHDVMKRLLTTAACIIVGTVYIFVKEMAEDG 838
           GPPAQSLGVEPVDHEVM+KPPRKRTDKILT  V+KR+L +A  IIVGT+Y+FVKEMAEDG
Sbjct: 767 GPPAQSLGVEPVDHEVMRKPPRKRTDKILTDAVLKRVLISACFIIVGTIYVFVKEMAEDG 826

Query: 839 KVTARDTTMTFTCFVFFDMFNALACRHNTKSIFEIGFFTNKMFNYAVGLSLLGQMCAIYI 898
           +VT+RDTTMTFTCFVFFDMFNAL+CRH TKSIFEIGFF NKMFNYAV LSLLGQ+CAIYI
Sbjct: 827 QVTSRDTTMTFTCFVFFDMFNALSCRHATKSIFEIGFFANKMFNYAVSLSLLGQLCAIYI 886

Query: 899 PFFQSIFKTEKXXXXXXXXXXXXXXXVFIVDELRK 933
           PFFQ IFKTE                VFI DE+RK
Sbjct: 887 PFFQGIFKTESLSLGDLLFLLTLSSSVFIGDEIRK 921

>Scas_707.48*
          Length = 741

 Score = 1216 bits (3145), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 596/742 (80%), Positives = 664/742 (89%), Gaps = 7/742 (0%)

Query: 1   MSDNPFNASLLDEDSNREREILDATAEALSKPSPSLEYCTLSVDEALEKLDTDKNGGLRS 60
           MS NPF+A + DE S  ERE+L+   EALS+P+ SLEYCT+SVDE L KL+TD   GL S
Sbjct: 1   MSANPFDAPIADERSIEERELLEVAKEALSRPNASLEYCTMSVDETLRKLETDPKSGLGS 60

Query: 61  SNEANNRRSLYGPNEITVEDDESLFKKFLSNFIEDRMILLLIGSAVVSLFMGNIDDAVSI 120
             EA+ R+ +YG NEI +E+DESL+KKFLS+F+EDR+ILLLIGSAVVS  MGNIDDAVSI
Sbjct: 61  IAEASRRKLVYGANEIVIEEDESLWKKFLSSFVEDRLILLLIGSAVVSFIMGNIDDAVSI 120

Query: 121 TLAIFIVVTVGFVQEYRSEKSLEALNKLVPAECHLMRCGQESHVLASTLVPGDLVHFRIG 180
           TLAI IVV+VGFVQEYRSEKSLEALNKLVPAECHL+RCGQESHVLAS LVPGDLVHF+IG
Sbjct: 121 TLAIVIVVSVGFVQEYRSEKSLEALNKLVPAECHLIRCGQESHVLASGLVPGDLVHFKIG 180

Query: 181 DRIPADIRIIEAIDLSIDESNLTGENEPVHKTSQTIEKSSFNDQPNSIVPISERSCIAYM 240
           DRIPAD+RIIEA+DLSIDESNLTGENEPVHK+++ + K SFNDQPNSI+PIS+R+C+AYM
Sbjct: 181 DRIPADLRIIEAVDLSIDESNLTGENEPVHKSAKEVNKDSFNDQPNSIIPISDRTCVAYM 240

Query: 241 GTLVKEGHGKGIVVGTGTNTSFGAVFEMMNNIEKPKTPLQLTMDKLGKDLSLVSFIVIGM 300
           GTLVKEGHGKGIVVG G NTSFGA+FEM++NIEKPKTPLQ  MDKLGKDLSL SFIVIG+
Sbjct: 241 GTLVKEGHGKGIVVGIGKNTSFGAIFEMLSNIEKPKTPLQNAMDKLGKDLSLFSFIVIGL 300

Query: 301 ICLVGIIQGRSWLEMFQISVSLAVAAIPEGLPIIVTVTLALGVLRMAKRKAIVRRLPSVE 360
           ICLVGI+QGRSWLEMFQISVSLAVAAIPEGLPIIVTVTLALGVLRMAKRKAIVRRLPSVE
Sbjct: 301 ICLVGILQGRSWLEMFQISVSLAVAAIPEGLPIIVTVTLALGVLRMAKRKAIVRRLPSVE 360

Query: 361 TLGSVNVICSDKTGTLTSNHMTVSKLWCLDSMSNKLNVLSLDKNKKTKNSNGNLKNYLTE 420
           TLGSVNVICSDKTGTLTSNHMT SK+WCLDSM+NK NVLSL+K+K     +G+LKNYLTE
Sbjct: 361 TLGSVNVICSDKTGTLTSNHMTASKIWCLDSMANKANVLSLEKSK-----SGSLKNYLTE 415

Query: 421 DVRETLTIGNLCNNASFSQEHAIFLGNPTDVALLEQLANFEMPDIRNTVQKVQELPFNSK 480
           DV+ TLTIGN+CNNASFSQEH  +LGNPTD+ALLEQL+ F++ DIR T +KVQE+PFNSK
Sbjct: 416 DVKSTLTIGNICNNASFSQEHGKYLGNPTDIALLEQLSKFDLSDIRPTFKKVQEIPFNSK 475

Query: 481 RKLMATKILNPVDNKCTVYVKGAFERILEYSTSYLKSKGKKTEKLTEAQKATINECANSM 540
           RK MA KI+N  + K ++ VKGAFE++L   + YL  KG KTEKLT+ Q+  I E ANS+
Sbjct: 476 RKFMAVKIVNS-EGKYSLCVKGAFEKVLSQCSHYLNQKG-KTEKLTQGQRDVIIETANSL 533

Query: 541 ASEGLRVFGFAKLTLSDSSTPLTEDLIKDLTFTGLIGMNDPPRPNVKFAIEQLLQGGVHI 600
           ASEGLR+  FAK TL DS T LTE+ + DL FTGLIGMNDPPRP VK AIEQLLQGGVHI
Sbjct: 534 ASEGLRMLAFAKTTLPDSPTLLTEESVGDLIFTGLIGMNDPPRPTVKPAIEQLLQGGVHI 593

Query: 601 IMITGDSENTAVNIAKQIGIPVIDPKLSVLSGDKLDEMSDDQLANVIDHVNIFARATPEH 660
           IMITGDSENTAVNIA+QIGIPV+DPKLSVLSGDKL+EMSDDQLANVIDHVNIFARATPEH
Sbjct: 594 IMITGDSENTAVNIARQIGIPVLDPKLSVLSGDKLNEMSDDQLANVIDHVNIFARATPEH 653

Query: 661 KLNIVRALRKRGDVVAMTGDGVNDAPALKLSDIGVSMGRIGTDVAKEASDMVLTDDDFST 720
           KLNIVRALRKRGDVVAMTGDGVNDAPALKL+DIGVSMGR+GTDVAKEASDMVLTDDDFST
Sbjct: 654 KLNIVRALRKRGDVVAMTGDGVNDAPALKLADIGVSMGRMGTDVAKEASDMVLTDDDFST 713

Query: 721 ILTAIEEGKGIFNNIQNFLTFQ 742
           ILTAIEEGKGIFNNIQNFLTFQ
Sbjct: 714 ILTAIEEGKGIFNNIQNFLTFQ 735

>CAGL0J01870g 181666..184506 highly similar to sp|P13586
           Saccharomyces cerevisiae YGL167c PMR1, hypothetical
           start
          Length = 946

 Score = 1144 bits (2960), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 582/914 (63%), Positives = 715/914 (78%), Gaps = 15/914 (1%)

Query: 21  ILDATA-EALSKPSPSLEYCTLSVDEALEKLDTDKNGGLRSSNEANNRRSLYGPNEITVE 79
           +LD  A E L++P+PSL++CTLSV E +E L+TD + GL S  E   RR ++G N+   +
Sbjct: 30  VLDEEAYELLNRPNPSLKFCTLSVGETVENLETDVDNGLSSEEEVVKRREIHGRNDFEED 89

Query: 80  DDESLFKKFLSNFIEDRMILLLIGSAVVSLFMGNIDDAVSITLAIFIVVTVGFVQEYRSE 139
           DDES+ KKFL +F+EDR+ILLLIGSAV+S  +G IDDAVSI+LAI IVVTVGF+QEYRSE
Sbjct: 90  DDESMIKKFLMSFVEDRLILLLIGSAVLSFAIGQIDDAVSISLAILIVVTVGFIQEYRSE 149

Query: 140 KSLEALNKLVPAECHLMRCGQESHVLASTLVPGDLVHFRIGDRIPADIRIIEAIDLSIDE 199
           KSLEALNKLVP +CHL+R G+ES+ LAS LVPGDLV F+IGDRIPAD+RIIEA+DLSIDE
Sbjct: 150 KSLEALNKLVPTKCHLIRYGRESNTLASELVPGDLVRFKIGDRIPADVRIIEAVDLSIDE 209

Query: 200 SNLTGENEPVHKTSQTIEKSSFNDQPNSIVPISERSCIAYMGTLVKEGHGKGIVVGTGTN 259
           SNLTGE EP+HK +QTI+   ++   N  VP+SERSCIAYMGTLVKEGHGKGIV+GTGTN
Sbjct: 210 SNLTGETEPLHKDAQTIDPEEYD---NRNVPVSERSCIAYMGTLVKEGHGKGIVIGTGTN 266

Query: 260 TSFGAVFEMMNNIEKPKTPLQLTMDKLGKDLSLVSFIVIGMICLVGIIQGRSWLEMFQIS 319
           TS+GA+FEM+N+IEKPKTPLQ TMD+LG +LS +SF +I +I +VGII+G S L MFQ+S
Sbjct: 267 TSYGAIFEMVNSIEKPKTPLQETMDRLGTELSYISFFIIAIISIVGIIRGNSLLMMFQVS 326

Query: 320 VSLAVAAIPEGLPIIVTVTLALGVLRMAKRKAIVRRLPSVETLGSVNVICSDKTGTLTSN 379
           VSLAVAAIPEGLPIIVTVTLALGVLRM K+ AIVRRLPSVETLGSVNVIC+DKTGTLT+N
Sbjct: 327 VSLAVAAIPEGLPIIVTVTLALGVLRMTKQNAIVRRLPSVETLGSVNVICTDKTGTLTTN 386

Query: 380 HMTVSKLWCLDSMSNKLNVLSLDKNKKTKNSNGNLKNYLTEDVRETLTIGNLCNNASFSQ 439
           HMTVSKL+CLDS     N +S +++ +    +         DV+ETLTI N+CNNA +S+
Sbjct: 387 HMTVSKLFCLDSSGTYENAISPEEDSEFDVHDN--------DVKETLTIANICNNAKYSE 438

Query: 440 EHAIFLGNPTDVALLEQLANFEMPDIRNTVQKVQELPFNSKRKLMATKILNPVDNKCTVY 499
           EH +++GNPTDVAL+E L  F +PD R++ +K++EL FNSKRK MA K  +    +  +Y
Sbjct: 439 EHNLYIGNPTDVALIEVLTKFGIPDQRDSHEKMEELSFNSKRKYMAIK-SSKESGEHVLY 497

Query: 500 VKGAFERILEYSTSYLKSKGKKTEKLTEAQKATINECANSMASEGLRVFGFAKLTLSDSS 559
           +KGAFERIL+ S+ YL   G+  E   E  K  + E A+S AS+GLR    A    +DS 
Sbjct: 498 IKGAFERILDKSSYYLDKAGEVRE-FDEHSKVMVLEAAHSCASDGLRTIACA-FKPTDSD 555

Query: 560 TPLTEDLIKDLTFTGLIGMNDPPRPNVKFAIEQLLQGGVHIIMITGDSENTAVNIAKQIG 619
             ++ED I  LTFTGL G+ DPPRPNVK +IE+L +GGVHIIMITGDS NTAV+IA++IG
Sbjct: 556 NVISEDDINGLTFTGLFGLADPPRPNVKASIEKLHRGGVHIIMITGDSVNTAVSIAEKIG 615

Query: 620 IPVIDPKLSVLSGDKLDEMSDDQLANVIDHVNIFARATPEHKLNIVRALRKRGDVVAMTG 679
           + V D + SV++GDK+ E+++D+L+ VID VNIFARATPE+KLNIV+ALRKRGD+VAMTG
Sbjct: 616 LSVQDRESSVMTGDKVSELTEDELSKVIDKVNIFARATPENKLNIVKALRKRGDIVAMTG 675

Query: 680 DGVNDAPALKLSDIGVSMGRIGTDVAKEASDMVLTDDDFSTILTAIEEGKGIFNNIQNFL 739
           DGVNDAPALKL+DIG++MG  GTDVAKE SDM+LTDDDFS+ILTAIEEGKGIFNNI+NFL
Sbjct: 676 DGVNDAPALKLADIGIAMGISGTDVAKEVSDMILTDDDFSSILTAIEEGKGIFNNIRNFL 735

Query: 740 TFQXXXXXXXXXXXXXXXXFKLPNPLNAMQILWINILMDGPPAQSLGVEPVDHEVMKKPP 799
           TFQ                 KLP PLN MQILWINI+MDGPPAQSLGVEPVD +VM KPP
Sbjct: 736 TFQLSISVATLSLIAITTIAKLPAPLNPMQILWINIIMDGPPAQSLGVEPVDSDVMDKPP 795

Query: 800 RKRTDKILTHDVMKRLLTTAACIIVGTVYIFVKEMAEDGKVTARDTTMTFTCFVFFDMFN 859
           R R ++IL  +++ RLL  A CI+VGT YIF+K M E+ + T++D TMTFT FVFF +FN
Sbjct: 796 RSREERILNMNILLRLLYLAICILVGTFYIFLKGMDENQQTTSKDITMTFTGFVFFAIFN 855

Query: 860 ALACRHNTKSIFEIGFFTNKMFNYAVGLSLLGQMCAIYIPFFQSIFKTEKXXXXXXXXXX 919
           A+ACRH TKSIF+IG F+N++FN A+ LS+ GQMCA+YIPFFQ IFKTE           
Sbjct: 856 AVACRHTTKSIFQIGLFSNRIFNIAILLSVCGQMCAVYIPFFQHIFKTENLGFYDLLTLV 915

Query: 920 XXXXXVFIVDELRK 933
                V IVDE+RK
Sbjct: 916 LVSSSVLIVDEIRK 929

>Kwal_23.3160
          Length = 1100

 Score =  372 bits (956), Expect = e-113,   Method: Compositional matrix adjust.
 Identities = 272/923 (29%), Positives = 450/923 (48%), Gaps = 136/923 (14%)

Query: 38  YCTLSVDEALEKLDTDKNGGLRSSNEANNRRSLYGPNEITVEDDESLFKKFLSNFIEDRM 97
           + T+S  +    L+TD   GLRS+ EA  R S YG N +  +D +  FK  L + I + M
Sbjct: 23  FHTVSARDTAHVLETDLQAGLRSA-EATARVSQYGENSLG-DDSKIDFKSILLHQICNAM 80

Query: 98  ILLLIGSAVVSLFMGNIDDAVSITLAIFIVVTVGFVQEYRSEKSLEALNKLVPAECHLMR 157
           IL+L  S V++L + +      I   +FI V +G  QEY++ K++ +L  L     H++R
Sbjct: 81  ILVLFISMVITLAIRDWISGGVIAFVVFINVAIGSYQEYKASKTMNSLKSLSTPSAHVIR 140

Query: 158 CGQESHVLASTLVPGDLVHFRIGDRIPADIRIIEAIDLSIDESNLTGENEPVHKTSQTIE 217
            G +  + +  LVPGDL   + GD +PAD+R+IE ++   DE+ LTGE+ P+ K +  + 
Sbjct: 141 DGNDETIPSKQLVPGDLCVVKAGDTVPADLRLIECVNFETDEALLTGESLPIAKEASQVY 200

Query: 218 KSSFNDQPNSIVPISERSCIAYMGTLVKEGHGKGIVVGTGTNTSFGAVFEMMNN----IE 273
            ++ +       P+ +R  +A+  + V +G   GIVV TG NT  G + + +      I 
Sbjct: 201 PATED------TPVGDRLNLAFASSTVSKGRATGIVVKTGLNTEIGKIAQSLKGDNSLIS 254

Query: 274 KPK-------------------------TPLQLTMDKLGKDLSLVS--FIVIGMICLVGI 306
           K +                         TPL   + KL   L  ++  F ++ M     +
Sbjct: 255 KDENKTFWANAGITLAATIGSFLGTTTGTPLHRKLSKLAVLLFFIAVVFAIVVMATQKFV 314

Query: 307 IQGRSWLEMFQISVSLAVAAIPEGLPIIVTVTLALGVLRMAKRKAIVRRLPSVETLGSVN 366
           +      E+   ++ +AV+ IP  L +++T+T+++G   MA R  +VR+L S+E LG+VN
Sbjct: 315 VNK----EVAIYAICVAVSMIPSSLVVVLTITMSVGAKIMATRNVVVRKLDSLEALGAVN 370

Query: 367 VICSDKTGTLTSNHMTVSKLWC-------LDSMSNKLNVLSLDKNKKTKNSNGNLKNYLT 419
            +CSDKTGTLT   M V + W        + + SN  +          + S    K+  T
Sbjct: 371 DVCSDKTGTLTQGKMIVKQAWVPSFGTITVSNSSNPFDPTDGGIELIPRFSPHQYKHDST 430

Query: 420 EDVR------------------------ETLTIGNLCNNASFSQ----EHAIFLGNPTDV 451
           EDV                           L    L N A   Q    E     G+PT++
Sbjct: 431 EDVGIITSFKNKFYNDKLPAGLNSKLFLNWLKTAALANIAHVYQDPETEEWKAHGDPTEI 490

Query: 452 ALLEQLANFEMP-------------------------DIRNTVQKVQELPFNSKRKLMAT 486
           A+       +MP                          +    + + E PF+S  K M+ 
Sbjct: 491 AIQVFAHKLDMPRNALTAEDKSDSESDEDAALGEKTSSVEPHYKHIAEFPFDSSIKRMSA 550

Query: 487 KILN-PVDNKCTVYVKGAFERILEYSTSYLKSKGKKTEK--LTEAQKATINECANSMASE 543
             ++   DN   V+ KGAFER+L+  T +L     +++   +TE  K  + +   +++SE
Sbjct: 551 VYVSLDEDNAHRVFTKGAFERVLDCCTKWLPDGCNESDAKPMTEEDKEEVFKNVETLSSE 610

Query: 544 GLRVFGFAKLTLSDSST-PLTEDLIK-------DLTFTGLIGMNDPPRPNVKFAIEQLLQ 595
           GLRV  FA  + ++S    ++EDL K       DL F GL+G+ DPPR     A++Q  +
Sbjct: 611 GLRVLAFATKSFTESQALKVSEDLRKNRDFVESDLIFQGLVGIYDPPRQETAGAVKQFHK 670

Query: 596 GGVHIIMITGDSENTAVNIAKQIGI----------PVIDPKLSVLSGDKLDEMSDDQLAN 645
            G+++ M+TGD   TA  IA+++GI           V+D    V++  + D+++D+++ N
Sbjct: 671 AGINVHMLTGDFPGTAKAIAQEVGILPRNLYHYPKEVVDSM--VMTAAQFDQLTDEEIDN 728

Query: 646 VIDHVNIFARATPEHKLNIVRALRKRGDVVAMTGDGVNDAPALKLSDIGVSMGRIGTDVA 705
           ++    + AR  P+ K+ ++ AL +R    AMTGDGVND+P+LK +++G++MG  G+DVA
Sbjct: 729 LLLLPLVIARCAPQTKVRMIDALHRREKFCAMTGDGVNDSPSLKKANVGIAMGINGSDVA 788

Query: 706 KEASDMVLTDDDFSTILTAIEEGKGIFNNIQNFLTFQXXXXXXXXXXXXXXXXFKLPN-- 763
           K+ASD+VL+DD+F++IL A+EEG+ + +NIQ F+                   F   +  
Sbjct: 789 KDASDIVLSDDNFASILNAVEEGRRMSDNIQKFVLQLLAENVAQALYLMIGLCFLDEDRL 848

Query: 764 ---PLNAMQILWINILMDGPPAQSLGVEPVDHEVMKKPPRKRTDKILTHDVMKRLL---- 816
              PL+ +++LWI ++    PA  LG+E    ++M+K P+     I T +++  +L    
Sbjct: 849 SVFPLSPVEVLWIIVVTSCFPAMGLGLEKSAPDIMEKEPQDSKAGIFTWEIILDMLIYGT 908

Query: 817 -TTAACIIVGTVYIFVKEMAEDG 838
              A C+      I+ K   E G
Sbjct: 909 WMAACCLACFITVIYGKGNGELG 931

>CAGL0K12034g complement(1161299..1164562) highly similar to sp|P13587
            Saccharomyces cerevisiae YDR040c ENA1 or sp|Q01896
            Saccharomyces cerevisiae YDR039c ENA2 or sp|Q12691
            Saccharomyces cerevisiae YDR038c ENA5, hypothetical start
          Length = 1087

 Score =  367 bits (941), Expect = e-110,   Method: Compositional matrix adjust.
 Identities = 283/1010 (28%), Positives = 479/1010 (47%), Gaps = 163/1010 (16%)

Query: 37   EYCTLSVDEALEKLDTDKNGGLRSSNEANNRRSLYGPNEITVEDDESL-FKKFLSNFIED 95
            +Y  LSV++   +L TD + G+ S  E   R +  G N  ++ DD  + +K  L + I +
Sbjct: 12   DYHALSVEDTCARLVTDSSKGI-SPEEFQARLAQCGEN--SLGDDAKIDYKAMLIHQICN 68

Query: 96   RMILLLIGSAVVSLFMGNIDDAVSITLAIFIVVTVGFVQEYRSEKSLEALNKLVPAECHL 155
             MIL+LI S ++S  + +      I   I I V +G +QEY++ K++ AL  L     H+
Sbjct: 69   AMILVLIISMIISFAIRDWITGGVICFVIGINVIIGLIQEYKASKTMNALRALSSPNAHV 128

Query: 156  MRCGQESHVLASTLVPGDLVHFRIGDRIPADIRIIEAIDLSIDESNLTGENEPVHKTSQT 215
            +R G    V ++ +VPGDLV  ++GD IPAD+R++   +   DE+ LTGE+ PV K +  
Sbjct: 129  IRNGNSEVVDSTDVVPGDLVVVKVGDTIPADLRLVSQQNFETDEALLTGESLPVSKDANE 188

Query: 216  IEKSSFNDQPNSIVPISERSCIAYMGTLVKEGHGKGIVVGTGTNTSFGAVFEMMN----- 270
            I    F+D+     P+ +R  +A+  + V +G  +GI + TG NT  G + + +      
Sbjct: 189  I----FDDE----TPVGDRINLAFSSSTVVKGRAQGIAIKTGLNTEIGKIAKSLRGGNEL 240

Query: 271  -NIEKPKTPLQLTM----------------DKLGKDLSLVSFIVIGMICLVGIIQGRSWL 313
             + +  KT  Q                     L + LS ++ ++  +  +  I+   S  
Sbjct: 241  ISRDPAKTWYQNAWISTKRTVGAFLGTTQGTPLHRKLSKLAVLLFWIAVVFAIVVMAS-- 298

Query: 314  EMFQI-------SVSLAVAAIPEGLPIIVTVTLALGVLRMAKRKAIVRRLPSVETLGSVN 366
            + F +       +V +A++ IP  L +++T+T+++G   MA R  I+R+L S+E LG+VN
Sbjct: 299  QKFDVDRGVAIYAVCVALSMIPSSLVVVLTITMSVGAAVMASRNVIIRKLDSLEALGAVN 358

Query: 367  VICSDKTGTLTSNHMTVSKLWC------------------------------LDSMSNKL 396
             ICSDKTGTLT   M   ++W                                +   N+ 
Sbjct: 359  DICSDKTGTLTQGKMIAKQIWVPKFGTLQVVGSNEPLNPEKGDINFIPNLSPYEYSHNET 418

Query: 397  NVLSLDKNKKTKNSN----GNLKNYLTEDVRETLTIGNLCNNASFSQ-EHAIFLGNPTDV 451
              + + +N K K       GN +  L +   ET ++ N+ +  +  + +     G+PT++
Sbjct: 419  EDVGIMQNFKDKYEGKSIPGNCQYQLFDKWLETASLANIASVFTDPETKEWKAHGDPTEI 478

Query: 452  ALLEQLANFEMP--------------DIRNTV--------------QKVQELPFNSKRKL 483
            A+       ++P              +I ++V              +   E PF+S  K 
Sbjct: 479  AIQVFATRMDLPRHVLTGERDDMDEDEIMSSVSLSEKDATAANAKFRHAAEFPFDSTIKR 538

Query: 484  MATKILNPVDNKCTVYVKGAFERILEYSTSYLKSKGKKTEKLTEAQKATINECANSMASE 543
            M++   +       +Y KGAFE +L   T +          +T+A   TI E  +SM+SE
Sbjct: 539  MSSVYESRDYKTYEIYTKGAFESVLNCCTHWYGRDPNTATVMTDADVDTIKENIDSMSSE 598

Query: 544  GLRVFGFAKLTL--SDSSTPLTEDLIKD-------LTFTGLIGMNDPPRPNVKFAIEQLL 594
            GLRV  FA  +   SD +    + ++K+       LTF GLIG+ DPPR     A+++  
Sbjct: 599  GLRVLAFANKSYPKSDVNEEKLQKILKERDYAETGLTFLGLIGIYDPPREETAGAVKKFH 658

Query: 595  QGGVHIIMITGDSENTAVNIAKQIGI----------PVIDPKLSVLSGDKLDEMSDDQLA 644
            Q G+++ M+TGD   TA  IA+++GI           V+D  + V++G + D +S+D++ 
Sbjct: 659  QAGINVRMLTGDFPGTAKAIAQEVGILPTNLYHYSKEVVD--IMVMTGKQFDNLSEDEID 716

Query: 645  NVIDHVNIFARATPEHKLNIVRALRKRGDVVAMTGDGVNDAPALKLSDIGVSMGRIGTDV 704
            N+     + AR +P+ K+ ++ AL +R    AMTGDGVND+P+LK++++G++MG  G+DV
Sbjct: 717  NLPVLPLVIARCSPQTKVRMIEALHRREKFCAMTGDGVNDSPSLKMANVGIAMGINGSDV 776

Query: 705  AKEASDMVLTDDDFSTILTAIEEGKGIFNNIQNFLTFQXXXXXXXXXXXXXXXXF----- 759
            AK+ASD+VL+DD+F++IL A+EEG+ + +NIQ F+                   F     
Sbjct: 777  AKDASDIVLSDDNFASILNAVEEGRRMSDNIQKFVLQLLAENVAQALYLIVGLAFQDKEG 836

Query: 760  KLPNPLNAMQILWINILMDGPPAQSLGVEPVDHEVMKKPPRKRTDKILTHDVMKRLLT-- 817
            K   PL  +++LWI ++    PA  LG+E   H++M +PP      I T +++  +    
Sbjct: 837  KSVFPLAPVEVLWIIVVTSCFPAMGLGLEKAAHDLMDRPPNDSKAGIFTWEIIVDMFVYG 896

Query: 818  ---TAACIIVGTVYIFVKEMAEDGKVTARD----------------TTMTFTCFVF---- 854
                A+C+      I+ ++    G+   RD                 TMT+   +     
Sbjct: 897  VWMAASCMATFVTIIYGRDHGNLGQNCNRDYSESCHDVFRARSAAFATMTWCALILAWEV 956

Query: 855  FDMFNALACRH-----NTKSIFEIGFFTNKMFNYAVGLSLLGQMCAIYIP 899
             D+  +    H       K  F+   + NK   Y+V          +YIP
Sbjct: 957  IDLRRSFFRMHPDTDAPVKQFFK-DIYGNKFLFYSVVFGFASVFPVVYIP 1005

>KLLA0E14630g complement(1297636..1300884) similar to sp|Q01896
           Saccharomyces cerevisiae YDR039c ENA2 P-type ATPase
           involved in Na+ efflux, hypothetical start
          Length = 1082

 Score =  358 bits (919), Expect = e-107,   Method: Compositional matrix adjust.
 Identities = 268/904 (29%), Positives = 443/904 (49%), Gaps = 118/904 (13%)

Query: 32  PSPSLEYCTLSVDEALEKLDTDKNGGLRSSNEANNRRSLYGPNEITVEDDESL-FKKFLS 90
           P    ++ +LSV      L T  N GL ++  A  R  L G N  T+ DD  +  K    
Sbjct: 13  PYARDDFHSLSVSRVETLLSTHINQGLNTTQIAE-RLGLIGEN--TLGDDSKINIKGIFI 69

Query: 91  NFIEDRMILLLIGSAVVSLFMGNIDDAVSITLAIFIVVTVGFVQEYRSEKSLEALNKLVP 150
           + I + MI++LI S V+S  + +      I   +FI V +G  QEY + K++ +L  L  
Sbjct: 70  SQICNAMIMVLIISMVISFAIKDWISGGVIAFVVFINVVIGAYQEYNASKTMNSLKSLST 129

Query: 151 AECHLMRCGQESHVLASTLVPGDLVHFRIGDRIPADIRIIEAIDLSIDESNLTGENEPVH 210
              H++R G +  + +  LVPGD+   R+GD +PAD+R+ EAI+L  DE+ LTGE+ PV 
Sbjct: 130 PSAHVIRAGNDLTIESKELVPGDICIIRVGDTVPADLRLFEAINLETDEALLTGESLPVA 189

Query: 211 KTSQTIEKSSFNDQPNSIVPISERSCIAYMGTLVKEGHGKGIVVGTGTNTSFGAVFEMMN 270
           K+   + +           P+ +R  +A+  + V +G   GIV+ T  NT  G + + + 
Sbjct: 190 KSHGEVYEQD--------TPVGDRLNLAFAASTVTKGRATGIVIKTALNTEIGKIAKSLK 241

Query: 271 N----IEKPK-------------------------TPLQLTMDKLGKDLSLVSFIVIGMI 301
           +    I + K                         TPL   + +L   + L    VI  I
Sbjct: 242 SEASLISRDKSKSFGRNLWITLRESIGTFLGTSVGTPLHRKLSQLA--ILLFVVAVIFAI 299

Query: 302 CLVGIIQGRSWLEMFQISVSLAVAAIPEGLPIIVTVTLALGVLRMAKRKAIVRRLPSVET 361
            ++G  + +   ++   ++ +A++ IP  L +++T+T++ G   MA R  I+R+L S+E 
Sbjct: 300 VVMGTQKFKVNKQVAIYAICVALSMIPSSLVVVLTITMSAGAKVMATRHVIIRKLDSLEA 359

Query: 362 LGSVNVICSDKTGTLTSNHMTVSKLWCLD------SMSNK-------------------- 395
           LG+VN ICSDKTGTLT   M   ++W           SN+                    
Sbjct: 360 LGAVNDICSDKTGTLTQGKMIAKQVWIPQFGTINVQNSNEPFNPTIGEIQLIPKFSPYQY 419

Query: 396 -------LNVLSLDKNKKTKNSNGNLKNYLTEDVRETLTIGNLCN--NASFSQEHAIFLG 446
                  + +++  K+K   +  G L   L      T T+ N+        +Q+     G
Sbjct: 420 KHDDEEDVGMITDFKSKYYADELGPLNVSLFTQWLYTATLANIATVFRDPETQDWKAH-G 478

Query: 447 NPTDVALLEQLANFEMP-------------DIRN--TVQKVQELPFNSKRKLMATKILNP 491
           +PT++A+       ++P             +I N  T + V E PF+S  K M+    N 
Sbjct: 479 DPTEIAIQVFATRMDLPRRVLTGEDNDDEKNIHNDITFEHVAEYPFDSSVKRMSAIYKNV 538

Query: 492 VDNKCTVY---VKGAFERILEYSTSYLKSKGKKTEKLTEAQKATINECANSMASEGLRVF 548
            + K  +Y    KGAFER+L+   S+  +     + LTE    T+ +  ++++SEGLRV 
Sbjct: 539 EEPKAPIYEVFTKGAFERVLQCCNSWYTTPDGSPQPLTEEDLETVQKNVDTLSSEGLRVL 598

Query: 549 GFAKLTLSDSSTPLTED-LIKD-------LTFTGLIGMNDPPRPNVKFAIEQLLQGGVHI 600
            FAK T ++S   + +D L+K+       LTF GL+G+ DPPR     A+++    G+++
Sbjct: 599 AFAKKTFNESQFTINKDKLLKERDFVENNLTFLGLVGIYDPPRRESLAAVKKCHLAGINV 658

Query: 601 IMITGDSENTAVNIAKQIGI--------PVIDPKLSVLSGDKLDEMSDDQLANVIDHVNI 652
            M+TGD   TA +IA+++GI        P       V++    D +SD ++  +     +
Sbjct: 659 HMLTGDFPGTAKSIAQEVGILPHNLYHYPKEVVNFMVMTATDFDALSDKEIDELPVLPLV 718

Query: 653 FARATPEHKLNIVRALRKRGDVVAMTGDGVNDAPALKLSDIGVSMGRIGTDVAKEASDMV 712
            AR  P+ K+ ++ AL +R    AMTGDGVND+P+LK++++G++MG  G+DVAK+ASD+V
Sbjct: 719 IARCAPQTKVRMIEALHRRNRFCAMTGDGVNDSPSLKIANVGIAMGINGSDVAKDASDIV 778

Query: 713 LTDDDFSTILTAIEEGKGIFNNIQNFLTFQXXXXXXXXXXXXXXXXFKLPN-----PLNA 767
           L+DD+F++IL A+EEG+ + +NIQ F+                   F         PL+ 
Sbjct: 779 LSDDNFASILNAVEEGRRMSDNIQKFVLQLLAENVAQALYLMVGLCFLDEEGFSVFPLSP 838

Query: 768 MQILWINILMDGPPAQSLGVEPVDHEVMKKPPRKRTDKILTHDVMKRLLTTAACIIVGTV 827
           +++LW+ ++    PA  LG+E  + +VM+KPP+     I T +V+  +L     I    +
Sbjct: 839 VEVLWVIVVTSCFPAMGLGLEKANVDVMEKPPKDAKAVIFTWEVIVDMLVYGVIIAACCM 898

Query: 828 YIFV 831
             FV
Sbjct: 899 ACFV 902

>YDR040C (ENA1) [893] chr4 complement(535187..538462) P-type ATPase
           involved in Na+ and Li+ efflux, required for Na+
           tolerance [3276 bp, 1091 aa]
          Length = 1091

 Score =  356 bits (914), Expect = e-107,   Method: Compositional matrix adjust.
 Identities = 264/920 (28%), Positives = 457/920 (49%), Gaps = 148/920 (16%)

Query: 38  YCTLSVDEALEKLDTDKNGGLRSSNEANNRRSLYGPNEITVEDDESL-FKKFLSNFIEDR 96
           Y TL+ +EA E + T    GL + +E  +R    G N  T+ DD  + +K  + + + + 
Sbjct: 17  YHTLTAEEAAEFIGTSLTEGL-TQDEFVHRLKTVGEN--TLGDDTKIDYKAMVLHQVCNA 73

Query: 97  MILLLIGSAVVSLFMGNIDDAVSITLAIFIVVTVGFVQEYRSEKSLEALNKLVPAECHLM 156
           MI++L+ S ++S  M +      I+  I + V +G VQEY++ K++ +L  L     H++
Sbjct: 74  MIMVLLISMIISFAMHDWITGGVISFVIAVNVLIGLVQEYKATKTMNSLKNLSSPNAHVI 133

Query: 157 RCGQESHVLASTLVPGDLVHFRIGDRIPADIRIIEAIDLSIDESNLTGENEPVHKTSQTI 216
           R G+   + +  +VPGD+   ++GD IPAD+R+IE  +   DES LTGE+ PV K +  +
Sbjct: 134 RNGKSETINSKDVVPGDICLVKVGDTIPADLRLIETKNFDTDESLLTGESLPVSKDANLV 193

Query: 217 ----EKSSFNDQPNSIVPISERSCIAYMGTLVKEGHGKGIVVGTGTNTSFGAVFEMMN-- 270
               E++S  D+ N          +A+  + V +G  KGIV+ T  N+  G + + +   
Sbjct: 194 FGKEEETSVGDRLN----------LAFSSSAVVKGRAKGIVIKTALNSEIGKIAKSLQGD 243

Query: 271 ----NIEKPKTPLQLTM----------------DKLGKDLSLVSFIVIGMICLVGIIQGR 310
               + +  K+ LQ T                   L + LS ++ ++  +  L  II   
Sbjct: 244 SGLISRDPSKSWLQNTWISTKKVTGAFLGTNVGTPLHRKLSKLAVLLFWIAVLFAIIVMA 303

Query: 311 SWLEMFQI-------SVSLAVAAIPEGLPIIVTVTLALGVLRMAKRKAIVRRLPSVETLG 363
           S  + F +       ++ +A++ IP  L +++T+T+++G   M  R  IVR+L S+E LG
Sbjct: 304 S--QKFDVDKRVAIYAICVALSMIPSSLVVVLTITMSVGAAVMVSRNVIVRKLDSLEALG 361

Query: 364 SVNVICSDKTGTLTSNHMTVSKLW-------CLDSMSNKLN--------VLSLDKNKKTK 408
           +VN ICSDKTGTLT   M   ++W        + +  +  N        +      + + 
Sbjct: 362 AVNDICSDKTGTLTQGKMLARQIWIPRFGTITISNSDDPFNPNEGNVSLIPRFSPYEYSH 421

Query: 409 NSNGN---LKNY--------LTEDV-----RETLTIGNLCNNASFSQEHAI----FLGNP 448
           N +G+   L+N+        L ED+     ++ L    L N A+  ++ A       G+P
Sbjct: 422 NEDGDVGILQNFKDRLYEKDLPEDIDMDLFQKWLETATLANIATVFKDDATDCWKAHGDP 481

Query: 449 TDVALLEQLANFEMPDIRNTVQK---------------------------VQELPFNSKR 481
           T++A+       ++P    T +K                           + E PF+S  
Sbjct: 482 TEIAIQVFATKMDLPHNALTGEKSTNQSNENDQSSLSQHNEKPGSAQFEHIAEFPFDSTV 541

Query: 482 KLMATKILNPVDNKCTVYVKGAFERILEYSTSYLKSKGKKTEKLTEAQKATINECANSMA 541
           K M++   N  +    +Y KGAFE I+   +S+    G K   LT+    TI +   S++
Sbjct: 542 KRMSSVYYNNHNETYNIYGKGAFESIISCCSSWYGKDGVKITPLTDCDVETIRKNVYSLS 601

Query: 542 SEGLRVFGFAKLTLSDSSTPLTEDLIK-----------DLTFTGLIGMNDPPRPNVKFAI 590
           +EGLRV GFA  + +     + +D +K           DL F GLIG+ DPPR     A+
Sbjct: 602 NEGLRVLGFASKSFTKDQ--VNDDQLKNITSNRATAESDLVFLGLIGIYDPPRNETAGAV 659

Query: 591 EQLLQGGVHIIMITGDSENTAVNIAKQIGI----------PVIDPKLSVLSGDKLDEMSD 640
           ++  Q G+++ M+TGD   TA  IA+++GI           ++D    V++G + D +S+
Sbjct: 660 KKFHQAGINVHMLTGDFVGTAKAIAQEVGILPTNLYHYSQEIVDSM--VMTGSQFDGLSE 717

Query: 641 DQLANVIDHVNIFARATPEHKLNIVRALRKRGDVVAMTGDGVNDAPALKLSDIGVSMGRI 700
           +++ ++     + AR +P+ K+ ++ AL +R     MTGDGVND+P+LK++++G++MG  
Sbjct: 718 EEVDDLPVLPLVIARCSPQTKVRMIEALHRRKKFCTMTGDGVNDSPSLKMANVGIAMGIN 777

Query: 701 GTDVAKEASDMVLTDDDFSTILTAIEEGKGIFNNIQNFLTFQXXXXXXXXXXXXXXXXFK 760
           G+DV+KEASD+VL+DD+F++IL A+EEG+ + +NIQ F+                   F+
Sbjct: 778 GSDVSKEASDIVLSDDNFASILNAVEEGRRMTDNIQKFVLQLLAENVAQALYLIIGLVFR 837

Query: 761 LPN-----PLNAMQILWINILMDGPPAQSLGVEPVDHEVMKKPPRKRTDKILTHDVM--- 812
             N     PL+ +++LWI ++    PA  LG+E    ++M +PP      I T +V+   
Sbjct: 838 DENGKSVFPLSPVEVLWIIVVTSCFPAMGLGLEKAAPDLMDRPPHDSEVGIFTWEVIIDT 897

Query: 813 --KRLLTTAACI--IVGTVY 828
               ++ T +C+    G++Y
Sbjct: 898 FAYGIIMTGSCMASFTGSLY 917

>YDR039C (ENA2) [892] chr4 complement(531302..534577) Member of the
           Na[+]-transporting ATPases family in the superfamily of
           P-type ATPases [3276 bp, 1091 aa]
          Length = 1091

 Score =  355 bits (911), Expect = e-106,   Method: Compositional matrix adjust.
 Identities = 264/920 (28%), Positives = 457/920 (49%), Gaps = 148/920 (16%)

Query: 38  YCTLSVDEALEKLDTDKNGGLRSSNEANNRRSLYGPNEITVEDDESL-FKKFLSNFIEDR 96
           Y TL+ +EA E + T    GL + +E+  R    G N  T+ DD  + +K  + + + + 
Sbjct: 17  YHTLTTEEAAEFIGTSLTEGL-TQDESLRRLKAVGEN--TLGDDTKIDYKAMVLHQVCNA 73

Query: 97  MILLLIGSAVVSLFMGNIDDAVSITLAIFIVVTVGFVQEYRSEKSLEALNKLVPAECHLM 156
           MI++L+ S  +S  + +      I+  I + V +G VQEY++ K++ +L  L     H++
Sbjct: 74  MIMVLVISMAISFAVRDWITGGVISFVIAVNVLIGLVQEYKATKTMNSLKNLSSPNAHVI 133

Query: 157 RCGQESHVLASTLVPGDLVHFRIGDRIPADIRIIEAIDLSIDESNLTGENEPVHKTSQTI 216
           R G+   + +  +VPGD+   ++GD IPAD+R+IE  +   DES LTGE+ PV K +  +
Sbjct: 134 RNGKSETINSKDVVPGDICLVKVGDTIPADLRLIETKNFDTDESLLTGESLPVSKDANLV 193

Query: 217 ----EKSSFNDQPNSIVPISERSCIAYMGTLVKEGHGKGIVVGTGTNTSFGAVFEMMN-- 270
               E++S  D+ N          +A+  + V +G  KGIV+ T  N+  G + + +   
Sbjct: 194 FGKEEETSVGDRLN----------LAFSSSAVVKGRAKGIVIKTALNSEIGKIAKSLQGD 243

Query: 271 ----NIEKPKTPLQLTM----------------DKLGKDLSLVSFIVIGMICLVGIIQGR 310
               + +  K+ LQ T                   L + LS ++ ++  +  L  II   
Sbjct: 244 SGLISRDPSKSWLQNTWISTKKVTGAFLGTNVGTPLHRKLSKLAVLLFWIAVLFAIIVMA 303

Query: 311 SWLEMFQI-------SVSLAVAAIPEGLPIIVTVTLALGVLRMAKRKAIVRRLPSVETLG 363
           S  + F +       ++ +A++ IP  L +++T+T+++G   M  R  IVR+L S+E LG
Sbjct: 304 S--QKFDVDKRVAIYAICVALSMIPSSLVVVLTITMSVGAAVMVSRNVIVRKLDSLEALG 361

Query: 364 SVNVICSDKTGTLTSNHMTVSKLW-------CLDSMSNKLN--------VLSLDKNKKTK 408
           +VN ICSDKTGTLT   M   ++W        + +  +  N        +      + + 
Sbjct: 362 AVNDICSDKTGTLTQGKMLARQIWIPRFGTITISNSDDPFNPNEGNVSLIPRFSPYEYSH 421

Query: 409 NSNGN---LKNY--------LTEDV-----RETLTIGNLCNNASFSQEHAI----FLGNP 448
           N +G+   L+N+        L ED+     ++ L    L N A+  ++ A       G+P
Sbjct: 422 NEDGDVGILQNFKDRLYEKDLPEDIDMDLFQKWLETATLANIATVFKDDATDCWKAHGDP 481

Query: 449 TDVALLEQLANFEMPDIRNTVQK---------------------------VQELPFNSKR 481
           T++A+       ++P    T +K                           + E PF+S  
Sbjct: 482 TEIAIQVFATKMDLPHNALTGEKSTNQSNENDQSSLSQHNEKPGSAQFEHIAEFPFDSTV 541

Query: 482 KLMATKILNPVDNKCTVYVKGAFERILEYSTSYLKSKGKKTEKLTEAQKATINECANSMA 541
           K M++   N  +    +Y KGAFE I+   +S+    G K   LT+    TI +   S++
Sbjct: 542 KRMSSVYYNNHNETYNIYGKGAFESIISCCSSWYGKDGVKITPLTDCDVETIRKNVYSLS 601

Query: 542 SEGLRVFGFAKLTLSDSSTPLTEDLIK-----------DLTFTGLIGMNDPPRPNVKFAI 590
           +EGLRV GFA  + +     + +D +K           DL F GLIG+ DPPR     A+
Sbjct: 602 NEGLRVLGFASKSFTKDQ--VNDDQLKNITSNRATAESDLVFLGLIGIYDPPRNETAGAV 659

Query: 591 EQLLQGGVHIIMITGDSENTAVNIAKQIGI----------PVIDPKLSVLSGDKLDEMSD 640
           ++  Q G+++ M+TGD   TA  IA+++GI           ++D    V++G + D +S+
Sbjct: 660 KKFHQAGINVHMLTGDFVGTAKAIAQEVGILPTNLYHYSQEIVDSM--VMTGSQFDGLSE 717

Query: 641 DQLANVIDHVNIFARATPEHKLNIVRALRKRGDVVAMTGDGVNDAPALKLSDIGVSMGRI 700
           +++ ++     + AR +P+ K+ ++ AL +R    AMTGDGVND+P+LK++++G++MG  
Sbjct: 718 EEVDDLPVLPLVIARCSPQTKVRMIEALHRRKKFCAMTGDGVNDSPSLKMANVGIAMGIN 777

Query: 701 GTDVAKEASDMVLTDDDFSTILTAIEEGKGIFNNIQNFLTFQXXXXXXXXXXXXXXXXFK 760
           G+DV+KEASD+VL+DD+F++IL A+EEG+ + +NIQ F+                   F+
Sbjct: 778 GSDVSKEASDIVLSDDNFASILNAVEEGRRMTDNIQKFVLQLLAENVAQALYLIIGLVFR 837

Query: 761 LPN-----PLNAMQILWINILMDGPPAQSLGVEPVDHEVMKKPPRKRTDKILTHDVM--- 812
             N     PL+ +++LWI ++    PA  LG+E    ++M +PP      I T +V+   
Sbjct: 838 DENGKSVFPLSPVEVLWIIVVTSCFPAMGLGLEKAAPDLMDRPPHDSEVGIFTWEVIIDT 897

Query: 813 --KRLLTTAACI--IVGTVY 828
               ++ T +C+    G++Y
Sbjct: 898 FAYGIIMTGSCMASFTGSLY 917

>KLLA0F20658g 1919851..1923099 similar to sp|Q12691 Saccharomyces
           cerevisiae YDR038c ENA5 P-type ATPase involved in Na+
           efflux, start by similarity
          Length = 1082

 Score =  355 bits (910), Expect = e-106,   Method: Compositional matrix adjust.
 Identities = 275/911 (30%), Positives = 453/911 (49%), Gaps = 130/911 (14%)

Query: 32  PSPSLEYCTLSVDEALEKLDTDKNGGLRSSNEANNRRSLYGPNEITVEDDESL-FKKFLS 90
           P    ++  L+  +  + L T  N GL ++  A  R SL G N  T+ DD  +  K  L 
Sbjct: 13  PYARNDFHVLTAPQVEKLLSTHINQGLNNTQIAE-RLSLVGEN--TLGDDTKINIKGILI 69

Query: 91  NFIEDRMILLLIGSAVVSLFMGNIDDAVSITLAIFIV---VTVGFVQEYRSEKSLEALNK 147
           + I + MI++LI S V++L    I D +S  +  F+V   V +G  QEY + K++ +L  
Sbjct: 70  SQICNAMIMVLIISMVITL---AIKDWISGGVLAFVVGINVVIGAYQEYNASKTMNSLKS 126

Query: 148 LVPAECHLMRCGQESHVLASTLVPGDLVHFRIGDRIPADIRIIEAIDLSIDESNLTGENE 207
           L     H++R G +  + +  LVPGD+   ++GD +PAD+R++E+I+L  DE+ LTGE+ 
Sbjct: 127 LSTPSAHVIRDGNDITIQSKELVPGDICIIKVGDTVPADLRLLESINLETDEALLTGESL 186

Query: 208 PVHKT-SQTIEKSSFNDQPNSIVPISERSCIAYMGTLVKEGHGKGIVVGTGTNTSFGAVF 266
           PV K+ S+  EK +         P+ +R  +A+  + V +G   GIV+ T  NT  G + 
Sbjct: 187 PVAKSHSEVYEKDT---------PVGDRLNLAFAASTVTKGRATGIVIKTALNTEIGKIA 237

Query: 267 EMMNN----IEKPK-------------------------TPLQLTMDKLGKDLSLVSFIV 297
           + + +    I K +                         TPL   + +L   + L    V
Sbjct: 238 KSLKSETSFISKDENKSFGQNLWITLKETIGSFLGTNVGTPLHRKLSQLA--ILLFVVAV 295

Query: 298 IGMICLVGIIQGRSWLEMFQISVSLAVAAIPEGLPIIVTVTLALGVLRMAKRKAIVRRLP 357
           I  I ++G  + R   ++   ++ +A++ IP  L +++T+T++ G   MA R  IVR+L 
Sbjct: 296 IFAIVVMGTQKYRVNKQVAIYAICVAISMIPSSLVVVLTITMSAGAKVMATRNVIVRKLD 355

Query: 358 SVETLGSVNVICSDKTGTLTSNHMTVSKLWCLD------SMSNK---------------- 395
           S+E LG+VN ICSDKTGTLT   M   ++W           SN+                
Sbjct: 356 SLEALGAVNDICSDKTGTLTQGKMIAKQVWIPQFGTITVQESNEPFNPTIGEIHLIPKFS 415

Query: 396 -----------LNVLSLDKNKKTKNSNGNLKNYLTEDVRETLTIGNLCN--NASFSQEHA 442
                      + ++   K+K      G L   L +    T T+ N+      S +Q+  
Sbjct: 416 PYQYKHDDEEDVGIIPDFKSKYLAGELGPLNVSLFDQWLYTATLANIATVFQDSETQDWK 475

Query: 443 IFLGNPTDVALLEQLANFEMP-------------DIR--NTVQKVQELPFNSKRKLMATK 487
              G+PT++A+       ++P             D R  ++ + V E PF+S  K M+  
Sbjct: 476 AH-GDPTEIAIQVFATRMDLPRHVLTGEDKDDEKDARANSSFEHVAEFPFDSSVKRMSAI 534

Query: 488 ILNPVDNKCTVY---VKGAFERILEYSTSYLKSKGKKTEKLTEAQKATINECANSMASEG 544
             N  D    +Y    KGAFER+L+   S+  +   K   L++    TI +  ++++SEG
Sbjct: 535 YKNTEDPATPIYEVFTKGAFERVLQCCDSWYTTPDGKPSPLSKEDLETIQKNVDTLSSEG 594

Query: 545 LRVFGFAKLTLSDSSTPLTED-LIKD-------LTFTGLIGMNDPPRPNVKFAIEQLLQG 596
           LRV  FAK + ++S     +D L+K+       LTF GLIG+ DPPR     A+++  Q 
Sbjct: 595 LRVLAFAKKSFNESEFNANKDKLLKERDFVECKLTFLGLIGIYDPPRQESLAAVKKCHQA 654

Query: 597 GVHIIMITGDSENTAVNIAKQIGI--------PVIDPKLSVLSGDKLDEMSDDQLANVID 648
           G+++ M+TGD   TA +IA+++GI        P       V++    D +SD ++ ++  
Sbjct: 655 GINVHMLTGDFPGTAKSIAQEVGILPHNLYHYPKEVVNFMVMAATDFDALSDQEIDDLRV 714

Query: 649 HVNIFARATPEHKLNIVRALRKRGDVVAMTGDGVNDAPALKLSDIGVSMGRIGTDVAKEA 708
              + AR  P+ K+ ++ AL +R    AMTGDGVND+P+LK++++G++MG  G+DVAK+A
Sbjct: 715 LPLVIARCAPQTKVRMIEALHRRSKFCAMTGDGVNDSPSLKIANVGIAMGINGSDVAKDA 774

Query: 709 SDMVLTDDDFSTILTAIEEGKGIFNNIQNFLTFQXXXXXXXXXXXXXXXXFKLPN----- 763
           SD+VL+DD+F++IL A+EEG+ + +NIQ F+                   F         
Sbjct: 775 SDIVLSDDNFASILNAVEEGRRMSDNIQKFVLQLLAENVAQALYLMVGLCFVDKEGFSVF 834

Query: 764 PLNAMQILWINILMDGPPAQSLGVEPVDHEVMKKPPRKRTDKILTHDVMKRLLT----TA 819
           PL+ +++LWI ++    PA  LG+E    +VM+KPP+     + T +V+  +L      A
Sbjct: 835 PLSPVEVLWIIVVTSCFPAMGLGLEKASVDVMEKPPKDAKAVVFTWEVIIDMLVYGVIMA 894

Query: 820 ACIIVGTVYIF 830
           AC +   V + 
Sbjct: 895 ACCMACFVTVL 905

>YDR038C (ENA5) [891] chr4 complement(527417..530692) Member of the
           Na[+]-transporting ATPases family in the superfamily of
           P-type ATPases [3276 bp, 1091 aa]
          Length = 1091

 Score =  354 bits (909), Expect = e-106,   Method: Compositional matrix adjust.
 Identities = 264/920 (28%), Positives = 457/920 (49%), Gaps = 148/920 (16%)

Query: 38  YCTLSVDEALEKLDTDKNGGLRSSNEANNRRSLYGPNEITVEDDESL-FKKFLSNFIEDR 96
           Y TL+ +EA E + T    GL + +E+  R    G N  T+ DD  + +K  + + + + 
Sbjct: 17  YHTLTTEEAAEFIGTSLTEGL-TQDESLRRLKAVGEN--TLGDDTKIDYKAMVLHQVCNA 73

Query: 97  MILLLIGSAVVSLFMGNIDDAVSITLAIFIVVTVGFVQEYRSEKSLEALNKLVPAECHLM 156
           MI++L+ S  +S  + +      I+  I + V +G VQEY++ K++ +L  L     H++
Sbjct: 74  MIMVLVISMAISFAVRDWITGGVISFVIAVNVLIGLVQEYKATKTMNSLKNLSSPNAHVI 133

Query: 157 RCGQESHVLASTLVPGDLVHFRIGDRIPADIRIIEAIDLSIDESNLTGENEPVHKTSQTI 216
           R G+   + +  +VPGD+   ++GD IPAD+R+IE  +   DES LTGE+ PV K +  +
Sbjct: 134 RNGKSETINSKDVVPGDICLVKVGDTIPADLRLIETKNFDTDESLLTGESLPVSKDANLV 193

Query: 217 ----EKSSFNDQPNSIVPISERSCIAYMGTLVKEGHGKGIVVGTGTNTSFGAVFEMMN-- 270
               E++S  D+ N          +A+  + V +G  KGIV+ T  N+  G + + +   
Sbjct: 194 FGKEEETSVGDRLN----------LAFSSSAVVKGRAKGIVIKTALNSEIGKIAKSLQGD 243

Query: 271 ----NIEKPKTPLQLTM----------------DKLGKDLSLVSFIVIGMICLVGIIQGR 310
               + +  K+ LQ T                   L + LS ++ ++  +  L  II   
Sbjct: 244 SGLISRDPSKSWLQNTWISTKKVTGAFLGTNVGTPLHRKLSKLAVLLFWIAVLFAIIVMA 303

Query: 311 SWLEMFQI-------SVSLAVAAIPEGLPIIVTVTLALGVLRMAKRKAIVRRLPSVETLG 363
           S  + F +       ++ +A++ IP  L +++T+T+++G   M  R  IVR+L S+E LG
Sbjct: 304 S--QKFDVDKRVAIYAICVALSMIPSSLVVVLTITMSVGAAVMVSRNVIVRKLDSLEALG 361

Query: 364 SVNVICSDKTGTLTSNHMTVSKLW-------CLDSMSNKLN--------VLSLDKNKKTK 408
           +VN ICSDKTGTLT   M   ++W        + +  +  N        +      + + 
Sbjct: 362 AVNDICSDKTGTLTQGKMLARQIWIPRFGTITISNSDDPFNPNEGNVSLIPRFSPYEYSH 421

Query: 409 NSNGN---LKNY--------LTEDV-----RETLTIGNLCNNASFSQEHAI----FLGNP 448
           N +G+   L+N+        L ED+     ++ L    L N A+  ++ A       G+P
Sbjct: 422 NEDGDVGILQNFKDRLYEKDLPEDIDMDLFQKWLETATLANIATVFKDDATDCWKAHGDP 481

Query: 449 TDVALLEQLANFEMPDIRNTVQK---------------------------VQELPFNSKR 481
           T++A+       ++P    T +K                           + E PF+S  
Sbjct: 482 TEIAIQVFATKMDLPHNALTGEKSTNQSNENDQSSLSQHNEKPGSAQFEHIAEFPFDSTV 541

Query: 482 KLMATKILNPVDNKCTVYVKGAFERILEYSTSYLKSKGKKTEKLTEAQKATINECANSMA 541
           K M++   N  +    +Y KGAFE I+   +S+    G K   LT+    TI +   S++
Sbjct: 542 KRMSSVYYNNHNETYNIYGKGAFESIISCCSSWYGKDGVKITPLTDCDVETIRKNVYSLS 601

Query: 542 SEGLRVFGFAKLTLSDSSTPLTEDLIK-----------DLTFTGLIGMNDPPRPNVKFAI 590
           +EGLRV GFA  + +     + +D +K           DL F GLIG+ DPPR     A+
Sbjct: 602 NEGLRVLGFASKSFTKDQ--VNDDQLKNITSNRATAESDLVFLGLIGIYDPPRNETAGAV 659

Query: 591 EQLLQGGVHIIMITGDSENTAVNIAKQIGI----------PVIDPKLSVLSGDKLDEMSD 640
           ++  Q G+++ M+TGD   TA  IA+++GI           ++D    V++G + D +S+
Sbjct: 660 KKFHQAGINVHMLTGDFVGTAKAIAQEVGILPTNLYHYSQEIVDSM--VMTGSQFDGLSE 717

Query: 641 DQLANVIDHVNIFARATPEHKLNIVRALRKRGDVVAMTGDGVNDAPALKLSDIGVSMGRI 700
           +++ ++     + AR +P+ K+ ++ AL +R    AMTGDGVND+P+LK++++G++MG  
Sbjct: 718 EEVDDLPVLPLVIARCSPQTKVRMIEALHRRKKFCAMTGDGVNDSPSLKMANVGIAMGIN 777

Query: 701 GTDVAKEASDMVLTDDDFSTILTAIEEGKGIFNNIQNFLTFQXXXXXXXXXXXXXXXXFK 760
           G+DV+KEASD+VL+DD+F++IL A+EEG+ + +NIQ F+                   F+
Sbjct: 778 GSDVSKEASDIVLSDDNFASILNAVEEGRRMTDNIQKFVLQLLAENVAQALYLIIGLVFR 837

Query: 761 LPN-----PLNAMQILWINILMDGPPAQSLGVEPVDHEVMKKPPRKRTDKILTHDVM--- 812
             N     PL+ +++LWI ++    PA  LG+E    ++M +PP      I T +V+   
Sbjct: 838 DENGKSVFPLSPVEVLWIIVVTSCFPAMGLGLEKAAPDLMDRPPNDSEVGIFTWEVIIDT 897

Query: 813 --KRLLTTAACI--IVGTVY 828
               ++ T +C+    G++Y
Sbjct: 898 FAYGIIMTGSCMASFTGSLY 917

>AGL097C [4215] [Homologous to ScYDR039C (ENA2 ) - NSH]
           (520915..524205) [3291 bp, 1096 aa]
          Length = 1096

 Score =  353 bits (906), Expect = e-105,   Method: Compositional matrix adjust.
 Identities = 274/915 (29%), Positives = 458/915 (50%), Gaps = 132/915 (14%)

Query: 37  EYCTLSVDEALEKLDTDKNGGLRSSNEANNRRSLYGPNEITVEDDESL-FKKFLSNFIED 95
           ++  L   E    L TD   GL ++ EA  R  + G N  T+ ++E +  +  L   + +
Sbjct: 20  DFHALPAHEVARLLGTDLRRGL-TAEEARARLEVVGDN--TLGEEEGINVRAILLKQMCN 76

Query: 96  RMILLLIGSAVVSLFMGNIDDAVSITLAIFIV---VTVGFVQEYRSEKSLEALNKLVPAE 152
            MIL+LI S V++L    I D +S  +  F+V   V++G  QEY + K++ +L  L    
Sbjct: 77  AMILVLIISMVIAL---AIKDWISGGVIAFVVALNVSIGAYQEYNACKTMNSLKDLSTPS 133

Query: 153 CHLMRCGQESHVLASTLVPGDLVHFRIGDRIPADIRIIEAIDLSIDESNLTGENEPVHKT 212
             ++R G++  + ++ +VPGD+V  R+GD +PAD+R++EA++L  DE+ LTGE  PV K 
Sbjct: 134 ARVIRNGEDVVMASAQVVPGDIVQVRVGDTVPADLRLVEALNLETDEALLTGEALPVAKD 193

Query: 213 SQTIEKSSFNDQPNSIVPISERSCIAYMGTLVKEGHGKGIVVGTGTNTSFGAVFEMMN-- 270
              + +           P+ +R  +A+  + V +G   GIVV TG  +  G + E +   
Sbjct: 194 PAAVFEQD--------TPVGDRLNLAFASSTVSKGRATGIVVRTGLRSEIGKIAESLQGK 245

Query: 271 ----NIEKPKTPLQLTM--------------------DKLGKDLSLVSFIVIGMICLVGI 306
               + ++ K+ LQ T+                     KL K L+L+ F +  +  L+ +
Sbjct: 246 QSLISRDENKSGLQNTVLTVKASVGSFLGTNVGTPLHRKLAK-LALILFAIAVLFALI-V 303

Query: 307 IQGRSWL---EMFQISVSLAVAAIPEGLPIIVTVTLALGVLRMAKRKAIVRRLPSVETLG 363
           +  + ++   E+   ++ +A++ IP  L +++T+T++ G   M+ R  IVRRL S+E LG
Sbjct: 304 MATQKFIVNREVAIYAICVALSMIPSSLVVVLTITMSAGAKVMSTRNVIVRRLDSLEALG 363

Query: 364 SVNVICSDKTGTLTSNHMTVSKLWCLD---SMSNKLNV---------------------- 398
           +VN ICSDKTGTLT   M + +LW  +    + N+ NV                      
Sbjct: 364 AVNDICSDKTGTLTQGKMILKQLWVPEFGTVVVNRSNVPFDPTVGDVSLIPRFSPWEYQH 423

Query: 399 -----LSLDKNKKTKNSNGNLKNYLT----EDVRETLTIGNLCN--NASFSQEHAIFLGN 447
                + +  N K +  + +L   L     E    T T+ N+      S S+E     G+
Sbjct: 424 DEEEDVGIIANFKQRWQSNSLPKGLNPRKFESWLHTATLANIATVFKDSDSKEWRAH-GD 482

Query: 448 PTDVALLEQLANFEMP-------------------DIRNTVQKVQELPFNSKRKLMATKI 488
           PT++A+       + P                   D     +   E PF+S  K M+   
Sbjct: 483 PTEIAIQVFATRMDHPHHALTTEQDEEDSDSSQQNDAARIYEHAAEFPFDSSIKRMSAVY 542

Query: 489 LNPVD-NKCTVYVKGAFERILEYSTSYLKSKGKK-TEKLTEAQKATINECANSMASEGLR 546
           +N  D N   V+ KGAFER+L+  T +    G   T  LTE     I +  +++++EGLR
Sbjct: 543 INLRDKNTRHVFTKGAFERVLKCCTRWKLDPGTGVTHPLTEDDLEIIQKNVDTLSNEGLR 602

Query: 547 VFGFAKLTL-SDSSTPLTEDLIKD-------LTFTGLIGMNDPPRPNVKFAIEQLLQGGV 598
           V  FA  T+ ++ +  L E L KD       L F GL+G+ DPPR     A+++  + G+
Sbjct: 603 VLAFATKTIPAEEAESLGERLTKDRDFVESDLIFQGLVGIYDPPRVETAGAVKKCHRAGI 662

Query: 599 HIIMITGDSENTAVNIAKQIGI----------PVIDPKLSVLSGDKLDEMSDDQLANVID 648
           ++ M+TGD   TA  IA+++GI           V+D  + V++  + D ++D++L  +  
Sbjct: 663 NVHMLTGDFPGTAKAIAQEVGILPHNLYHYPKEVVD--IMVMTATQFDSLTDEELDQLPV 720

Query: 649 HVNIFARATPEHKLNIVRALRKRGDVVAMTGDGVNDAPALKLSDIGVSMGRIGTDVAKEA 708
              + AR  P+ K+ ++ AL +R    AMTGDGVND+P+LK +++G++MG  G+DVAK+A
Sbjct: 721 LPLVIARCAPQTKVRMIDALHRREKFCAMTGDGVNDSPSLKKANVGIAMGINGSDVAKDA 780

Query: 709 SDMVLTDDDFSTILTAIEEGKGIFNNIQNFLTFQXXXXXXXXXXXXXXXXF----KLP-N 763
           SD+VL+DD+F++IL A+EEG+ + +NIQ F+                   F    KL   
Sbjct: 781 SDIVLSDDNFASILNAVEEGRRMSDNIQKFVLQLLAANVAQAIYLMLGLTFLDEDKLSVF 840

Query: 764 PLNAMQILWINILMDGPPAQSLGVEPVDHEVMKKPPRKRTDKILTHDVMKRLLTTAACII 823
           PL+ +++LWI ++    PA  LG+E    ++M+KPP      I T +V+  ++     + 
Sbjct: 841 PLSPVEVLWIIVVTSCLPAMGLGLEKAAPDIMEKPPNDSKAGIFTWEVIVDMIVYGLVMA 900

Query: 824 VGTVYIFVKEMAEDG 838
           V  +  FV  + +DG
Sbjct: 901 VCCLGCFVSIIYKDG 915

>Kwal_47.17547
          Length = 1240

 Score =  325 bits (832), Expect = 1e-94,   Method: Compositional matrix adjust.
 Identities = 283/1016 (27%), Positives = 467/1016 (45%), Gaps = 185/1016 (18%)

Query: 50   LDTDKNGGLRSSNE---ANNRRSLYGPNEITVEDDESLFKKFLSNFIEDRMILLLIGSAV 106
            L TD+N GL  ++E      R  LYG N I     +S  +     F +DR+++LL  +AV
Sbjct: 61   LKTDRNAGLTIADEDITQTERYQLYGDNRIPQRKPKSFLQLAWIAF-QDRIMILLTVAAV 119

Query: 107  VSLFMG-------------------NID--DAVSITLAIFIVVTVGFVQEYRSEKSLEAL 145
            VS  +G                    +D  + V+I +A+ +V+ VG   +Y+ E     L
Sbjct: 120  VSFALGLYEVLGQPPEHDAEGKKITKVDWVEGVAIMIAVLVVILVGSANDYQKELQFSKL 179

Query: 146  N-KLVPAECHLMRCGQESHVLASTLVPGDLVHFRIGDRIPADIRIIEAIDLSIDESNLTG 204
            N K    E  ++R G E  +    ++ GD++  + GD +PAD  +++      DES LTG
Sbjct: 180  NDKKNDREVIVLRNGDEHLISIHDILVGDILSLQTGDVVPADCILVKG-SCECDESALTG 238

Query: 205  ENEPVHKTS-----QTIEKSSFNDQPNSI-VPISER--SCIAYMGTLVKEGHGKGIVVGT 256
            E+  + K +     +  ++ S  D    I  P +E+    +   G+ +  G G+ +V   
Sbjct: 239  ESATIKKAAIDVCYEKYKQLSATDAAIDIGTPGAEKVPDPMLISGSKLLSGLGRAVVTSV 298

Query: 257  GTNTSFGAVFEMMNNIEKPKTPLQLTMDKLGKDLS-------LVSFIVIGMICLVGI--- 306
            G N+  G    M   +E   TPLQ  +D L   +S       L+ F ++ M  L  +   
Sbjct: 299  GVNSMHGRTL-MALKVEAETTPLQERLDSLANSISVYGSAAALLLFFILFMRFLANLKKG 357

Query: 307  ---------IQGRSWLEMFQISVSLAVAAIPEGLPIIVTVTLALGVLRMAKRKAIVRRLP 357
                      +G  ++ +F + +++ V A+PEGLP+ VT+ LA    RMAK   +VR L 
Sbjct: 358  GELHDLTPAQKGSRFMNIFIVGITVIVVAVPEGLPLAVTLALAFATTRMAKDGNLVRVLR 417

Query: 358  SVETLGSVNVICSDKTGTLTSNHMTVSKLW----------------------------CL 389
            + ET+GS   +CSDKTGTLT N MTV K +                            C 
Sbjct: 418  ACETMGSATAVCSDKTGTLTENRMTVVKGFLGSTFFDEAESVGPSDSETDVDLAIANECS 477

Query: 390  DSMSNK------LNVLSLD--KNKKTKNSNGNLKNYLTEDV---------RETLTIGNLC 432
            + +         LN  + +  +N++ K SN N  +   + +         ++  T   L 
Sbjct: 478  EELKKDVLTNITLNSTAFENKENEEDKVSNENPFHKPRKSLFPWSRNNKSKKPATAKELV 537

Query: 433  NNASFSQEHAIFLGNPTDVALL---------EQLANF-EMPDIRNTVQKVQELPFNSKRK 482
             NA+  Q    FLG+ T+ ALL         + L ++ + PD     + VQ +PF S RK
Sbjct: 538  ENAAADQPKEPFLGSKTETALLAFAQKNLGMQNLHHYRDEPDCLGIEKIVQIIPFESSRK 597

Query: 483  L--MATKILNPVDNKCTVYVKGAFERILEYSTSYLKSKGKKT---EKLTEAQKATINECA 537
               +  K  N +      Y+KGA E +L        S  K T   +K  + +  TI    
Sbjct: 598  WGGIVVKYKNGLHR---FYIKGAAELLLRRCMQKRASDSKLTLISQKDFDEESQTIT--- 651

Query: 538  NSMASEGLRVFGFA--------------------------------KLTLSDSSTPLTED 565
             ++A+E LR    A                                +++ SDS +   ++
Sbjct: 652  -NLAAEALRAISLAHRDYPNCPNWPPSELQDEVEPEAASPDLLFGDEVSRSDSVSEPAQE 710

Query: 566  LIKDLTFTGLIGMNDPPRPNVKFAIEQLLQGGVHIIMITGDSENTAVNIAKQIGI----P 621
            L+  +   G++G+ DP R  V+ ++EQ  + GV + M+TGD+  TA  IAK+  I     
Sbjct: 711  LVSPMVLDGIVGIQDPLRKGVRKSVEQCQKAGVTVRMVTGDNILTATAIAKKCSILSEEQ 770

Query: 622  VIDPKLSVLSGDKLDEMSDDQLANVIDHVNIFARATPEHKLNIVRALRKRGDVVAMTGDG 681
              +P+ S + G +  ++S+ +   ++ ++ + AR++PE K  +V  L+K GDVVA+TGDG
Sbjct: 771  AENPE-SSMEGPRFRKLSNKERVRILPNLRVLARSSPEDKRILVETLKKMGDVVAVTGDG 829

Query: 682  VNDAPALKLSDIGVSMGRIGTDVAKEASDMVLTDDDFSTILTAIEEGKGIFNNIQNFLTF 741
             NDAPALKL+D+G SMG  GT+VA+EASD++L  DDFS I+ AI+ G+ +  +I+ F+ F
Sbjct: 830  TNDAPALKLADVGFSMGIAGTEVAREASDIILMTDDFSAIVNAIKWGRCVSTSIKKFIQF 889

Query: 742  QXXXXXXXXXXX--XXXXXFKLPNPLNAMQILWINILMDGPPAQSLGVEPVDHEVMKKPP 799
            Q                   +  + L A+Q+LW+N++MD   A +L  +  D  ++++ P
Sbjct: 890  QLTVNVTAVVLTFVSAVASSEEASVLTAVQLLWVNLIMDTLAALALATDKPDENILERKP 949

Query: 800  RKRTDKILTHDVMKRLL--TTAACIIVGTVYIFVKEMAEDGKVT------ARDTTMTFTC 851
            + R   ++T    K +L  +T   I+   ++   K++   GK T       +   MTF  
Sbjct: 950  KGREAVLITVSTWKMILGQSTLQLIVTFILHFAGKQIFFPGKATITGHEQQQLNAMTFNA 1009

Query: 852  FVFFDMFNALACRHNTKSIFEIGFFTNKMFNYAVGLS-LLGQMCAIYIPFFQSIFK 906
            FV+   F  +  R                 + A G+S +  ++ A  + FFQ +F+
Sbjct: 1010 FVWLQFFKLIVTRK---------------LDEADGISNVKDRITASNLNFFQDLFR 1050

>YGL006W (PMC1) [1966] chr7 (485923..489444) Vacuolar
            Ca2+-transporting P-type ATPase, member of the cation
            transporting (E1-E2) P-type ATPase superfamily, functions
            to pump Ca2+ into the vacuole [3522 bp, 1173 aa]
          Length = 1173

 Score =  313 bits (801), Expect = 1e-90,   Method: Compositional matrix adjust.
 Identities = 291/1030 (28%), Positives = 473/1030 (45%), Gaps = 182/1030 (17%)

Query: 47   LEKLDTDKNGGLR----SSNEANNRRSLYGPNEITVEDDESLFKKFLSNFIEDRMILLLI 102
             + L TDKN G+     S+    NR   YG N +     +S  +   + F  D+ + LL 
Sbjct: 63   FKYLKTDKNAGISLPEISNYRKTNRYKNYGDNSLPERIPKSFLQLVWAAF-NDKTMQLLT 121

Query: 103  GSAVVSLFMG-------------------NID--DAVSITLAIFIVVTVGFVQEYRSEKS 141
             +AVVS  +G                    +D  + V+I +A+F+VV V    +Y+ E  
Sbjct: 122  VAAVVSFVLGLYELWMQPPQYDPEGNKIKQVDWIEGVAIMIAVFVVVLVSAANDYQKELQ 181

Query: 142  LEALNKLVP-AECHLMRCGQESHVLASTLVPGDLVHFRIGDRIPADIRIIEAIDLSIDES 200
               LNK     +  ++R  QE  +    ++ GD++  + GD +PAD  +I       DES
Sbjct: 182  FAKLNKKKENRKIIVIRNDQEILISIHHVLVGDVISLQTGDVVPADCVMISG-KCEADES 240

Query: 201  NLTGENE-----PVHKTSQTIEK-----SSFNDQPNSIVPISE-----RSCIAYMGTLVK 245
            ++TGE+      PV  + +  +K     S  + +P  I  ++E       C+   G+ + 
Sbjct: 241  SITGESNTIQKFPVDNSLRDFKKFNSIDSHNHSKPLDIGDVNEDGNKIADCMLISGSRIL 300

Query: 246  EGHGKGIVVGTGTNTSFGAVFEMMNNIEKPKTPLQLTMDKLGKDLS-------LVSFIVI 298
             G G+G++   G N+ +G     +N  E   TPLQL + +L  ++S       ++ F+V+
Sbjct: 301  SGLGRGVITSVGINSVYGQTMTSLN-AEPESTPLQLHLSQLADNISVYGCVSAIILFLVL 359

Query: 299  GMICLVGII-------------QGRSWLEMFQISVSLAVAAIPEGLPIIVTVTLALGVLR 345
                L  II             +G  ++ +F  S+++ V A+PEGLP+ VT+ LA    R
Sbjct: 360  FTRYLFYIIPEDGRFHDLDPAQKGSKFMNIFITSITVIVVAVPEGLPLAVTLALAFATTR 419

Query: 346  MAKRKAIVRRLPSVETLGSVNVICSDKTGTLTSNHMTVSKLW------------------ 387
            M K   +VR L S ET+GS   +CSDKTGTLT N MTV + +                  
Sbjct: 420  MTKDGNLVRVLRSCETMGSATAVCSDKTGTLTENVMTVVRGFPGNSKFDDSKSLPVSEQR 479

Query: 388  -----------CLDSMSNKL--NVL-------SLDKNKKTKNSNG--NLKNYLT--EDVR 423
                       C  S+ N L  N++       + D  K  KN+NG  N+   L+  +  +
Sbjct: 480  KLNSKKVFEENCSSSLRNDLLANIVLNSTAFENRDYKKNDKNTNGSKNMSKNLSFLDKCK 539

Query: 424  ETLTI---GN-------LCNNASFSQEHAIFLGNPTDVAL--------------LEQLAN 459
              L+    GN       L  N +  ++   F+G+ T+ AL              L+ L +
Sbjct: 540  SRLSFFKKGNREDDEDQLFKNVNKGRQEP-FIGSKTETALLSLARLSLGLQPGELQYLRD 598

Query: 460  FEMPDIRNTVQKVQELPFNSKRKLMATKI-LNPVDNKCTVY---VKGAFERILEYSTSYL 515
              M    N  + VQ +PF S RK     +      NK   Y   +KGA E I+  + SY 
Sbjct: 599  QPMEKF-NIEKVVQTIPFESSRKWAGLVVKYKEGKNKKPFYRFFIKGAAE-IVSKNCSYK 656

Query: 516  KSKGKKTEKLTEAQKATINECANSMASEGLRVFGFA-------------KLTLSDSSTPL 562
            ++     E++ E  K   ++   ++AS+ LR    A             +L   DS    
Sbjct: 657  RNSDDTLEEINEDNKKETDDEIKNLASDALRAISVAHKDFCECDSWPPEQLRDKDSPNIA 716

Query: 563  TEDLI----KDLTFTGLIGMNDPPRPNVKFAIEQLLQGGVHIIMITGDSENTAVNIAKQI 618
              DL+    K L   GL+G+ DP R  V+ +++Q  + GV + M+TGD+  TA  IA+  
Sbjct: 717  ALDLLFNSQKGLILDGLLGIQDPLRAGVRESVQQCQRAGVTVRMVTGDNILTAKAIARNC 776

Query: 619  GIPVID---PKLSVLSGDKLDEMSDDQLANVIDHVNIFARATPEHKLNIVRALRKRGDVV 675
             I   D      S + G +  +++ ++   ++ ++ + AR++PE K  +V  L+  GDVV
Sbjct: 777  AILSTDISSEAYSAMEGTEFRKLTKNERIRILPNLRVLARSSPEDKRLLVETLKGMGDVV 836

Query: 676  AMTGDGVNDAPALKLSDIGVSMGRIGTDVAKEASDMVLTDDDFSTILTAIEEGKGIFNNI 735
            A+TGDG NDAPALKL+D+G SMG  GT+VA+EASD++L  DDFS I+ AI+ G+ +  +I
Sbjct: 837  AVTGDGTNDAPALKLADVGFSMGISGTEVAREASDIILMTDDFSAIVNAIKWGRCVSVSI 896

Query: 736  QNFLTFQ--XXXXXXXXXXXXXXXXFKLPNPLNAMQILWINILMDGPPAQSLGVEPVDHE 793
            + F+ FQ                      + L A+Q+LWIN++MD   A +L  +  D  
Sbjct: 897  KKFIQFQLIVNITAVILTFVSSVASSDETSVLTAVQLLWINLIMDTLAALALATDKPDPN 956

Query: 794  VMKKPPRKRTDKILTHDVMKRLLTTAACIIVGT--VYIFVKEM---AEDGKVTARD---- 844
            +M + PR R+  +++    K +L+ A   ++ T  ++ +  E+     + ++T+      
Sbjct: 957  IMDRKPRGRSTSLISVSTWKMILSQATLQLIVTFILHFYGPELFFKKHEDEITSHQQQQL 1016

Query: 845  TTMTFTCFVFFDMFNALACRH--------NTK---SIFEIGFFTNKMFNYA--VGLSLLG 891
              MTF  FV+   F  L  R         N +   S   + FF +   NY     ++++G
Sbjct: 1017 NAMTFNTFVWLQFFTMLVSRKLDEGDGISNWRGRISAANLNFFQDLGRNYYFLTIMAIIG 1076

Query: 892  QMCAIYIPFF 901
              C + I FF
Sbjct: 1077 S-CQVLIMFF 1085

>CAGL0A00517g 58830..62198 similar to sp|P38929 Saccharomyces
           cerevisiae YGL006w PMC1, hypothetical start
          Length = 1122

 Score =  297 bits (760), Expect = 3e-85,   Method: Compositional matrix adjust.
 Identities = 275/973 (28%), Positives = 438/973 (45%), Gaps = 159/973 (16%)

Query: 45  EAL-EKLDTDKNGGLRSSNEAN----NRRSLYGPNEITVEDDESLFKKFLSNFIEDRMIL 99
           EAL  +L TD   G+ +  +A      RR  YG N +     +S F   +    +DR +L
Sbjct: 25  EALARRLSTDLANGIATDKDAELPPLKRRDAYGSNRLPERAPKS-FWALVREAFQDRTML 83

Query: 100 LLIGSAVVSLFMG-------------------NID--DAVSITLAIFIVVTVGFVQEYRS 138
           LL G+AVVS  +G                    +D  + ++I +A+ +VV V    +Y+ 
Sbjct: 84  LLTGAAVVSFTLGIYEVLTQPPELDPEGNPITQVDWIEGLAIMMAVLVVVLVSAANDYQK 143

Query: 139 EKSLEALN-KLVPAECHLMRCGQESHVLASTLVPGDLVHFRIGDRIPADIRIIEAIDLSI 197
           E   + LN K    +  ++R   ES +    L+ GDL+  + GD +PAD  ++   +   
Sbjct: 144 ELQFQQLNRKREDRQVVVVRDAAESLISIHNLLVGDLLKLQTGDVVPADCVLVRG-ECET 202

Query: 198 DESNLTGENEPVHKT-------------SQTIEKSSFNDQPNSIVPISERSCIAYMGTLV 244
           DES LTGE+  + K               + I  +S +    +        C+   G+ V
Sbjct: 203 DESALTGESNTIKKLPLADALEYHSAHGGRDIGDTSASGASGAADDSRCPDCMLISGSRV 262

Query: 245 KEGHGKGIVVGTGTNTSFGAVFEMMNNIEKPKTPLQLTMDKLGKDLSLVS-------FIV 297
             G    IV   G N+  G     +   +   TPLQ+ + +L  ++S+         F+V
Sbjct: 263 LSGLASAIVTNVGVNSVHGKTMASLKE-DSEDTPLQMRLSQLTDNISVYGCVAAITLFVV 321

Query: 298 IGMICLVGII-------------QGRSWLEMFQISVSLAVAAIPEGLPIIVTVTLALGVL 344
           +    L  I+             +G  ++++F  ++++ V A+PEGLP+ VT+ LA    
Sbjct: 322 LFARYLSYILPSGGKYHDLPPAEKGSKFMDIFITAITVIVVAVPEGLPLAVTLALAFATT 381

Query: 345 RMAKRKAIVRRLPSVETLGSVNVICSDKTGTLTSNHMTV-------------------SK 385
           RM K   +VR L S ET+GS   +CSDKTGTLT N MTV                   S 
Sbjct: 382 RMTKDGNLVRVLRSCETMGSATAVCSDKTGTLTENIMTVVRGTLGRAGFDDIGADPSKSN 441

Query: 386 LWCLDSMSNKLNVLSLD---------KNKKTKNSNG------NLKNYLTEDVRETLTIG- 429
           L      S+ L  +  D         +NK  K+ N       +    L   + +TL    
Sbjct: 442 LVFKKKCSDLLRTVIYDNIVLNSTAFENKDYKDPNNYNSIDDSQPRRLIRRITQTLQKKK 501

Query: 430 -----NLCNNASFSQEHAIFLGNPTDVALLE-----------QLANFE-MPDIRNTVQK- 471
                NL  +A+  ++   ++G+ T+ ALL             L +F   P+   TV+  
Sbjct: 502 PDDEENLLAHAAEGRQEP-YIGSKTETALLSLARKSFGLKFGALQSFRGHPEKLPTVETI 560

Query: 472 VQELPFNSKRKLMA--TKILNPVDN---KCTVYVKGAFERILEYSTSYLKSKGKKTEKLT 526
           VQ +PF S RK  A   K+ +  +N   K  +YVKGA E I+  + +      +   ++ 
Sbjct: 561 VQIIPFESSRKWSAIVVKLNSNKENEGKKFRLYVKGAAE-IVAKACTLKNVCNEGISEID 619

Query: 527 EAQKATINECANSMASEGLRVFGFAKLTLSDSSTPLTE--------------------DL 566
           +  K  I E   S+A + LR    A +    +  P  E                      
Sbjct: 620 QKSKDDIEEQIFSLAKDALRAISLAHMDFDVNEWPPKELADPENSHEALAVKLIDPKKPH 679

Query: 567 IKDLTFTGLIGMNDPPRPNVKFAIEQLLQGGVHIIMITGDSENTAVNIAKQIGI---PVI 623
           ++ LT   ++G+ DP R NVK ++ Q  + GV + M+TGD+  TA  IA+  GI     +
Sbjct: 680 LEGLTLDAIVGIQDPLRENVKNSVAQCQKAGVTVRMVTGDNLLTAKAIARNCGILSSKSL 739

Query: 624 DPKLSVLSGDKLDEMSDDQLANVIDHVNIFARATPEHKLNIVRALRKRGDVVAMTGDGVN 683
           +     + G    ++SD +   ++  + + AR++PE K  +VRAL++ G+VVA+TGDG N
Sbjct: 740 NDSACAMEGPAFRKLSDSERKRILPKLRVLARSSPEDKKILVRALKEMGEVVAVTGDGTN 799

Query: 684 DAPALKLSDIGVSMGRIGTDVAKEASDMVLTDDDFSTILTAIEEGKGIFNNIQNFLTFQX 743
           DAPALKL+D+G SMG  GT+VA+EASD++L  DDFS I+ AI+ G+ +  +I+ F+ FQ 
Sbjct: 800 DAPALKLADVGFSMGITGTEVAREASDIILMTDDFSAIVNAIKWGRCVAASIKKFIQFQL 859

Query: 744 XXXXXXXXXXXXXXXFK--LPNPLNAMQILWINILMDGPPAQSLGVEPVDHEVMKKPPRK 801
                              + + L A+Q+LW+N++MD   A +L  +  D  +M + P+ 
Sbjct: 860 IVNVTAVLLTFVTSVISSDVKSVLTAVQLLWVNLIMDTLAALALATDKPDPNIMDRKPKG 919

Query: 802 RTDKILTHDVMKRLLTTAACIIV--------GTVYIFVKEMAED--GKVTARDTTMTFTC 851
           R+  ++T    K ++  A   +         G  Y F K   ED  G    +   M F  
Sbjct: 920 RSTPLITPSTWKMIIGQAILQLSVTFTLYSHGAQYFFGKP-KEDLPGHEHQQINAMIFNT 978

Query: 852 FVFFDMFNALACR 864
           FV+   F  L  R
Sbjct: 979 FVWLQWFTLLVSR 991

>AFL011W [3182] [Homologous to ScYGL006W (PMC1) - SH]
            complement(415265..418993) [3729 bp, 1242 aa]
          Length = 1242

 Score =  282 bits (721), Expect = 1e-79,   Method: Compositional matrix adjust.
 Identities = 274/990 (27%), Positives = 438/990 (44%), Gaps = 166/990 (16%)

Query: 29   LSKPSPSLEYCTL---SVDEALEKLDTDKNGGLRSSNE-----ANNRRSLYGPNEITVED 80
            L  P     YC L   S +   + L TDK  GL  ++E     A  RR  +G N +    
Sbjct: 34   LHNPKSLAAYCALFGHSENGLCDALKTDKKNGLALADEEVRETARCRR--FGANRVPERT 91

Query: 81   DESLFKKFLSNFIEDRMILLLIGSAVVSLFMG---------NIDD------------AVS 119
                 +     F +  MI+L++ +AV+S  +G          +DD             ++
Sbjct: 92   ARGFLRLMWEAFKDKTMIVLMV-AAVISFSLGLYEAIGQPPELDDDGTPMAQVDYVEGLA 150

Query: 120  ITLAIFIVVTVGFVQEYRSEKSLEALN-KLVPAECHLMRCGQESHVLASTLVPGDLVHFR 178
            I  A+ +VV V    +Y+ E+    LN K    E  ++R G +  +    L+ GDL+  +
Sbjct: 151  IMAAVAVVVLVTAANDYQKERQFARLNRKKEDTEVVVVRNGDKHVISVHDLLVGDLLSLQ 210

Query: 179  IGDRIPADIRIIEAIDLSIDESNLTGENEPVHKTSQTIEKSSF--------------NDQ 224
             GD +P D  ++E      DES +TGE++ + K S  +    +              +D 
Sbjct: 211  TGDVVPVDCILVEG-KCECDESGITGESDTIKKVSLAMSLQVYRTVAADNPSADIGSSDN 269

Query: 225  PNSIVPISERSCIAYMGTLVKEGHGKGIVVGTGTNTSFGAVFEMMNNIEKPKTPLQLTMD 284
             +S+VP      +   G+ +  G G  +V   G ++  G +   + + E   TPLQ  ++
Sbjct: 270  GHSLVP----DPMLISGSKLLSGIGHAVVTAVGPHSVHGKMMLALKS-EPETTPLQERLN 324

Query: 285  KLGKDLSLVS-------FIVIGMICLVGIIQGR------------SWLEMFQISVSLAVA 325
             L  D+S+         F+V+ +  L  + +GR             ++++F  +V++ V 
Sbjct: 325  TLADDISIYGSVAAFLLFVVLFLRFLSYLPKGRLYHDLPSARKGSRFMDIFITAVTVIVV 384

Query: 326  AIPEGLPIIVTVTLALGVLRMAKRKAIVRRLPSVETLGSVNVICSDKTGTLTSNHMTVSK 385
            A+PEGLP+ VT+ LA    RM K   +VR L + ET+GS   +CSDKTGTLT N M V K
Sbjct: 385  AVPEGLPLAVTLALAFATTRMTKDGNLVRVLRACETMGSATTVCSDKTGTLTQNKMVVVK 444

Query: 386  LW---------CLDSMSNKLNVLSLDKNKKTKN---SNGNLKNYLTED------------ 421
             +           DS   + + L  D ++ T N   +N  L +   E+            
Sbjct: 445  GFLGSSHFDDISEDSNCAQSDALRQDMSQHTLNDILANIALNSTAFENKQVADPVITENP 504

Query: 422  ---VRETLTIGNLCNNASFS-------QEHAIFLGNPTDVALL---------EQLANF-E 461
                R +L   +  N   +        Q    F+G+ T+ ALL         E L    +
Sbjct: 505  YHKPRRSLFPWSRNNKPKYPAPKDSSVQSAEFFIGSKTEAALLSLAKGSLGLESLQALRD 564

Query: 462  MPDIRNTVQKVQELPFNSKRKLMATKILNPVDNKCTVYVKGAFERILEYSTSYLKSKGKK 521
             P        VQ +PF S RK  A  ++  VD     ++KGA E I + S  Y++S    
Sbjct: 565  DPHHIGIASIVQMIPFESSRK-WAGLVVRLVDGNYRFFIKGASETIFK-SCHYMRSSNDD 622

Query: 522  TEKLTEAQKATINECANSMASEGLRVFGFAKLTLSD-SSTPLTE------------DLI- 567
              KL+  +   I    N++AS+ LR    A    +D SS P  E            DL+ 
Sbjct: 623  VIKLSPQKHGEIFGLINNLASDALRTISLAHKDFTDISSWPPAELRDASDPSTASPDLLL 682

Query: 568  -------------------KDLTFTGLIGMNDPPRPNVKFAIEQLLQGGVHIIMITGDSE 608
                                 L   G++G++DP RP VK +++   Q GV + MITGD+ 
Sbjct: 683  GDEYVPTATDRPSIITNNNSGLILDGVVGIHDPLRPGVKESVKNCQQSGVTVRMITGDNI 742

Query: 609  NTAVNIAKQIGI----PVIDPKLSVLSGDKLDEMSDDQLANVIDHVNIFARATPEHKLNI 664
             T   IA+  GI       D + + + G    ++S  Q+ +    + + AR++PE K   
Sbjct: 743  TTGRAIARACGILSESEYADHECA-MEGPVFRKLSRRQMMDAAPKLKVLARSSPEDKRIF 801

Query: 665  VRALRKRGDVVAMTGDGVNDAPALKLSDIGVSMGRIGTDVAKEASDMVLTDDDFSTILTA 724
            V  L+K  +VVA+TGDG NDAPAL L+D+G SMG  GT VA+EASD++L  DDF++I+ A
Sbjct: 802  VDILKKMNEVVAVTGDGTNDAPALTLADVGFSMGISGTGVAREASDIILMTDDFTSIVNA 861

Query: 725  IEEGKGIFNNIQNFLTFQXXXXXXXXXXXXXXXXFKL-PNP-LNAMQILWINILMDGPPA 782
            I+ G+ +  +I+ F+ FQ                     NP L A+Q+LW+N++MD   A
Sbjct: 862  IKWGRCVSLSIKKFIQFQLTVNITAVTLTCVTAVTSTEENPVLTAVQLLWVNLIMDTLAA 921

Query: 783  QSLGVEPVDHEVMKKPPRKRTDKILTHDVMKRLLTTAACIIV--------GTVYIFVKEM 834
             +L  +  D  ++++ P  R   ++     K +L  A   ++        G    +  ++
Sbjct: 922  LALATDKPDPHILERIPTGRDSPLIAVSTWKMILGQAVLQLIIAFVLHYGGRKLFYPHQV 981

Query: 835  AEDGKVTARDTTMTFTCFVFFDMFNALACR 864
               G+   R  T+TF  FV+   F  +  R
Sbjct: 982  PFTGRDQKRLDTLTFNTFVWLQFFKLIVTR 1011

>KLLA0A08910g complement(779526..783368) similar to sp|P38929
            Saccharomyces cerevisiae YGL006w PMC1 Ca2+-transporting
            P-type ATPase, start by similarity
          Length = 1280

 Score =  265 bits (678), Expect = 7e-74,   Method: Compositional matrix adjust.
 Identities = 272/995 (27%), Positives = 441/995 (44%), Gaps = 159/995 (15%)

Query: 50   LDTDKNGGLRSSNE---ANNRRSLYGPNEITVEDDESLFKKFLSNFIEDRMILLLIGSAV 106
            L TD+  GL   +E   +  R  +YG N I     +S  +     F +  MILL + +AV
Sbjct: 114  LQTDRTNGLTIQDEDIESLERTQVYGLNRIPERKGKSFLRLVWEAFNDKTMILLTV-AAV 172

Query: 107  VSLFMG---NIDDAVSITLAIFIVVTVGFVQ------------------EYRSEKSLEAL 145
            +S  +G    +            +V V +V+                  +Y+ E     L
Sbjct: 173  ISFALGLYETLGQPPEYDPEGNEIVKVEWVEGVAIMIAVVVVVLVGAINDYQKELQFAKL 232

Query: 146  NKLVP-AECHLMRCGQESHVLASTLVPGDLVHFRIGDRIPADIRIIEAIDLSIDESNLTG 204
            NK     +  ++R G E  +    L+ GD++  + GD +PAD  +I       DES LTG
Sbjct: 233  NKKKDDRDVVVIRNGDEHLISIHDLLVGDVISLQTGDVVPADAVLISG-SCECDESALTG 291

Query: 205  ENEPVHKTS---------QTIEKSSFNDQPNSIVPISERSCIAYMGTLVKEGHGKGIVVG 255
            E++ + K +         Q  EK    D  +  V       +   G+ +  G G  ++  
Sbjct: 292  ESDTIKKVALKPALEKYKQIFEKDPTIDIGSHGVGEKVPDPLLISGSKLLSGIGNAVITS 351

Query: 256  TGTNTSFGAVFEMMNNIEKPKTPLQLTMDKLGKDLS-------LVSFIVIGMICLVGIIQ 308
             G N+  G +  M    E   TPLQ  +  L  ++S       LV FI++ +  L  +  
Sbjct: 352  VGENSVNGRIM-MALKTESESTPLQERLSNLADNISIYGCMAALVLFIILFIRFLTYLPN 410

Query: 309  GRSW------------LEMFQISVSLAVAAIPEGLPIIVTVTLALGVLRMAKRKAIVRRL 356
            G+ +            + +F  +V++ V A+PEGLP+ VT+ LA    RM K   +VR L
Sbjct: 411  GKKYHDLPPAQKGSKFMNIFITAVTVIVVAVPEGLPLAVTLALAFATTRMTKDGNLVRVL 470

Query: 357  PSVETLGSVNVICSDKTGTLTSNHMTVSKLW--------------------------CLD 390
             + ET+GS   ICSDKTGTLT N MTV K +                          C  
Sbjct: 471  RACETMGSATAICSDKTGTLTENRMTVVKGFAGNLGFDDTTHAENKEIKSAVVLRSNCDA 530

Query: 391  SM-SNKLNVLSLD----KNKKTKNSNGNLKNYLTEDVRETLTIGNLCNNAS------FSQ 439
            S+ ++ L+ +SL+    +NK++++ + ++        R++L   +  N  S        +
Sbjct: 531  SLLTDILSNISLNSTAFENKESQHKDKDVDENPYHKSRKSLFPWSRNNRTSQLIADAMKE 590

Query: 440  EHAIFLGNPTDVALLE-QLANFEMPDIRNTVQK---------VQELPFNSKRKLMATKIL 489
                FLG+ T+ ALL     +  M D+     K         VQ +PF S RK  A  + 
Sbjct: 591  NDEQFLGSKTETALLAFAQKSLGMKDVHKLRTKPSDLGIDKVVQVIPFESSRKWGAIAV- 649

Query: 490  NPVDNK-CTVYVKGAFERILEYSTSYLKSKGKKTEKLTEAQKATINECANSMASEGLRVF 548
               DNK    Y KGA E +L+  ++   S         +    +  +  + MAS  LR  
Sbjct: 650  QLADNKGYRFYAKGAAEILLKVCSNQRNSDNSIVPMNQDLYDESFKKIQD-MASHALRTI 708

Query: 549  G--------FAKLTLSDSSTP--LTEDLI------------KDLTFTGLIGMNDPPRPNV 586
                     +     +DS+ P   + DL+            + +T   ++G+ DP R  V
Sbjct: 709  SLVHRDFKEWPPKEFADSTDPSIASPDLVMGHELDHKNLSSEGMTLDAMVGLQDPLREGV 768

Query: 587  KFAIEQLLQGGVHIIMITGDSENTAVNIAKQIGI----PVIDPKLSVLSGDKLDEMSDDQ 642
            K ++EQ  + GV + M+TGD+  TA  I++   I       DP+ + + G    ++   +
Sbjct: 769  KESVEQCQRAGVTVRMVTGDNILTARAISRNCNILSEEGYNDPECA-MEGPTFRKLPYKK 827

Query: 643  LANVIDHVNIFARATPEHKLNIVRALRKRGDVVAMTGDGVNDAPALKLSDIGVSMGRIGT 702
            +  VI  + + AR++PE K  +V  L+K G+VVA+TGDG NDAPALKL+D+G SMG  GT
Sbjct: 828  MLRVIPKLRVLARSSPEDKRILVETLKKMGEVVAVTGDGTNDAPALKLADVGFSMGISGT 887

Query: 703  DVAKEASDMVLTDDDFSTILTAIEEGKGIFNNIQNFLTFQXXXXXXXXXXX--XXXXXFK 760
            +VA+EASD++L  DDF+ I+ AI+ G+ +  +I+ F+ FQ                   +
Sbjct: 888  EVAREASDIILMTDDFTAIVNAIKWGRCVSVSIKKFIQFQLTVNITAVILTFVSAVASAE 947

Query: 761  LPNPLNAMQILWINILMDGPPAQSLGVEPVDHEVMKKPPRKRTDKILTHDVMKRLLTTAA 820
              + L A+Q+LW+N++MD   A +L  +  D  ++ + P+ R   ++     K +L  AA
Sbjct: 948  ETSVLTAVQLLWVNLIMDTLAALALATDKPDEFILDRKPKGRDAPLIAVSTWKMILGQAA 1007

Query: 821  CIIVGTVYIFV--KEMAEDGK--VTARD----TTMTFTCFVFFDMFNALACRHNTKSIFE 872
              +  T  +    KE+    K  +TA +      MTF  FV+   F  +  R        
Sbjct: 1008 LQLTVTFVLHFRGKEIFFPNKRTITAHEQEQLNAMTFNTFVWLQFFKLIVTRK------- 1060

Query: 873  IGFFTNKMFNYAVGLS-LLGQMCAIYIPFFQSIFK 906
                     + A G+S    ++ A  + FFQ +F+
Sbjct: 1061 --------LDEADGISKFKDRLTANNLNFFQHLFR 1087

>YGL008C (PMA1) [1965] chr7 complement(479913..482669)
           H+-transporting P-type ATPase of the plasma membrane
           required for nutrient uptake and pH homeostasis,
           activity is rate limiting for growth at low pH [2757 bp,
           918 aa]
          Length = 918

 Score =  222 bits (565), Expect = 3e-60,   Method: Compositional matrix adjust.
 Identities = 192/742 (25%), Positives = 347/742 (46%), Gaps = 105/742 (14%)

Query: 7   NASLLDEDSNREREILDATAEALSKPSPSLEYCTLSVDEALEKLDTDKNGGLRSSNEANN 66
           N  + DEDS+ +  +  A  EA  +P P             E L TD + GL +S+E   
Sbjct: 53  NHGVDDEDSDNDGPV--AAGEA--RPVPE------------EYLQTDPSYGL-TSDEVLK 95

Query: 67  RRSLYGPNEITVEDDESLFKKFLSNFIEDRMILLLIGSAVVSLFMGNIDDAVSITLAIFI 126
           RR  YG N++  ++ ESL  KF+  F+   +  ++  +A+++  + +  D   I   + +
Sbjct: 96  RRKKYGLNQMA-DEKESLVVKFVMFFV-GPIQFVMEAAAILAAGLSDWVDFGVICGLLML 153

Query: 127 VVTVGFVQEYRSEKSLEALNKLVPAECHLMRCGQESHVLASTLVPGDLVHFRIGDRIPAD 186
              VGFVQE+++   ++ L K +     ++R GQ   + A+ +VPGD++    G  IP D
Sbjct: 154 NAGVGFVQEFQAGSIVDELKKTLANTAVVIRDGQLVEIPANEVVPGDILQLEDGTVIPTD 213

Query: 187 IRII-EAIDLSIDESNLTGENEPVHKTSQTIEKSSFNDQPNSIVPISERSCIAYMGTLVK 245
            RI+ E   L ID+S +TGE+  V K         + DQ              +  + VK
Sbjct: 214 GRIVTEDCFLQIDQSAITGESLAVDK--------HYGDQ-------------TFSSSTVK 252

Query: 246 EGHGKGIVVGTGTNTSFGAVFEMMNNIEKPKTPLQLTMDKLGKDLSLVSFIVIGMICLVG 305
            G G  +V  TG NT  G    ++N     +      ++ +G  L ++    + ++    
Sbjct: 253 RGEGFMVVTATGDNTFVGRAAALVNKAAGGQGHFTEVLNGIGIILLVLVIATLLLVWTAC 312

Query: 306 IIQGRSWLEMFQISVSLAVAAIPEGLPIIVTVTLALGVLRMAKRKAIVRRLPSVETLGSV 365
             +    + + + ++ + +  +P GLP +VT T+A+G   +AK++AIV++L ++E+L  V
Sbjct: 313 FYRTNGIVRILRYTLGITIIGVPVGLPAVVTTTMAVGAAYLAKKQAIVQKLSAIESLAGV 372

Query: 366 NVICSDKTGTLTSNHMTVSKLWCLDSMSNKLNVLS--LDKNKKTKNSNGNLKNYLTEDVR 423
            ++CSDKTGTLT N +++ + + ++ +S    +L+  L  ++K K  +            
Sbjct: 373 EILCSDKTGTLTKNKLSLHEPYTVEGVSPDDLMLTACLAASRKKKGLDA----------- 421

Query: 424 ETLTIGNLCNNASFSQEHAIFLGNPTDVALLEQLANFEMPDIRNTVQKVQEL---PFNSK 480
                                     D A L+ L  +  P  ++ + K + L   PF+  
Sbjct: 422 -------------------------IDKAFLKSLKQY--PKAKDALTKYKVLEFHPFDPV 454

Query: 481 RKLMATKILNPVDNKCTVYVKGAFERILEYSTSYLKSKGKKTEKLTEAQKATINECANSM 540
            K +   + +P + +  V VKGA   +L+     ++      E + E  +  + E    +
Sbjct: 455 SKKVTAVVESP-EGERIVCVKGAPLFVLKT----VEEDHPIPEDVHENYENKVAE----L 505

Query: 541 ASEGLRVFGFAKLTLSDSSTPLTEDLIKDLTFTGLIGMNDPPRPNVKFAIEQLLQGGVHI 600
           AS G R  G A+         L           G++   DPPR +    + +    G+ +
Sbjct: 506 ASRGFRALGVARKRGEGHWEIL-----------GVMPCMDPPRDDTAQTVSEARHLGLRV 554

Query: 601 IMITGDSENTAVNIAKQIGIPVIDPKLSVLSGDKLDEMSDDQLANVIDHVNIFARATPEH 660
            M+TGD+   A    +Q+G+         L      +M   +LA+ +++ + FA   P+H
Sbjct: 555 KMLTGDAVGIAKETCRQLGLGTNIYNAERLGLGGGGDMPGSELADFVENADGFAEVFPQH 614

Query: 661 KLNIVRALRKRGDVVAMTGDGVNDAPALKLSDIGVSMGRIGTDVAKEASDMVLTDDDFST 720
           K  +V  L+ RG +VAMTGDGVNDAP+LK +D G+++    TD A+ A+D+V      S 
Sbjct: 615 KYRVVEILQNRGYLVAMTGDGVNDAPSLKKADTGIAV-EGATDAARSAADIVFLAPGLSA 673

Query: 721 ILTAIEEGKGIFNNIQNFLTFQ 742
           I+ A++  + IF+ + +++ ++
Sbjct: 674 IIDALKTSRQIFHRMYSYVVYR 695

>AGL085C [4226] [Homologous to ScYGL008C (PMA1) - SH; ScYPL036W
           (PMA2) - NSH] (546285..549014) [2730 bp, 909 aa]
          Length = 909

 Score =  221 bits (563), Expect = 5e-60,   Method: Compositional matrix adjust.
 Identities = 186/697 (26%), Positives = 327/697 (46%), Gaps = 81/697 (11%)

Query: 48  EKLDTDKNGGLRSSNEANNRRSLYGPNEITVEDDESLFKKFLSNFIEDRMILLLIGSAVV 107
           E L TD + GL +S+E + RR  YG N+++ E +ES+  KF+  F+   +  ++  +A++
Sbjct: 59  ELLQTDPSYGL-TSDEVSRRRKKYGLNQMS-EANESMILKFVMFFV-GPIQFVMEAAAIL 115

Query: 108 SLFMGNIDDAVSITLAIFIVVTVGFVQEYRSEKSLEALNKLVPAECHLMRCGQESHVLAS 167
           +  +    D   I   + +   VGF+QE+++   +E L K +     ++R G    + A+
Sbjct: 116 AAGLEEWIDFGIICALLLLNAAVGFIQEFQAGSIVEELKKTLANSAVVIRDGSLVEIPAN 175

Query: 168 TLVPGDLVHFRIGDRIPADIRII-EAIDLSIDESNLTGENEPVHKTSQTIEKSSFNDQPN 226
            +VPGD++    G  IPAD RI+ E   + ID+S +TGE+  V K         + D   
Sbjct: 176 EVVPGDILQLEDGVIIPADGRIVTEGCFVQIDQSAITGESLAVDK--------RYGDA-- 225

Query: 227 SIVPISERSCIAYMGTLVKEGHGKGIVVGTGTNTSFGAVFEMMNNIEKPKTPLQLTMDKL 286
                       +  + VK G G  IV  TG +T  G    ++N            ++ +
Sbjct: 226 -----------TFSSSTVKRGEGFMIVTATGDSTFVGRAAALVNKASAGSGHFTEVLNGI 274

Query: 287 GKDLSLVSFIVIGMICLVGIIQGRSWLEMFQISVSLAVAAIPEGLPIIVTVTLALGVLRM 346
           G  L ++  + + ++ +    +    + + + ++++ V  +P GLP +VT T+A+G   +
Sbjct: 275 GTILLILVILTLLVVYVACFYRSIDIVTILRYTLAITVVGVPVGLPAVVTTTMAVGAAYL 334

Query: 347 AKRKAIVRRLPSVETLGSVNVICSDKTGTLTSNHMTVSKLWCLDSMSNKLNVLSLDKNKK 406
           AK+KAIV++L ++E+L  V ++CSDKTGTLT N +++ +                     
Sbjct: 335 AKKKAIVQKLSAIESLAGVEILCSDKTGTLTKNKLSLHE--------------------- 373

Query: 407 TKNSNGNLKNYLTEDVRETLTIGNLCNNASFSQEHAIFLGNPTDVALLEQLANFEMPDIR 466
                     Y  E V     +   C  AS  ++      +  D A L+ L N+      
Sbjct: 374 ---------PYTVEGVEADDLMLTACLAASRKKKGL----DAIDKAFLKSLINYPRAKAA 420

Query: 467 NTVQKVQEL-PFNSKRKLMATKILNPVDNKCTVYVKGAFERILEYSTSYLKSKGKKTEKL 525
            T  KV E  PF+   K + T I+   + +  V VKGA   +L+          ++   +
Sbjct: 421 LTKYKVLEFHPFDPVSKKV-TAIVESPEGERIVCVKGAPLFVLKTV--------EENHLI 471

Query: 526 TEAQKATINECANSMASEGLRVFGFAKLTLSDSSTPLTEDLIKDLTFTGLIGMNDPPRPN 585
            E  K         +AS G R  G A+         L           G++   DPPR +
Sbjct: 472 PEDVKENYENKVAELASRGYRALGVARKRGEGHWEIL-----------GVMPCMDPPRDD 520

Query: 586 VKFAIEQLLQGGVHIIMITGDSENTAVNIAKQIGIPVIDPKLSVLSGDKLDEMSDDQLAN 645
               + +    G+ + M+TGD+   A    +Q+G+         L      +M   +LA+
Sbjct: 521 TAQTVNEARHLGLRVKMLTGDAVGIAKETCRQLGLGTNIYNAERLGLGGGGDMPGSELAD 580

Query: 646 VIDHVNIFARATPEHKLNIVRALRKRGDVVAMTGDGVNDAPALKLSDIGVSMGRIGTDVA 705
            +++ + FA   P+HK N+V  L++RG +VAMTGDGVNDAP+LK +D G+++    TD A
Sbjct: 581 FVENADGFAEVFPQHKYNVVEILQQRGYLVAMTGDGVNDAPSLKKADTGIAV-EGATDAA 639

Query: 706 KEASDMVLTDDDFSTILTAIEEGKGIFNNIQNFLTFQ 742
           + A+D+V      S I+ A++  + IF+ + +++ ++
Sbjct: 640 RSAADIVFLAPGLSAIIDALKTSRQIFHRMYSYVVYR 676

>Kwal_47.17522
          Length = 899

 Score =  218 bits (554), Expect = 7e-59,   Method: Compositional matrix adjust.
 Identities = 183/699 (26%), Positives = 324/699 (46%), Gaps = 85/699 (12%)

Query: 48  EKLDTDKNGGLRSSNEANNRRSLYGPNEITVEDDESLFKKFLSNFIEDRMILLLIGSAVV 107
           E L TD + GL +S+E   RR  YG N++  E+ ESL  KFL  FI     ++   + + 
Sbjct: 59  ELLQTDPSYGL-TSDEVTKRRKKYGLNQMA-EESESLVVKFLMFFIGPIQFVMEAAAILA 116

Query: 108 SLFMGNIDDAVSITLAIFIVVTVGFVQEYRSEKSLEALNKLVPAECHLMRCGQESHVLAS 167
           +     +D  V + L +F+   VGF+QEY++   ++ L K +     ++R G    + A+
Sbjct: 117 AGLEDWVDFGVILGL-LFLNAGVGFIQEYQAGSIVDELKKSLANSAVVVRDGNLVEIPAN 175

Query: 168 TLVPGDLVHFRIGDRIPADIRII-EAIDLSIDESNLTGENEPVHKTSQTIEKSSFNDQPN 226
            +VPGD++    G  I AD R++ E   L ID+S +TGE+  V K         + D   
Sbjct: 176 EVVPGDIMQLEDGVVICADGRLVTEECFLQIDQSAITGESLAVDK--------HYGDT-- 225

Query: 227 SIVPISERSCIAYMGTLVKEGHGKGIVVGTGTNTSFGAVFEMMNNIEKPKTPLQLTMDKL 286
                       +  + VK G G  IV  TG NT  G    ++N     +      ++ +
Sbjct: 226 -----------TFSSSTVKRGEGFMIVTATGDNTFVGRAAALVNQAAGDQGHFTEVLNGI 274

Query: 287 GKDLSLVSFIVIGMICLVGIIQGRSWLEMFQISVSLAVAAIPEGLPIIVTVTLALGVLRM 346
           G  L ++  + + ++      +    + + + ++ + +  +P GLP +VT T+A+G   +
Sbjct: 275 GTILLVLVIVTLLLVWTACFYRTDRIVRILRYTLGITIIGVPVGLPAVVTTTMAVGAAYL 334

Query: 347 AKRKAIVRRLPSVETLGSVNVICSDKTGTLTSNHMTVSKLWCLDSMSNKLNVLSLDKNKK 406
           AK++AIV++L ++E+L  V ++CSDKTGTLT N +++                       
Sbjct: 335 AKKQAIVQKLSAIESLAGVEILCSDKTGTLTKNKLSLH---------------------- 372

Query: 407 TKNSNGNLKNYLTEDVRETLTIGNLCNNASFSQEHAIFLGNPTDVALLEQLANFEMPDIR 466
                   + Y  E V     +   C  AS  ++      +  D A L+ L  +  P  +
Sbjct: 373 --------EPYTVEGVEPDDLMLTACLAASRKKKGL----DAIDKAFLKSLIQY--PRAK 418

Query: 467 NTVQKVQELPFNSKRKLMATKILNPVDNKCTVYVKGA-FERIL--EYSTSYLKSKGKKTE 523
           N + K + L F+           +PV  K T  V+    ERI+  + +  ++    ++  
Sbjct: 419 NALTKYKVLDFHP---------FDPVSKKVTAVVESPEGERIICVKGAPLFVLKTVEEDH 469

Query: 524 KLTEAQKATINECANSMASEGLRVFGFAKLTLSDSSTPLTEDLIKDLTFTGLIGMNDPPR 583
            + E            +AS G R  G A+         L           G++   DPPR
Sbjct: 470 PIPEDVHENYENKVAELASRGFRALGVARKRGEGHWEIL-----------GVMPCMDPPR 518

Query: 584 PNVKFAIEQLLQGGVHIIMITGDSENTAVNIAKQIGIPVIDPKLSVLSGDKLDEMSDDQL 643
            +    + +  + G+ + M+TGD+   A    +Q+G+         L      +M   +L
Sbjct: 519 DDTAQTVHEARRLGLRVKMLTGDAVGIAKETCRQLGLGTNIYNAERLGLGGGGDMPGSEL 578

Query: 644 ANVIDHVNIFARATPEHKLNIVRALRKRGDVVAMTGDGVNDAPALKLSDIGVSMGRIGTD 703
           A+ +++ + FA   P+HK ++V  L++RG +VAMTGDGVNDAP+LK +D G+++    TD
Sbjct: 579 ADFVENADGFAEVFPQHKYSVVEILQQRGYLVAMTGDGVNDAPSLKKADTGIAV-EGATD 637

Query: 704 VAKEASDMVLTDDDFSTILTAIEEGKGIFNNIQNFLTFQ 742
            A+ A+D+V      S I+ A++  + IF+ + +++ ++
Sbjct: 638 AARSAADIVFLAPGLSAIIDALKTSRQIFHRMYSYVVYR 676

>KLLA0A09031g 787768..790467 gi|1346734|sp|P49380|PMA1_KLULA
           Kluyveromyces lactis Plasma membrane ATPase (Proton
           pump), start by similarity
          Length = 899

 Score =  216 bits (549), Expect = 3e-58,   Method: Compositional matrix adjust.
 Identities = 191/734 (26%), Positives = 344/734 (46%), Gaps = 97/734 (13%)

Query: 11  LDEDSNREREILDATAEALSKPSPSLEYCTLSVDEALEKLDTDKNGGLRSSNEANNRRSL 70
           LD++S  +  +   +A    +P P             E L TD + GL +S+E   RR  
Sbjct: 38  LDDESEDDEHVAAGSA----RPVPE------------ELLQTDPSYGL-TSDEVTKRRKK 80

Query: 71  YGPNEITVEDDESLFKKFLSNFIEDRMILLLIGSAVVSLFMGNIDDAVSITLAIFIVVTV 130
           YG N+++ E+ E+LF KFL  FI   +  ++  +A+++  + +  D   I   +F+   V
Sbjct: 81  YGLNQMS-EETENLFVKFLMFFI-GPIQFVMEAAAILAAGLEDWVDFGVICGLLFLNAAV 138

Query: 131 GFVQEYRSEKSLEALNKLVPAECHLMRCGQESHVLASTLVPGDLVHFRIGDRIPADIRII 190
           GF+QEY++   ++ L K +     ++R G    V ++ +VPGD++    G  IPAD R++
Sbjct: 139 GFIQEYQAGSIVDELKKTLANSAVVIRDGNLVEVPSNEVVPGDILQLEDGVVIPADGRLV 198

Query: 191 -EAIDLSIDESNLTGENEPVHKTSQTIEKSSFNDQPNSIVPISERSCIAYMGTLVKEGHG 249
            E   + ID+S +TGE+  V K         F D               +  + VK G  
Sbjct: 199 TEDCFIQIDQSAITGESLAVDK--------RFGDS-------------TFSSSTVKRGEA 237

Query: 250 KGIVVGTGTNTSFGAVFEMMNNIEKPKTPLQLTMDKLGKDLSLVSFIVIGMICLVGIIQG 309
             IV  TG +T  G    ++N            ++ +G  L ++  + + ++ +    + 
Sbjct: 238 FMIVTATGDSTFVGRAAALVNKAAAGSGHFTEVLNGIGTILLILVIVTLLLVWVASFYRT 297

Query: 310 RSWLEMFQISVSLAVAAIPEGLPIIVTVTLALGVLRMAKRKAIVRRLPSVETLGSVNVIC 369
              + + + ++++ +  +P GLP +VT T+A+G   +AK++AIV++L ++E+L  V ++C
Sbjct: 298 NKIVRILRYTLAITIVGVPVGLPAVVTTTMAVGAAYLAKKQAIVQKLSAIESLAGVEILC 357

Query: 370 SDKTGTLTSNHMTVSKLWCLDSMSNKLNVLSLDKNKKTKNSNGNLKNYLTEDVRETLTIG 429
           SDKTGTLT N +++ +                               Y  E V     + 
Sbjct: 358 SDKTGTLTKNKLSLHE------------------------------PYTVEGVDPDDLML 387

Query: 430 NLCNNASFSQEHAIFLGNPTDVALLEQLANFEMPDIRNTVQKVQEL-PFNSKRKLMATKI 488
             C  AS  ++      +  D A L+ L ++       T  K+ E  PF+   K + T I
Sbjct: 388 TACLAASRKKKGL----DAIDKAFLKSLISYPRAKAALTKYKLLEFHPFDPVSKKV-TAI 442

Query: 489 LNPVDNKCTVYVKGAFERILEYSTSYLKSKGKKTEKLTEAQKATINECANSMASEGLRVF 548
           +   + +  + VKGA   +L+     ++ +    E + E  +  + E    +AS G R  
Sbjct: 443 VESPEGERIICVKGAPLFVLKT----VEEEHPIPEDVRENYENKVAE----LASRGFRAL 494

Query: 549 GFAKLTLSDSSTPLTEDLIKDLTFTGLIGMNDPPRPNVKFAIEQLLQGGVHIIMITGDSE 608
           G A+         L           G++   DPPR +    + +    G+ + M+TGD+ 
Sbjct: 495 GVARKRGEGHWEIL-----------GVMPCMDPPRDDTAQTVNEARHLGLRVKMLTGDAV 543

Query: 609 NTAVNIAKQIGIPVIDPKLSVLSGDKLDEMSDDQLANVIDHVNIFARATPEHKLNIVRAL 668
             A    +Q+G+         L      +M   +LA+ +++ + FA   P+HK N+V  L
Sbjct: 544 GIAKETCRQLGLGTNIYNAERLGLGGGGDMPGSELADFVENADGFAEVFPQHKYNVVEIL 603

Query: 669 RKRGDVVAMTGDGVNDAPALKLSDIGVSMGRIGTDVAKEASDMVLTDDDFSTILTAIEEG 728
           ++RG +VAMTGDGVNDAP+LK +D G+++    TD A+ A+D+V      S I+ A++  
Sbjct: 604 QQRGYLVAMTGDGVNDAPSLKKADTGIAV-EGATDAARSAADIVFLAPGLSAIIDALKTS 662

Query: 729 KGIFNNIQNFLTFQ 742
           + IF+ + +++ ++
Sbjct: 663 RQIFHRMYSYVVYR 676

>YPL036W (PMA2) [5403] chr16 (482839..485682) H[+]-transporting
           P-type ATPase of the plasma membrane, expression not
           detected under normal growth conditions [2844 bp, 947
           aa]
          Length = 947

 Score =  215 bits (548), Expect = 7e-58,   Method: Compositional matrix adjust.
 Identities = 184/705 (26%), Positives = 332/705 (47%), Gaps = 101/705 (14%)

Query: 50  LDTDKNGGLRSSNEANNRRSLYGPNEITVEDDESLFKKFLSNFIEDRMILLLIGSAVVSL 109
           L TD   GL +S+E   RR  YG N++  E++ESL  KFL  F+   +  ++  +A+++ 
Sbjct: 109 LSTDPAYGL-TSDEVARRRKKYGLNQMA-EENESLIVKFLMFFV-GPIQFVMEAAAILAA 165

Query: 110 FMGNIDDAVSITLAIFIVVTVGFVQEYRSEKSLEALNKLVPAECHLMRCGQESHVLASTL 169
            + +  D   I   + +  +VGF+QE+++   ++ L K +     ++R GQ   + A+ +
Sbjct: 166 GLSDWVDVGVICALLLLNASVGFIQEFQAGSIVDELKKTLANTATVIRDGQLIEIPANEV 225

Query: 170 VPGDLVHFRIGDRIPADIRII-EAIDLSIDESNLTGENEPVHKTSQTIEKSSFNDQPNSI 228
           VPG+++    G   PAD RI+ E   L ID+S +TGE+    K         + D+    
Sbjct: 226 VPGEILQLESGTIAPADGRIVTEDCFLQIDQSAITGESLAAEK--------HYGDE---- 273

Query: 229 VPISERSCIAYMGTLVKEGHGKGIVVGTGTNTSFGAVFEMMNNIEKPKTPLQLTMDKLG- 287
                     +  + VK G    +V  TG NT  G    ++      +      ++ +G 
Sbjct: 274 ---------VFSSSTVKTGEAFMVVTATGDNTFVGRAAALVGQASGVEGHFTEVLNGIGI 324

Query: 288 --KDLSLVSFIVIGMICL---VGIIQGRSWLEMFQISVSLAVAAIPEGLPIIVTVTLALG 342
               L + + +++   C    VGI+       + + ++ + +  +P GLP +VT T+A+G
Sbjct: 325 ILLVLVIATLLLVWTACFYRTVGIVS------ILRYTLGITIIGVPVGLPAVVTTTMAVG 378

Query: 343 VLRMAKRKAIVRRLPSVETLGSVNVICSDKTGTLTSNHMTVSKLWCLDSMSNKLNVLS-- 400
              +AK++AIV++L ++E+L  V ++CSDKTGTLT N +++ + + ++ +S    +L+  
Sbjct: 379 AAYLAKKQAIVQKLSAIESLAGVEILCSDKTGTLTKNKLSLHEPYTVEGVSPDDLMLTAC 438

Query: 401 LDKNKKTKNSNGNLKNYLTEDVRETLTIGNLCNNASFSQEHAIFLGNPTDVALLEQLANF 460
           L  ++K K  +                                      D A L+ L   
Sbjct: 439 LAASRKKKGLDA------------------------------------IDKAFLKSL--I 460

Query: 461 EMPDIRNTVQKVQEL---PFNSKRKLMATKILNPVDNKCTVYVKGAFERILEYSTSYLKS 517
           E P  ++ + K + L   PF+   K +   + +P + +  V VKGA   +L+     ++ 
Sbjct: 461 EYPKAKDALTKYKVLEFHPFDPVSKKVTAVVESP-EGERIVCVKGAPLFVLKT----VEE 515

Query: 518 KGKKTEKLTEAQKATINECANSMASEGLRVFGFAKLTLSDSSTPLTEDLIKDLTFTGLIG 577
                E + E  +  + E    +AS G R  G A+         L           G++ 
Sbjct: 516 DHPIPEDVHENYENKVAE----LASRGFRALGVARKRGEGHWEIL-----------GVMP 560

Query: 578 MNDPPRPNVKFAIEQLLQGGVHIIMITGDSENTAVNIAKQIGIPVIDPKLSVLSGDKLDE 637
             DPPR +    I +    G+ I M+TGD+   A    +Q+G+         L      +
Sbjct: 561 CMDPPRDDTAQTINEARNLGLRIKMLTGDAVGIAKETCRQLGLGTNIYNAERLGLGGGGD 620

Query: 638 MSDDQLANVIDHVNIFARATPEHKLNIVRALRKRGDVVAMTGDGVNDAPALKLSDIGVSM 697
           M   +LA+ +++ + FA   P+HK  +V  L+ RG +VAMTGDGVNDAP+LK +D G+++
Sbjct: 621 MPGSELADFVENADGFAEVFPQHKYRVVEILQNRGYLVAMTGDGVNDAPSLKKADTGIAV 680

Query: 698 GRIGTDVAKEASDMVLTDDDFSTILTAIEEGKGIFNNIQNFLTFQ 742
               TD A+ A+D+V      S I+ A++  + IF+ + +++ ++
Sbjct: 681 -EGATDAARSAADIVFLAPGLSAIIDALKTSRQIFHRMYSYVVYR 724

>Scas_688.1
          Length = 913

 Score =  214 bits (546), Expect = 9e-58,   Method: Compositional matrix adjust.
 Identities = 186/699 (26%), Positives = 339/699 (48%), Gaps = 89/699 (12%)

Query: 50  LDTDKNGGLRSSNEANNRRSLYGPNEITVEDDESLFKKFLSNFIEDRMILLLIGSAVVSL 109
           L TD   GL SS+E   RR  YG N+++ E++ESL  KF+  F+   +  ++  +A+++ 
Sbjct: 75  LQTDPAYGL-SSDEVARRRKKYGLNQMS-EENESLVVKFIMFFV-GPIQFVMEAAAILAA 131

Query: 110 FMGNIDDAVSITLAIFIVVTVGFVQEYRSEKSLEALNKLVPAECHLMRCGQESHVLASTL 169
            + +  D   I   + +   VGFVQE+++   +E L K +     ++R GQ   V A+ +
Sbjct: 132 GLSDWVDFGVICGLLLLNAGVGFVQEFQAGSIVEELKKTLANSAIVIRDGQLVEVPANEV 191

Query: 170 VPGDLVHFRIGDRIPADIRII-EAIDLSIDESNLTGENEPVHKTSQTIEKSSFNDQPNSI 228
           VPGD++    G  IPAD RI+ E   + ID+S +TGE+    K         + DQ    
Sbjct: 192 VPGDILQLEDGVIIPADGRIVTEDCFVQIDQSAITGESLAADK--------HYGDQ---- 239

Query: 229 VPISERSCIAYMGTLVKEGHGKGIVVGTGTNTSFGAVFEMMNNIEKPKTPLQLTMDKLGK 288
                     +  + VK G    ++  TG NT  G    ++N     +      ++ +G 
Sbjct: 240 ---------TFSSSTVKRGEAFMVITATGDNTFVGRAAALVNKASGGQGHFTEVLNGIGI 290

Query: 289 DLSLVSFIVIGMICLVGIIQGRSWLEMFQISVSLAVAAIPEGLPIIVTVTLALGVLRMAK 348
            L ++  + + ++      +    + + + ++ + +  +P GLP +VT T+A+G   +AK
Sbjct: 291 ILLVLVIVTLLLVWTASFYRTDGIVRILRYTLGITIVGVPVGLPAVVTTTMAVGAAYLAK 350

Query: 349 RKAIVRRLPSVETLGSVNVICSDKTGTLTSNHMTVSKLWCLDSMSNKLNVLSLDKNKKTK 408
           ++AIV++L ++E+L  V ++CSDKTGTLT N +++ + + ++ +S               
Sbjct: 351 KQAIVQKLSAIESLAGVEILCSDKTGTLTKNKLSLHEPYTVEGVS--------------- 395

Query: 409 NSNGNLKNYLTEDVRETLTIGNLCNNASFSQEHAIFLGNPTDVALLEQLANFEMPDIRNT 468
                      +D+  T      C  AS  ++      +  D A L+ LA +  P  +N 
Sbjct: 396 ----------ADDLMLTA-----CLAASRKKKGL----DAIDKAFLKSLAQY--PAAKNA 434

Query: 469 VQKVQEL---PFNSKRKLMATKILNPVDNKCTVYVKGAFERILEYSTSYLKSKGKKTEKL 525
           + K + L   PF+   K +   + +P + +  + VKGA   +L+     ++      E +
Sbjct: 435 LTKYKVLEFHPFDPVSKKVTAVVESP-EGERIICVKGAPLFVLKT----VEEDHPIPEDI 489

Query: 526 TEAQKATINECANSMASEGLRVFGFAKLTLSDSSTPLTEDLIKDLTFTGLIGMNDPPRPN 585
            E  +  + E    +AS G R  G A+         L           G++   DPPR +
Sbjct: 490 HENYENKVAE----LASRGFRALGVARKRGEGHWEIL-----------GVMPCMDPPRDD 534

Query: 586 VKFAIEQLLQGGVHIIMITGDSENTAVNIAKQIGIP--VIDPKLSVLSGDKLDEMSDDQL 643
               + +  + G+ + M+TGD+   A    +Q+G+   V + +   LSG    +M   +L
Sbjct: 535 TGETVAEARRLGLRVKMLTGDAVGIAKETCRQLGLGTNVYNAERLGLSGG--GDMPGSEL 592

Query: 644 ANVIDHVNIFARATPEHKLNIVRALRKRGDVVAMTGDGVNDAPALKLSDIGVSMGRIGTD 703
           A+ +++ + FA   P+ K  +V  L+ RG +VAMTGDGVNDAP+LK +D G+++    TD
Sbjct: 593 ADFVENADGFAEVFPQDKYRVVEILQTRGYLVAMTGDGVNDAPSLKKADTGIAV-EGATD 651

Query: 704 VAKEASDMVLTDDDFSTILTAIEEGKGIFNNIQNFLTFQ 742
            A+ A+D+V      S I+ A++  + IF+ + +++ ++
Sbjct: 652 AARSAADIVFLAPGLSAIIDALKTSRQIFHRMYSYVVYR 690

>Scas_710.41
          Length = 904

 Score =  204 bits (520), Expect = 2e-54,   Method: Compositional matrix adjust.
 Identities = 175/700 (25%), Positives = 325/700 (46%), Gaps = 89/700 (12%)

Query: 49  KLDTDKNGGLRSSNEANNRRSLYGPNEITVEDDESLFKKFLSNFIEDRMILLLIGSAVVS 108
           +L TD   GL +++E   RR  YG N++  E++E+   KFL  F+   +  ++  +A+++
Sbjct: 66  QLKTDPGIGL-TTDEVVRRRKKYGLNQMK-EENENFIVKFLMYFV-GPIQFVMEAAAILA 122

Query: 109 LFMGNIDDAVSITLAIFIVVTVGFVQEYRSEKSLEALNKLVPAECHLMRCGQESHVLAST 168
             + +  D   I   + +  +VGF+QE+++   +E L K +     ++R G    + A+ 
Sbjct: 123 AGLSDWVDFGVICGLLMLNASVGFIQEFQAGSIVEELKKTLANTARVIRDGTLQEIPANE 182

Query: 169 LVPGDLVHFRIGDRIPADIRII-EAIDLSIDESNLTGENEPVHKTSQTIEKSSFNDQPNS 227
           +VPGD++    G  IPAD R++ E   L +D+S +TGE+  V K        ++ D    
Sbjct: 183 IVPGDILELDEGTIIPADGRLVTENRFLQVDQSAITGESLAVDK--------NYGD---- 230

Query: 228 IVPISERSCIAYMGTLVKEGHGKGIVVGTGTNTSFGAVFEMMNNIEKPKTPLQLTMDKLG 287
                    + +  + VK G    +V  TG NT  G    ++      +      ++ +G
Sbjct: 231 ---------VTFSSSTVKTGTSVMVVTATGDNTFVGRAAALVGEASGGQGHFTDILNDIG 281

Query: 288 KDLSLVSFIVIGMICLVGIIQGRSWLEMFQISVSLAVAAIPEGLPIIVTVTLALGVLRMA 347
             L ++  I + ++      +    + + + ++ + +  +P GLP +VT T+A+G   +A
Sbjct: 282 TILLVLVIITLLLVWTACFYRTDGIVMILRFTLGITIIGVPVGLPAVVTTTMAVGAAYLA 341

Query: 348 KRKAIVRRLPSVETLGSVNVICSDKTGTLTSNHMTVSKLWCLDSMSNKLNVLS--LDKNK 405
           K++AIV++L ++E+L  V ++CSDKTGTLT N +++ + + ++ +S    +L+  L   +
Sbjct: 342 KKQAIVQKLSAIESLAGVEILCSDKTGTLTKNKLSLHEPYTVEGVSADDLMLTACLAATR 401

Query: 406 KTKNSNGNLKNYLTEDVRETLTIGNLCNNASFSQEHAIFLGNPTDVALLEQLANFEMPDI 465
           K K  +                                      D A L+ L  +  P  
Sbjct: 402 KKKGLDA------------------------------------IDRAFLKSLNQY--PKA 423

Query: 466 RNTVQKVQELPFNSKRKLMATKILNPVDNKCTVYVK---GAFERILEYSTSYLKSKGKKT 522
            N + K + L F+           +PV  K T  VK   G     ++ +  ++    ++ 
Sbjct: 424 MNALPKYKILEFHP---------FDPVSKKVTAVVKSPEGETITCVKGAPLFVLKTVEED 474

Query: 523 EKLTEAQKATINECANSMASEGLRVFGFAKLTLSDSSTPLTEDLIKDLTFTGLIGMNDPP 582
             + E            +AS G R  G A+           E L       G++   DPP
Sbjct: 475 HPVPEDVHENYENKVAELASRGFRSLGVAR----KRGEGYWEIL-------GVMPCMDPP 523

Query: 583 RPNVKFAIEQLLQGGVHIIMITGDSENTAVNIAKQIGIPVIDPKLSVLSGDKLDEMSDDQ 642
           R +    I +    G+ + M+TGD+   A   ++Q+G+ V       L      +M   +
Sbjct: 524 RDDTARTIAEARTLGLRVKMLTGDAVGIAKETSRQLGLGVNIYNAEKLGLGGGGDMPGSE 583

Query: 643 LANVIDHVNIFARATPEHKLNIVRALRKRGDVVAMTGDGVNDAPALKLSDIGVSMGRIGT 702
           LA+ +++ + FA   P+HK  +V  L+ RG +VAMTGDGVNDAP+LK +D G+++    T
Sbjct: 584 LADFVENADGFAEVFPQHKYKVVEILQNRGYLVAMTGDGVNDAPSLKKADTGIAV-EGAT 642

Query: 703 DVAKEASDMVLTDDDFSTILTAIEEGKGIFNNIQNFLTFQ 742
           D A+ A+D+V      S I+  ++  + IF+ + +++ ++
Sbjct: 643 DAARSAADIVFLAPGLSAIIDGLKTSRQIFHRMYSYVVYR 682

>CAGL0A00495g complement(55014..57722) highly similar to sp|P05030
           Saccharomyces cerevisiae YGL008c PMA1 or sp|P19657
           Saccharomyces cerevisiae YPL036w PMA2, hypothetical
           start
          Length = 902

 Score =  197 bits (502), Expect = 3e-52,   Method: Compositional matrix adjust.
 Identities = 181/697 (25%), Positives = 335/697 (48%), Gaps = 81/697 (11%)

Query: 48  EKLDTDKNGGLRSSNEANNRRSLYGPNEITVEDDESLFKKFLSNFIEDRMILLLIGSAVV 107
           E L TD + GL +S+E  +RR  YG N++  ++ ES+  KF+  F+   +  ++  +A++
Sbjct: 62  EYLQTDPSYGL-TSDEVAHRRKKYGLNQMA-DERESMIVKFVMFFV-GPIQFVMEAAAIL 118

Query: 108 SLFMGNIDDAVSITLAIFIVVTVGFVQEYRSEKSLEALNKLVPAECHLMRCGQESHVLAS 167
           +  + +  D   I   + +   VGF+QE+++   ++ L K +     ++R GQ   V A+
Sbjct: 119 AAGLSDWVDFGVICGLLMLNACVGFIQEFQAGSIVDELKKTLANVAVVIRDGQLVEVPAN 178

Query: 168 TLVPGDLVHFRIGDRIPADIRII-EAIDLSIDESNLTGENEPVHKTSQTIEKSSFNDQPN 226
            +VPGD++    G  IPAD R++ E   L +D+S +TGE+  V K         + DQ  
Sbjct: 179 EVVPGDILQLEDGTIIPADGRLVTENCFLQVDQSAITGESLAVDK--------GYGDQ-- 228

Query: 227 SIVPISERSCIAYMGTLVKEGHGKGIVVGTGTNTSFGAVFEMMNNIEKPKTPLQLTMDKL 286
                       +  + VK G    +V  TG NT  G    ++N     +      ++ +
Sbjct: 229 -----------TFSSSTVKRGEAFMVVTATGDNTFVGRAAALVNKASGGQGHFTEVLNGI 277

Query: 287 GKDLSLVSFIVIGMICLVGIIQGRSWLEMFQISVSLAVAAIPEGLPIIVTVTLALGVLRM 346
           G  L ++  + +  +      +  + +++ + ++ + +  +P GLP +VT T+A+G   +
Sbjct: 278 GILLLVLVIVTLLGVWAACFYRTDNIVKILRFTLGITIIGVPVGLPAVVTTTMAVGAAYL 337

Query: 347 AKRKAIVRRLPSVETLGSVNVICSDKTGTLTSNHMTVSKLWCLDSMSNKLNVLSLDKNKK 406
           AK++AIV++L ++E+L  V ++CSDKTGTLT N +++ + + ++ +S             
Sbjct: 338 AKKQAIVQKLSAIESLAGVEILCSDKTGTLTKNKLSLHEPYTVEGVS------------- 384

Query: 407 TKNSNGNLKNYLTEDVRETLTIGNLCNNASFSQEHAIFLGNPTDVALLEQLANFEMPDIR 466
                        +D+  T      C  AS  ++      +  D A L+ L N+      
Sbjct: 385 ------------ADDLMLTA-----CLAASRKKKGL----DAIDKAFLKSLINYPKAKDA 423

Query: 467 NTVQKVQEL-PFNSKRKLMATKILNPVDNKCTVYVKGAFERILEYSTSYLKSKGKKTEKL 525
            T  KV E  PF+   K +   + +P + +  V VKGA   +L+     ++      E +
Sbjct: 424 LTKYKVIEFHPFDPVSKKVTAVVESP-EGERIVCVKGAPLFVLKT----VEEDHPIPEDV 478

Query: 526 TEAQKATINECANSMASEGLRVFGFAKLTLSDSSTPLTEDLIKDLTFTGLIGMNDPPRPN 585
            E  +  + E    +AS G R  G A+         L           G++   DPPR +
Sbjct: 479 HENYENKVAE----LASRGFRALGVARKRGEGHWEIL-----------GVMPCMDPPRDD 523

Query: 586 VKFAIEQLLQGGVHIIMITGDSENTAVNIAKQIGIPVIDPKLSVLSGDKLDEMSDDQLAN 645
               + +  + G+ + M+TGD+   A    +Q+G+         L      +M   +LA+
Sbjct: 524 TAETVNEARRLGLRVKMLTGDAVGIAKETCRQLGLGTNIYNAERLGLGGGGDMPGSELAD 583

Query: 646 VIDHVNIFARATPEHKLNIVRALRKRGDVVAMTGDGVNDAPALKLSDIGVSMGRIGTDVA 705
            +++ + FA   P+HK  +V  L+ RG +VAMTGDGVNDAP+LK +D G+++    +D A
Sbjct: 584 FVENADGFAEVFPQHKYKVVEILQNRGYLVAMTGDGVNDAPSLKKADTGIAV-EGASDAA 642

Query: 706 KEASDMVLTDDDFSTILTAIEEGKGIFNNIQNFLTFQ 742
           + A+D+V      S I+ A++  + IF+ + +++ ++
Sbjct: 643 RSAADIVFLAPGLSAIIDALKTSRQIFHRMYSYVVYR 679

>Scas_569.0d
          Length = 468

 Score =  135 bits (340), Expect = 2e-33,   Method: Compositional matrix adjust.
 Identities = 69/189 (36%), Positives = 115/189 (60%), Gaps = 5/189 (2%)

Query: 629 VLSGDKLDEMSDDQLANVIDHVNIFARATPEHKLNIVRALRKRGDVVAMTGDGVNDAPAL 688
           V++G + DE++ +Q+ N+     + AR +P+ K+ ++ AL +R    AMTGDGVND+P+L
Sbjct: 81  VMTGSQFDELTPEQIDNLPVLPLVIARCSPQTKVRMIEALHRRDKFCAMTGDGVNDSPSL 140

Query: 689 KLSDIGVSMGRIGTDVAKEASDMVLTDDDFSTILTAIEEGKGIFNNIQNFLTFQXXXXXX 748
           K++++G++MG  G+DVAK+ASD+VL+DD+F++IL AIEEG+ + +NIQ F+         
Sbjct: 141 KMANVGIAMGINGSDVAKDASDIVLSDDNFASILNAIEEGRRMSDNIQKFVLQLLAENVA 200

Query: 749 XXXXXXXXXXF-----KLPNPLNAMQILWINILMDGPPAQSLGVEPVDHEVMKKPPRKRT 803
                     F     K   PL  +++LWI ++    PA  LG+E    ++M +PP    
Sbjct: 201 QALYLICGLAFQDKEGKSVFPLAPVEVLWIIVVTSCFPAMGLGLEKAAPDLMDRPPNDSK 260

Query: 804 DKILTHDVM 812
             I T +++
Sbjct: 261 SGIFTWEII 269

>Scas_297.1
          Length = 800

 Score =  138 bits (348), Expect = 2e-33,   Method: Compositional matrix adjust.
 Identities = 90/273 (32%), Positives = 143/273 (52%), Gaps = 13/273 (4%)

Query: 605 GDSENTAVNIAKQIGIPVIDPKL---SVLSGDKLDEMSDDQLANVIDHVNIFARATPEHK 661
           GD+  TA  IA+   I   +  L     + G K   ++  +   ++ ++ + AR++PE K
Sbjct: 1   GDNILTARAIARNCNILSEETYLIPECAIEGPKFRTLTKQERIKMLPNLRVMARSSPEDK 60

Query: 662 LNIVRALRKRGDVVAMTGDGVNDAPALKLSDIGVSMGRIGTDVAKEASDMVLTDDDFSTI 721
             +V  L+  GDVVA+TGDG NDAPALKL+D+G SMG  GT+VA+EASD++L  DDF+ I
Sbjct: 61  RLLVETLKGMGDVVAVTGDGTNDAPALKLADVGFSMGISGTEVAREASDIILMTDDFAAI 120

Query: 722 LTAIEEGKGIFNNIQNFLTFQXXXXXXXXXXXXXXXXFKLPNP--LNAMQILWINILMDG 779
           + AI+ G+ +  +I+ F+ FQ                        L A+Q+LWIN++MD 
Sbjct: 121 VDAIKWGRCVSISIKKFIQFQLIVNITAVILAFVSSIASEDETSVLTAVQLLWINLIMDT 180

Query: 780 PPAQSLGVEPVDHEVMKKPPRKRTDKILTHDVMKRLLTTAACIIVGTVYIFV--KEMAED 837
             A +L  +  D  +M + PR R+  ++     K +L+ +   ++ T  +    KE+   
Sbjct: 181 LAALALATDKPDPNIMDRKPRGRSTPLIFPSTWKMILSQSCLQLIVTFILHFNGKEIFFR 240

Query: 838 GK--VTARD----TTMTFTCFVFFDMFNALACR 864
           G+  +T  +      MTF  FV+   F  L  R
Sbjct: 241 GRDEITGHEQQQLNAMTFNTFVWLQFFTLLVSR 273

 Score = 63.2 bits (152), Expect = 7e-10,   Method: Compositional matrix adjust.
 Identities = 77/278 (27%), Positives = 124/278 (44%), Gaps = 38/278 (13%)

Query: 66  NRRSLYGPNEITVEDDESLFKKFLSNFIEDRMILLLIGSAVVSLFMG------------- 112
            R  LY  N I  E     F + +     D+ +LLL  +AVVS  +G             
Sbjct: 492 QRXKLYSDNRIP-ERVPKTFLQLIWEAFNDKTMLLLTAAAVVSFVLGLYEALYTPPEYDP 550

Query: 113 ------NID--DAVSITLAIFIVVTVGFVQEYRSEKSLEALNKLVP-AECHLMRCGQESH 163
                  +D  + ++I +A+ +VV VG V +Y+ E     LNK     +  ++R  QE  
Sbjct: 551 EGNPIKKVDWIEGIAIMIAVIVVVFVGAVNDYQKELQFARLNKKKENRKIIVIRNSQELL 610

Query: 164 VLASTLVPGDLVHFRIGDRIPADIRIIEAIDLSIDESNLTGENEPVH--------KTSQT 215
                L+ GD++  + GD IPAD  ++E     +DES++TGE++ +         KT   
Sbjct: 611 TSIHNLLVGDIITLQTGDVIPADGVLVEG-QCEVDESSITGESDTIKKVKVFNALKTFDV 669

Query: 216 IEKSSFNDQPNSI---VPISER--SCIAYMGTLVKEGHGKGIVVGTGTNTSFGAVFEMMN 270
           I +   NDQ   I    P  ++   C+   G+ +  G GK I+   GTN+  G    M  
Sbjct: 670 INEGKSNDQILDIGFKTPNGDKIPDCMLISGSKLLSGLGKAIITSVGTNSIHGRTM-MAL 728

Query: 271 NIEKPKTPLQLTMDKLGKDLSLVSFIVIGMICLVGIIQ 308
            +E   TPLQ  + +L   +S+   +   ++ LV  I+
Sbjct: 729 KVEPESTPLQQRLSQLADSISVYGCVAAILLFLVLFIR 766

>KLLA0B08217g complement(724364..728683) similar to sp|Q12697
            Saccharomyces cerevisiae YOR291w, start by similarity
          Length = 1439

 Score =  121 bits (304), Expect = 1e-27,   Method: Compositional matrix adjust.
 Identities = 201/859 (23%), Positives = 338/859 (39%), Gaps = 154/859 (17%)

Query: 57   GLRSSNEANNRRSLYGPNEITVEDDESLFKKFLSNFIEDRMILLLIGSAVVSLFMGNIDD 116
            GL SS +  +R   +G N + ++      +K ++  + D  +       + S+ +   DD
Sbjct: 448  GLTSSIQ-EDRTLAFGKNSVNLK------QKTVTEILFDEALHPFYVFQIFSIILWLADD 500

Query: 117  AVSITLAIFIVVTVGFVQEY-RSEKSLEALNKLVPAECHLMRCGQE---SHVLASTLVPG 172
                   IF++  +  +     ++K+ E L  +    C + R  ++   + V +S LVPG
Sbjct: 501  YYYYAGCIFLISVLSIIDTVIETKKNSEKLADISHFNCEV-RVYKDRFWTQVNSSDLVPG 559

Query: 173  DLVHFRIGDR----IPADIRIIEAIDLSIDESNLTGENEPVHKTSQTIEKSS--FNDQPN 226
            DL  F I D     +P D  +I   D  ++ES LTGE+ PV K + T    +    D  +
Sbjct: 560  DL--FEISDPSLVVLPCDAVLISG-DCIVNESMLTGESVPVSKYAATEATMAQLLQDFKS 616

Query: 227  SIVPISERSCIAYMGT---LVKEGHGKG----IVVGTGTNTSFGAVFEMMNNIEKPKTPL 279
            S V         + GT    V+   G+G    +V+ TG +T+ G++   M    KP    
Sbjct: 617  SQVSSFVSKSFLFNGTKIIRVRNQPGQGMALALVIRTGFSTTKGSLVRSMV-FPKP-VGF 674

Query: 280  QLTMD--KLGKDLSLVSFIVIGMICLVGIIQGRSWLEMFQISVSLAVAAIPEGLPIIVTV 337
            +   D  K    ++L++     + C+  I  G  +  M   ++ +    +P  LP  +T+
Sbjct: 675  KFYEDSFKYIGFMTLIAMFGFSISCIQFIRLGLEYKVMILRALDIITIVVPPALPATLTI 734

Query: 338  TLALGVLRMAKRKAIVRRLPSVETLGSVNVICSDKTGTLTSNHMTVSKLWCLDSMSNKLN 397
              +  + R+ K+         V   G V+++C DKTGTLT                  L+
Sbjct: 735  GTSFALGRLKKKGIFCISPTRVNVGGKVDMMCFDKTGTLT---------------EEGLD 779

Query: 398  VLSLDKNKKTKNSNGNLKNYLTEDVRETLTIGNL--CNNA----------SFSQEHAI-- 443
            VL +   K   +S     + L  D  E L    L  CN+A          S    H++  
Sbjct: 780  VLGIHFAKPEGSSTILQLSDLITDCDEVLQKHTLSDCNSAEEFKAKNFLVSLLTCHSLKH 839

Query: 444  ----FLGNPTDVALLE-----QLANFEMPDIRNTVQKVQELPFNSKRKLMATKILNPVDN 494
                 LG+P D+ + E         +E    +N   K    P           I N  DN
Sbjct: 840  IDGELLGDPLDLKMFEFTKWAYEEGYESWKFKNAEDKTGISPAVVHPTSNCNFIENDPDN 899

Query: 495  ---------------KCTVYVKGAFERILEYSTSYLKSKGKKTEKLTEAQKATI----NE 535
                           + +V VKG  E     +T +  +KG           ATI    +E
Sbjct: 900  LIGVIRSFEFLSELRRMSVIVKGFKE-----NTYWSFTKGAPEVIADICNPATIPKDFHE 954

Query: 536  CANSMASEGLRVFGFAKLTLSDSSTPLT-----EDLIKDLTFTGLIGMNDPPRPNVKFAI 590
              +     G R+   A  TL  SS   +     E++  +L F G I   +  +   K A+
Sbjct: 955  LLHHYTHNGFRIIACAGKTLPKSSWLYSQKVSREEVEDNLEFLGFIVFENKLKSRTKAAL 1014

Query: 591  EQLLQGGVHIIMITGDSENTAVNIAKQIGI------------------------------ 620
            ++L    +  +M TGD+  TAV++ +  G+                              
Sbjct: 1015 KELQNANIRTVMCTGDNVLTAVSVGRDSGLISSERVFIPFLNDNLEESRHLLSWRDVDEE 1074

Query: 621  ----------PVIDPKLS---VLSGD------KLDE-MSDDQLANVIDHVNIFARATPEH 660
                      P+ DP+ S    ++GD      + DE + DD ++ V+   +I+AR +P+ 
Sbjct: 1075 GSVLDAVTLKPLNDPEKSYTLAITGDIFRILFRNDEILPDDYISTVLMKGSIYARMSPDE 1134

Query: 661  KLNIVRALRKRGDVVAMTGDGVNDAPALKLSDIGVSMGRIGTDVAKEASDMVLTDDDFST 720
            K  +V  L+K    V   GDG ND  ALK ++IG+S+      VA   +  V    D S 
Sbjct: 1135 KHELVEQLQKLDYNVGFCGDGANDCGALKAANIGISLSEAEASVAAPFTSAVF---DISC 1191

Query: 721  ILTAIEEGKGIFNNIQNFLTFQXXXXXXXXXXXXXXXXFKLPNPLNAMQILWINILMDGP 780
            +L  I+EG+     + +F  FQ                +   + L   Q L+I++L+  P
Sbjct: 1192 VLDVIKEGRASL--VTSFSCFQYMSLYSAIQFITITILYSRGSNLGDFQFLYIDLLLIVP 1249

Query: 781  PAQSLGVEPVDHEVMKKPP 799
             A S+     + +++KK P
Sbjct: 1250 IAISMSWSKPNSKLVKKRP 1268

>AFR567W [3759] [Homologous to ScYOR291W - SH]
            complement(1455295..1459644) [4350 bp, 1449 aa]
          Length = 1449

 Score =  112 bits (280), Expect = 7e-25,   Method: Compositional matrix adjust.
 Identities = 201/922 (21%), Positives = 363/922 (39%), Gaps = 173/922 (18%)

Query: 62   NEANNRRSLYGPNEITVEDDESLFKKFLSNFIEDRMILLLIGSAVVSLFMGNIDDAVSIT 121
            N   +R   +G N I      +L +K  S  + D  +       + S+ +   D      
Sbjct: 453  NIHEDRMIAFGKNSI------NLRQKTTSQILFDEALHPFYIFQIFSIILWMFDAYYYYA 506

Query: 122  LAIFIVVTVGFVQEY-RSEKSLEALNKLVPAEC--HLMRCGQESHVLASTLVPGDLVHFR 178
              IFI+  +  +     +++S E L++L    C   + R G  S V +S LVPGD+  + 
Sbjct: 507  TCIFIISVLSVIDTLVETKQSSERLSELSQFYCDVRVYRDGFWSQVPSSDLVPGDI--YE 564

Query: 179  IGDR----IPADIRIIEAIDLSIDESNLTGENEPVHKTSQTIEK-----SSFND-QPNSI 228
            + D     +P D  +I   D  ++ES LTGE+ PV K + T E        F D Q +S 
Sbjct: 565  LTDPSLSLLPCDSILISG-DCLVNESMLTGESVPVSKVAATRETMLQLLDDFMDTQLSSF 623

Query: 229  VPISERSCIAYMGT---LVKEGHGKGIVVG----TGTNTSFGAVFEMMNNIEKPKTPLQL 281
            V  S      + GT    V+   G+ I +G    TG +T+ G++   M    KP      
Sbjct: 624  VSKS----FLFNGTKLIRVRATAGQSIALGMVARTGFSTTKGSLVRSMV-FPKP------ 672

Query: 282  TMDKLGKDLSLVSFIVIGMICLVGIIQ-GRSWLEMFQI----------SVSLAVAAIPEG 330
            T  K  +D    SF  IG I ++ +     S+++  ++          ++ +    +P  
Sbjct: 673  TGFKFYED----SFKYIGYISIIALFGFAVSFIQFLRLGLDKRTMILRALDIITVVVPPA 728

Query: 331  LPIIVTVTLALGVLRMAKRKAIVRRLPSVETLGSVNVICSDKTGTLTSNHMTVSKLWCLD 390
            LP  +++     + R+ K+         V   G ++V+C DKTGTLT + + V  +  + 
Sbjct: 729  LPASLSIGTGFALNRLKKKGIFCISPTRVNVGGKIDVMCFDKTGTLTEDGLDVLGVHVVQ 788

Query: 391  SMSNKLNVLSLDKNKKTKNSNGNLKNYL-TEDVRETLTIGNLCNNASFSQEHAIFLGNPT 449
             +  ++ +  L  + K    + +L + + T D++    + +L    S        LG+P 
Sbjct: 789  PLQQEMKISKLVTDVKDLLQSLSLSDCVSTRDMKAKNFLVSLLTCHSLRMVDGELLGDPF 848

Query: 450  DVALL--------EQLANFEMPDIRNTVQKVQELPFNSKRKLMATKILNPVD-------- 493
            D  ++        E+  N ++  +         +P NS+    A  I++P          
Sbjct: 849  DFKMVQFTKWSDEEETGNRKVHSLYEERHDGSTMPENSR---FAPAIVHPSGKGRFIERE 905

Query: 494  -----------------NKCTVYVKGAFERILEYSTSYLKSKGKKTEKLTEAQKATINEC 536
                              + +V VK   E +     S+ K   +   +L   Q   ++  
Sbjct: 906  PSNVIGIVRSFEFLSNLRRMSVIVKPFSENVF---MSFTKGAPEVIFELCSKQTLPLDYE 962

Query: 537  A--NSMASEGLRVFGFAKLTLSDSSTPLT-----EDLIKDLTFTGLIGMNDPPRPNVKFA 589
            A  +     G RV   A   L+  S   +     E++  +L F G I   +  +   K  
Sbjct: 963  ALLHHYTHNGYRVIACAGKKLTRQSWLYSQKVSREEIESNLEFLGFIIFENKLKGTTKET 1022

Query: 590  IEQLLQGGVHIIMITGDSENTAVNIAKQIGIPVIDPKLSV-------------------- 629
            +E L +  +  IM TGD+  TA+++ ++ G+ V  P++ V                    
Sbjct: 1023 LESLHRADIRTIMCTGDNVLTAISVGREAGL-VESPRVFVSVINDIDTSQEGDIITWQNV 1081

Query: 630  --------------LSGDKLD--------------EMSDDQLANVIDHV----NIFARAT 657
                          LSGD  D              +    Q+  VI+++    +I+AR +
Sbjct: 1082 ANSSDTLDSVTLRPLSGDTDDYTLAVTGEVFRLLFKTDKSQIEEVINNILLKTSIYARMS 1141

Query: 658  PEHKLNIVRALRKRGDVVAMTGDGVNDAPALKLSDIGVSMGRIGTDVAKEASDMVLTDDD 717
            P+ K  +V  L+  G  V   GDG ND  ALK +DIG+S+      VA   +  +    +
Sbjct: 1142 PDEKHELVERLQSIGYQVGFCGDGANDCGALKAADIGISLSEAEASVAAPFTSRLF---E 1198

Query: 718  FSTILTAIEEGKGIFNNIQNFLTFQXXXXXXXXXXXXXXXXFKLPNPLNAMQILWINILM 777
             S +L  ++EG+     + +F  FQ                +   + L   Q L+I++ +
Sbjct: 1199 ISCVLDVMKEGRAAL--VTSFACFQYMSLYSATQFVTILILYSRGSNLGDFQFLYIDLFL 1256

Query: 778  DGPPAQSLGVEPVDHEVMKKPPRKRTDKILTHDVMKRLLTTAACIIVGTV--YIFVKEM- 834
              P A  +      +EV+ K  ++ T  +++  ++  LL     + V  +  ++ V+ M 
Sbjct: 1257 IVPLAVFMSWSK-PYEVLAK--KRPTANLVSPKILIPLLVHIVILFVFQLVPWLAVQHMK 1313

Query: 835  -------AEDGKVTARDTTMTF 849
                    +D  V + D T+ F
Sbjct: 1314 WYRQPVVGDDEHVASSDNTILF 1335

>Kwal_26.9207
          Length = 1469

 Score =  112 bits (279), Expect = 8e-25,   Method: Compositional matrix adjust.
 Identities = 203/921 (22%), Positives = 366/921 (39%), Gaps = 161/921 (17%)

Query: 66   NRRSLYGPNEITVEDDESLFKKFLSNFIEDRMILLLIGSAVVSLFMGNIDDAVSITLAIF 125
            +R   +G N I ++   SL        + D ++       + S+ +   D+       IF
Sbjct: 475  DRMLAFGRNNINLKQKTSL------EILFDEVLHPFYVFQIFSILLWLADNYYYYAACIF 528

Query: 126  IVVTVGFVQEY-RSEKSLEALNKLVPAEC--HLMRCGQESHVLASTLVPGDLVHFRIGD- 181
            I+  +  +     ++K+ + L ++  + C   + R G    V +S LVPGD+  + I D 
Sbjct: 529  IISMLSIIDTLVETKKTSQRLAEVSHSHCEVRVYRDGFWVQVSSSELVPGDV--YEISDP 586

Query: 182  ---RIPADIRIIEAIDLSIDESNLTGENEPVHK---TSQTIEKSSFNDQPNSIVPISERS 235
                 P D  ++   D  ++ES LTGE+ PV K   + +TI +   + Q   I     +S
Sbjct: 587  SLSTFPCDSLLLSG-DCIVNESMLTGESVPVSKIPASDETIYQLLEDFQKTQISNFLAKS 645

Query: 236  CIAYMGTLV-------KEGHGKGIVVGTGTNTSFGAVFEMMNNIEKPKTPLQLTMD--KL 286
             + + GT +       ++     +VV TG +T+ G++   M  I    +  +   D  K 
Sbjct: 646  FL-FNGTKIIRVRIGGEQSTALAMVVRTGFSTTKGSLLRSM--IFPKPSGFKFYEDSFKY 702

Query: 287  GKDLSLVSFIVIGMICLVGIIQGRSWLEMFQISVSLAVAAIPEGLPIIVTVTLALGVLRM 346
               ++L++     + C+  I  G ++  M   ++ +    +P  LP  +++  +  + R+
Sbjct: 703  IGFMTLIALAGFSISCINFIRLGLAYKVMILRALDIITIVVPPALPATLSIGASFAIARL 762

Query: 347  AKRKAIVRRLPS-VETLGSVNVICSDKTGTLTSNHMTVSKLWCLDSMSNK--------LN 397
             K+K I    P+ V   G ++V+C DKTGTLT + + V  +   +   ++         N
Sbjct: 763  -KKKGIFCIAPTRVNVSGKIDVMCFDKTGTLTEDGLDVLGVHVAEPQGHQNFRFGALITN 821

Query: 398  VLSLDKNKKTKNSNGNLKNYLTEDVRETLTIGNLCNNASFSQEHAIFLGNPTDVALL--- 454
            V  L  NK + N  G+  ++ + +   +L     C+  S        LG+P D  +    
Sbjct: 822  VRGL-FNKYSLNDCGSPIDFKSRNFLVSLLT---CH--SLRVVDGELLGDPLDFKMFQFT 875

Query: 455  -----EQLANFEMPDIRNTVQKVQELPFNSKRKLMATKILNP----VDNKCT-------V 498
                 E   +F+   +         LP N+    +A  +++P     +NK T       +
Sbjct: 876  NWSYAEDFQDFKFHSLNEERNNKSTLPENAG---IAPAVVHPNAESTENKFTENDPHNLL 932

Query: 499  YVKGAFERI--LEYSTSYLKSKGKKT-EKLTEAQKATINECAN-------------SMAS 542
             V  +FE +  L   +  +K  G+      T+     I+E  N                 
Sbjct: 933  GVIRSFEFVSELRRMSVIVKPYGENVFWGFTKGAPEVISEICNKSTLPANYEQILQQYTH 992

Query: 543  EGLRVFGFAKLTLSDSSTPLT-----EDLIKDLTFTGLIGMNDPPRPNVKFAIEQLLQGG 597
             G RV   A  TL   +         E++  ++ F G +   +  +P+    +  L   G
Sbjct: 993  NGYRVIACAGKTLPKRTWRFAQKVSREEVESNMEFLGFVVFENKLKPSTTPTLASLQDAG 1052

Query: 598  VHIIMITGDSENTAVNIAKQIG--------IPVIDPKLS----------------VLSGD 633
            +  IM TGD+  TA+++ ++ G        +P I+  +                 +L G 
Sbjct: 1053 IRSIMCTGDNVLTAISVGRESGLITESHVFVPQINDNMDPNEDLIIWRDVDDCDLILDGV 1112

Query: 634  KLDEM---SDDQLANVID---------------HVN-------IFARATPEHKLNIVRAL 668
             L+ M   SD  +A   D               ++N       I+AR +P+ K  +V  L
Sbjct: 1113 TLEPMNGSSDYTIAVTGDVFRLLFKNNEVLPESYINMVLLKSSIYARMSPDEKHELVGQL 1172

Query: 669  RKRGDVVAMTGDGVNDAPALKLSDIGVSMGRIGTDVAKEASDMVLTDDDFSTILTAIEEG 728
            +    VV   GDG ND  ALK +D+GVS+      VA   +  V    + S IL  I+EG
Sbjct: 1173 QGLDYVVGFCGDGANDCGALKAADVGVSLSEAEASVAAPFTSSVF---EISCILDVIKEG 1229

Query: 729  KGIFNNIQNFLTFQXXXXXXXXXXXXXXXXFKLPNPLNAMQILWINILMDGPPAQSLGVE 788
            +       +F  FQ                +     L   Q L+I++ +  P A  +   
Sbjct: 1230 RASLTT--SFSCFQYMSLYSAIQFVTVTMLYSRGINLGDFQFLYIDLFLIVPIAIFMSWS 1287

Query: 789  PVDHEVMKKPPRKRTDKILTHDVMKRLLTTAACIIV--GTVYIFVKEM--------AEDG 838
               H+++KK P   +  +++  ++  L+   A I+V   T ++ V+ M          D 
Sbjct: 1288 KPYHKLVKKRP---SANLVSPKILAPLVANIAIILVFQATPWLVVQAMRWYQAPVVGGDD 1344

Query: 839  KVTARDTTMTFTCFVFFDMFN 859
             V + D T+ F    FF  F 
Sbjct: 1345 AVQSSDNTVLF----FFSNFQ 1361

>Scas_665.30
          Length = 1439

 Score =  108 bits (271), Expect = 7e-24,   Method: Compositional matrix adjust.
 Identities = 175/818 (21%), Positives = 314/818 (38%), Gaps = 150/818 (18%)

Query: 106  VVSLFMGNIDDAVSITLAIFIVVTVG----FVQEYRSEKSLEALNKLVPAECHLMRCGQE 161
            + S+ + ++D+       IF++  +      V+  R++KSL  ++     E  + R    
Sbjct: 279  IFSIILWSLDEYYYYAGCIFLISILSIVDTLVETRRTQKSLADMSHFA-CEVRVFRDEFW 337

Query: 162  SHVLASTLVPGDLVHFRIGDR----IPADIRIIEAIDLSIDESNLTGENEPVHKTSQTIE 217
            ++V ++ LVPGD+  + I D      P D  ++   D  ++ES LTGE+ PV K     E
Sbjct: 338  TNVNSADLVPGDI--YEISDPSLTVFPCDSLLLSG-DCIVNESMLTGESVPVSKFPAEPE 394

Query: 218  K--SSFNDQPNSIVPISERSCIAYMGTLVKEG---HGK----GIVVGTGTNTSFGAVFEM 268
                  +D  N+ +         + GT +      +G+     +VV TG +T+ G++   
Sbjct: 395  TMLQLLDDFQNTQISSYLSKSFLFNGTTIIRARIPYGQSAALAMVVRTGFSTTKGSLVRS 454

Query: 269  MNNIEKPKTPLQLTMD--KLGKDLSLVSFIVIGMICLVGIIQGRSWLEMFQISVSLAVAA 326
            M    KP T  +   D  K    ++L++     + C+  I  G     M   ++ +    
Sbjct: 455  MV-FPKP-TGFKFYEDSFKYIGVMALIALFGFSISCIQFIKIGLDKRTMILRALDIITIV 512

Query: 327  IPEGLPIIVTVTLALGVLRMAKRKAIVRRLPSVETLGSVNVICSDKTGTLTSNHMTVSKL 386
            +P  LP  +T+     + R+ K+         V   G ++++C DKTGTLT N + V  +
Sbjct: 513  VPPALPATLTIGTGFALSRLKKKGIFCISPTRVNIGGKIDILCFDKTGTLTENGLDVLGV 572

Query: 387  -WCLDSMSNK------------------LNVLSLDKNKKTKNSNGNLKNYLTEDVRETLT 427
              C+ S  N                   LN  S  ++ + KN   +L    +  V +   
Sbjct: 573  QLCVPSSHNSFQFADLVQDVHKLFPKFSLNDCSSPRDYRAKNFFISLLTCHSLRVVDNEL 632

Query: 428  IGNLCNNASFS----------QE---HAIFLGNPTDVALLEQL---------------AN 459
            IG+  +   F           QE   H+ +     D AL E +                 
Sbjct: 633  IGDPLDFKMFQFTKWSYEEDFQEKEFHSTYEERRHDNALPENIDIIPAVVHPNSADPENT 692

Query: 460  FEMPDIRNTVQKVQELPFNSKRKLMATKILNPVDNKCTVYVKGAFERILEYSTSYLKSKG 519
            F   D  N +  ++   F S+ + M+  +    ++    + KGA E I            
Sbjct: 693  FIDNDPHNFLGIIRSFEFLSELRRMSVIVKPSNEDVYWAFTKGAPEVI------------ 740

Query: 520  KKTEKLTEAQ-KATINECANSMASEGLRVFGFAKLTLSDSSTPLT-----EDLIKDLTFT 573
              T+   +A   A   E  N    +G RV   A   L  ++   +     E++  ++ F 
Sbjct: 741  --TQICNKATLPANFEEMLNYYTHKGYRVIACAGRVLPRNTWLYSQKVSREEVESNMEFL 798

Query: 574  GLIGMNDPPRPNVKFAIEQLLQGGVHIIMITGDSENTAVNIAKQIGI----PVIDPKLS- 628
            G I   +  +      ++ L +  +  +M TGD+  TA+++ +Q  +     V  P L  
Sbjct: 799  GFIIFENKLKKETAKTLQTLQEASIRTVMCTGDNVLTAISVGRQCNLIKSKKVYVPSLEE 858

Query: 629  -----------------------------------------------VLSGDKLDEMSDD 641
                                                           ++ GD+ + +S+D
Sbjct: 859  IDSTGQTSIIWRDVDNMDDTLDSRTLLPINNSSSTSYTLAITGDIFRIIFGDENNSISED 918

Query: 642  QLANVIDHVNIFARATPEHKLNIVRALRKRGDVVAMTGDGVNDAPALKLSDIGVSMGRIG 701
             +  V+    I+AR +P+ K  ++  L++    V   GDG ND  ALK +D+G+S+    
Sbjct: 919  YINTVLLKGTIYARMSPDEKHELMEQLQRLNYTVGFCGDGANDCGALKAADVGISLSEAE 978

Query: 702  TDVAKEASDMVLTDDDFSTILTAIEEGKGIFNNIQNFLTFQXXXXXXXXXXXXXXXXFKL 761
              VA   +  V    D S +L  I+EG+     + +F  FQ                +  
Sbjct: 979  ASVAAPFTSQVF---DISCVLDVIKEGRACL--VTSFSCFQYMSLYSAIQFITITVLYSR 1033

Query: 762  PNPLNAMQILWINILMDGPPAQSLGV-EPVDHEVMKKP 798
             + L   Q L+I++L+  P A  +   +P D  V K+P
Sbjct: 1034 GSNLGDFQFLYIDLLLIVPIAIFMSWSKPYDKIVKKRP 1071

>CAGL0M11308g 1110211..1114569 similar to sp|Q12697 Saccharomyces
            cerevisiae YOR291w, hypothetical start
          Length = 1452

 Score =  107 bits (267), Expect = 2e-23,   Method: Compositional matrix adjust.
 Identities = 174/807 (21%), Positives = 323/807 (40%), Gaps = 129/807 (15%)

Query: 106  VVSLFMGNIDDAVSITLAIFIVVTVG----FVQEYRSEKSLEALNKLVPAECHLMRCGQE 161
            V+S+ + ++D+       IF++  +      ++  +  ++L  ++     E  ++R G  
Sbjct: 491  VLSIILWSLDEYYYYAGCIFLISLLSILDTLIETKKISRTLAEMSHF-NCEVRVLREGFW 549

Query: 162  SHVLASTLVPGDLVHFRIGDR----IPADIRIIEAIDLSIDESNLTGENEPVHKTSQTIE 217
            S + +S LVPGD+  + I D     +P D  I+ + D  ++ES LTGE+ PV K   + E
Sbjct: 550  SSIHSSELVPGDI--YEISDPNLNLLPCD-SILLSGDCIVNESMLTGESVPVSKYPASEE 606

Query: 218  K--SSFND-QPNSIVPISERSCIAYMGTLVKEGHGKG------IVVGTGTNTSFGAVFEM 268
                 F+D Q   I     +S +    TL++     G      + V TG +T+ G++   
Sbjct: 607  TILQLFDDFQSTQISTFLSKSFLFNGTTLIRAKIPNGGSVALAMAVRTGFSTTKGSLIRS 666

Query: 269  MNNIEKPKTPLQLTMD--KLGKDLSLVSFIVIGMICLVGIIQGRSWLEMFQISVSLAVAA 326
            M    KP +  +   D  K    +++++F    + C+  I  G     M   ++ +    
Sbjct: 667  MV-FPKP-SGFKFYSDSFKYIGFMAIIAFFGFSISCINFIKLGLDKRTMILRALDIITIV 724

Query: 327  IPEGLPIIVTVTLALGVLRMAKRKAIVRRLPS-VETLGSVNVICSDKTGTLTSNHMTV-- 383
            +P  LP  +T+  +  + R+ K K I    P+ V   G ++V+C DKTGTLT + + V  
Sbjct: 725  VPPALPATLTIGTSFALNRL-KEKGIFCIAPTRVNIGGKIDVMCFDKTGTLTEDGLDVLG 783

Query: 384  SKLWCLDSMSNKLNVLSLDKNKKTKNSNGNLKNYLT-EDVRETLTIGNLCNNASFSQEHA 442
             ++ C  +  NK +   L  +        +LK+    +D +    + +L    S      
Sbjct: 784  VRVSCA-ATRNKASFSDLISDTHDIFPKFSLKDCSNPDDYKRRNFLISLLTCHSLRVVDG 842

Query: 443  IFLGNPTDVALL--------EQLANFEMPDIRNTVQKVQELPFNSKRKLMATKILNPVD- 493
              LG+P D  +         E   N +   +     + Q  P N+    +   I++P D 
Sbjct: 843  ELLGDPLDFKMFQFTGWSYEEDFQNHQFHSLYEERHEGQNFPENND---IIPAIVHPNDS 899

Query: 494  NKCTVYVKG----------AFERILEY------------STSYLKSKGKKTEKLTEAQKA 531
            ++   +V+           +FE + E             +  +  +KG     +     A
Sbjct: 900  DERNKFVQNDPNNILGIIRSFEFLSELRRMSVIVKPNNENVYWAYTKGAPEVIIDICNPA 959

Query: 532  TI----NECANSMASEGLRVFGFAKLTLSDSSTPLT-----EDLIKDLTFTGLIGMNDPP 582
            T+    ++  N     G RV   A  TL  ++   +     E++  ++ F G I   +  
Sbjct: 960  TLPSDYDDILNFYTHSGYRVIACAGKTLPKNTWLYSQKVRREEVESNMEFLGFIIFQNKL 1019

Query: 583  RPNVKFAIEQLLQGGVHIIMITGDSENTAVNIAKQIGI-------------------PVI 623
            +      + +L    +  +M TGD+  TA+++ K+  +                   PVI
Sbjct: 1020 KDATSPTLSKLKTANIRTVMCTGDNVLTAISVGKECQLITEDRVYVPTVAYSDMTVQPVI 1079

Query: 624  D------------------------PKLSVLSGDKL-------DEMSDDQLANVIDHVNI 652
                                     P    ++G+         D  S++ +  ++   +I
Sbjct: 1080 HWNEISNAEHILDTFTLQPIDDYSGPYTLAITGEVFRIIFSNQDNYSEEYVNEILLKGSI 1139

Query: 653  FARATPEHKLNIVRALRKRGDVVAMTGDGVNDAPALKLSDIGVSMGRIGTDVAKEASDMV 712
            FAR +P+ K  +V  L+K    V   GDG ND  ALK +D+G+S+      VA   +  +
Sbjct: 1140 FARMSPDEKHELVEQLQKMDYTVGFCGDGANDCGALKAADVGISLSEAEASVAAPFTSKI 1199

Query: 713  LTDDDFSTILTAIEEGKGIFNNIQNFLTFQXXXXXXXXXXXXXXXXFKLPNPLNAMQILW 772
                D + +L  I+EG+     + +F  FQ                +   + L   Q L+
Sbjct: 1200 F---DITCVLDVIKEGRASL--VTSFACFQYMSLYSAIQFISITILYSRGSNLGDFQFLY 1254

Query: 773  INILMDGPPAQSLGVEPVDHEVMKKPP 799
            I++L+  P A ++      HE+ KK P
Sbjct: 1255 IDLLLIIPIAVTMSWSKPYHELAKKRP 1281

>CAGL0L01419g 156123..159767 highly similar to sp|P39986
           Saccharomyces cerevisiae YEL031w SPF1 P-type ATPase,
           hypothetical start
          Length = 1214

 Score = 97.8 bits (242), Expect = 2e-20,   Method: Compositional matrix adjust.
 Identities = 155/720 (21%), Positives = 284/720 (39%), Gaps = 150/720 (20%)

Query: 68  RSLYGPNEITVEDDESLFKKFLSNFIEDRMILLLIGSA-VVSLFMGNIDDAVSITLA-IF 125
           R LYG NE  +         FL  F E  +  L +     V+L++  +D+   ++L  +F
Sbjct: 172 RRLYGNNEFDIP-----IPTFLELFKEHAVAPLFVFQVFCVALWL--LDEYWYLSLFNLF 224

Query: 126 IVVTVGFVQEYRSEKSLEALNKL--VPAECHLMRCGQESHVLASTLVPGDLVHF-RIGD- 181
           +++++     ++   +L+    +   P   +++R G+   +  + L+P D+V   R  + 
Sbjct: 225 MILSMEAASVFQRLTALKEFRTMGVKPYAINVLRDGKWVEMQTNELLPMDVVSVVRTAED 284

Query: 182 -RIPADIRIIEAIDLSIDESNLTGENEPVHKTSQTIEKSSFNDQPNSIVPISERSCIAYM 240
             +P D+ +++   + ++E+ L+GE+ P+ K S  +   +   Q    +  +++  + + 
Sbjct: 285 SALPCDLILVDGTCI-VNEAMLSGESTPLLKESIRLRPGNEELQ----IEGTDKISVLHG 339

Query: 241 GTLV---------------KEGHGKGIVVGTGTNTSFGAVFEMMNNIEKPKTPLQLTMDK 285
           GT V                +G    IV  TG  TS G++  +M            + ++
Sbjct: 340 GTKVLQVTTPEKTGKVPSPPDGGAIAIVTKTGFETSQGSLVRVM----------IYSSER 389

Query: 286 LGKD--------LSLVSFIVIG--MICLVGIIQGRSWLEMFQISVSLAVAAIPEGLPIIV 335
           +G D        L L+ F V+    + + G   GR   ++    + +  + +P  LP+ +
Sbjct: 390 VGVDNKEALYFILFLLIFAVVASWYVWVEGTKMGRVQSKLILDCILIITSVVPPELPMEL 449

Query: 336 TVTLALGVLRMAKRKAIVRRLPSVETLGSVNVICSDKTGTLTSNHMTVSKLWCLDSMSNK 395
           T+ +   +  ++K          +   G ++V C DKTGTLT   +    L  L S  + 
Sbjct: 450 TMAVNSSLSALSKFYVYCTEPFRIPFAGRIDVCCFDKTGTLTGEDLVFEGLAGLSS--DP 507

Query: 396 LNVLSLDKNKKTKNSNGNLKNYLTEDVRETLTIGNLCNNASFSQEHAIFLGNPTDVALLE 455
            ++  L       NS              +L +G    +A    E    +G+P + A L+
Sbjct: 508 KDIRHLYSATDCPNST-------------SLVVG--AAHALVRLEDGEIVGDPMEKATLK 552

Query: 456 QLANFEMPDIRNTVQKVQELPFNSKRKLMATKILNPVDNKCTVYVKGAFERILEYSTSYL 515
            L        + TV+K               K+ N  + + T+  +  F   L+ S+S  
Sbjct: 553 AL--------KWTVEK-------------GDKVFNEKNGQVTILRRFQFSSALKRSSSVA 591

Query: 516 KSKGKKTEKLTEAQK----------ATINECANSMASEGLRVFGFAKLTLSDSSTPLTED 565
              GK    +  A +          A  +E   S    G RV   A   L   S    ED
Sbjct: 592 THDGKLYSAVKGAPETIRERLFTIPANYDEIYKSFTRSGSRVLALASKKLEKMSQSQIED 651

Query: 566 -----LIKDLTFTGLIGMNDPPRPNVKFAIEQLLQGGVHIIMITGDSENTAVNIAKQIGI 620
                  +DL F G +  + P + +    I+ L +     +MITGD+  TAV++AK++GI
Sbjct: 652 ADREHFERDLEFNGFLIFHCPLKHDAIETIQMLNESAHRCVMITGDNPLTAVHVAKEVGI 711

Query: 621 ------------------------------------------PVIDPKLSVLSGDKLDEM 638
                                                      + D     ++G  L+ +
Sbjct: 712 VKGETLIVDMVDNGNDDKLVFRNVEETLSFEFVVSKDSFEKYGIFDKYDLAVTGHALEAL 771

Query: 639 -SDDQLANVIDHVNIFARATPEHKLNIVRALRKRGDVVAMTGDGVNDAPALKLSDIGVSM 697
               QL ++I H  I+AR +P  K  I+  L+  G    M GDG ND  ALK + +GV++
Sbjct: 772 KGHHQLQDLIRHAWIYARVSPAQKEFILNNLKDMGYQTLMCGDGTNDVGALKQAHVGVAL 831

>YEL031W (SPF1) [1394] chr5 (90258..93905) Putative
           Ca2+-transporting ATPase, member of the P-type ATPase
           superfamily of membrane transporters [3648 bp, 1215 aa]
          Length = 1215

 Score = 92.0 bits (227), Expect = 1e-18,   Method: Compositional matrix adjust.
 Identities = 162/735 (22%), Positives = 291/735 (39%), Gaps = 132/735 (17%)

Query: 43  VDEALEKLDTDKNGGLRSSNEANNRRSLYGPNEITVEDDESLFKKFLSNFIEDRMILLLI 102
           VDE+ +  D  K  G   S +  + + LYG N   +         F+  F E  +  L +
Sbjct: 151 VDESPKIGDFQKCKG--HSGDLTHLKRLYGENSFDIP-----IPTFMELFKEHAVAPLFV 203

Query: 103 GSAV-VSLFMGNIDDAVSITLA-IFIVVTVGFVQEYRSEKSLEALNKL--VPAECHLMRC 158
                V+L++  +D+    +L  +F+++++     ++   +L+    +   P   ++ R 
Sbjct: 204 FQVFCVALWL--LDEFWYYSLFNLFMIISMEAAAVFQRLTALKEFRTMGIKPYTINVFRN 261

Query: 159 GQESHVLASTLVPGDLVHF-RIGDR--IPADIRIIEAIDLSIDESNLTGENEPVHKTSQT 215
            +   +  + L+P DLV   R  +   IP D+ +++   + ++E+ L+GE+ P+ K S  
Sbjct: 262 KKWVALQTNELLPMDLVSITRTAEESAIPCDLILLDGSAI-VNEAMLSGESTPLLKESIK 320

Query: 216 IEKSSFNDQPNSIVPISERSCIAYMGTLV---------------KEGHGKGIVVGTGTNT 260
           +  S  N Q + +    ++  + + GT                  +G    IV  TG  T
Sbjct: 321 LRPSEDNLQLDGV----DKIAVLHGGTKALQVTPPEHKSDIPPPPDGGALAIVTKTGFET 376

Query: 261 SFGAVFEMMNNIEKPKTPLQLTMDKLGKDLSLVSFIVIG--MICLVGIIQGRSWLEMFQI 318
           S G++  +M  I   +       + L   L L+ F VI    + + G   GR   ++   
Sbjct: 377 SQGSLVRVM--IYSAERVSVDNKEALMFILFLLIFAVIASWYVWVEGTKMGRIQSKLILD 434

Query: 319 SVSLAVAAIPEGLPIIVTVTLALGVLRMAKRKAIVRRLPSVETLGSVNVICSDKTGTLTS 378
            + +  + +P  LP+ +T+ +   +  +AK          +   G ++V C DKTGTLT 
Sbjct: 435 CILIITSVVPPELPMELTMAVNSSLAALAKFYVYCTEPFRIPFAGRIDVCCFDKTGTLTG 494

Query: 379 NHMTVSKLWCLDSMSNKLNVLSLDKNKKTKNSNGNLKNYLTEDVRET--LTIGNLCNNAS 436
             +    L  + + S  +  L                 Y   +  E+  L IG    +A 
Sbjct: 495 EDLVFEGLAGISADSENIRHL-----------------YSAAEAPESTILVIG--AAHAL 535

Query: 437 FSQEHAIFLGNPTDVALLEQLA------NFEMPDIRNTVQKVQELPFNSKRKLMATKILN 490
              E    +G+P + A L+ +       N    +    +  ++   F+S  K  A+  + 
Sbjct: 536 VKLEDGDIVGDPMEKATLKAVGWAVERKNSNYREGTGKLDIIRRFQFSSALKRSAS--IA 593

Query: 491 PVDNKCTVYVKGAFERILEYSTSYLKSKGKKTEKLTEAQKATINECANSMASEGLRVFGF 550
             ++     VKGA E I               E+L++  K   +E   S    G RV   
Sbjct: 594 SHNDALFAAVKGAPETI--------------RERLSDIPK-NYDEIYKSFTRSGSRVLAL 638

Query: 551 AKLTLSDSSTPLTEDLIKD-----LTFTGLIGMNDPPRPNVKFAIEQLLQGGVHIIMITG 605
           A  +L   S    +DL +D     LTF G +  + P + +    I+ L +     IMITG
Sbjct: 639 ASKSLPKMSQSKIDDLNRDDVESELTFNGFLIFHCPLKDDAIETIKMLNESSHRSIMITG 698

Query: 606 DSENTAVNIAKQIGIPV-----------------------------IDPKLSVLSGDKLD 636
           D+  TAV++AK++GI                                DP        KL 
Sbjct: 699 DNPLTAVHVAKEVGIVFGETLILDRAGKSDDNQLLFRDVEETVSIPFDPSKDTFDHSKLF 758

Query: 637 EMSD--------------DQLANVIDHVNIFARATPEHKLNIVRALRKRGDVVAMTGDGV 682
           +  D               QL +++ H  ++AR +P  K  ++  L+  G    M GDG 
Sbjct: 759 DRYDIAVTGYALNALEGHSQLRDLLRHTWVYARVSPSQKEFLLNTLKDMGYQTLMCGDGT 818

Query: 683 NDAPALKLSDIGVSM 697
           ND  ALK + +G+++
Sbjct: 819 NDVGALKQAHVGIAL 833

>YOR291W (YOR291W) [5075] chr15 (861172..865590) Member of the
            cation-translocating P-type ATPase superfamily of
            membrane transporters [4419 bp, 1472 aa]
          Length = 1472

 Score = 91.7 bits (226), Expect = 2e-18,   Method: Compositional matrix adjust.
 Identities = 201/948 (21%), Positives = 351/948 (37%), Gaps = 178/948 (18%)

Query: 43   VDEALEKLDTDKNGGLRSSNEANNRRSLYGPNEITVE---DDESLFKKFLSNFIEDRMIL 99
            +D     L T  NG  +   E  +R   +G N+I +      E LF + L  F   +   
Sbjct: 448  IDPDWVDLSTVSNGLTKGVQE--DRELAFGKNQINLRMKTTSEILFNEVLHPFYVFQ--- 502

Query: 100  LLIGSAVVSLFMGNIDDAVSITLAIFIVVTVGFVQEYRSEKSLEA-LNKLVPAEC--HLM 156
                  V S+ +  ID+       IF++  +        +K +   L ++    C   ++
Sbjct: 503  ------VFSIILWGIDEYYYYAACIFLISVLSIFDSLNEQKKVSRNLAEMSHFHCDVRVL 556

Query: 157  RCGQESHVLASTLVPGDLVHFRIGDR----IPADIRIIEAIDLSIDESNLTGENEPVHK- 211
            R    + + +S LVPGD+  + + D     +P D  I+ + D  ++ES LTGE+ PV K 
Sbjct: 557  RDKFWTTISSSELVPGDI--YEVSDPNITILPCD-SILLSSDCIVNESMLTGESVPVSKF 613

Query: 212  --TSQTIEKSSFNDQPNSIVPISERSCIAYMGT-LVKEGHGKG------IVVGTGTNTSF 262
              T +T+ +   + Q   I     +S + Y GT +++     G      +VV TG +T+ 
Sbjct: 614  PATEETMYQLCDDFQSTQISSFVSKSFL-YNGTNIIRARIAPGQTAALAMVVRTGFSTTK 672

Query: 263  GAVFEMMNNIEKPKTPLQLTMDKLGKDLSLVSFIVIGMICLVGIIQ----GRSWLEMFQI 318
            G++   M    KP T  +   D   K +  +S I I   C V  +Q    G     M   
Sbjct: 673  GSLVRSMV-FPKP-TGFKFYRDSF-KYIGFMSLIAIFGFC-VSCVQFIKLGLDKKTMILR 728

Query: 319  SVSLAVAAIPEGLPIIVTVTLALGVLRMAKRKAIVRRLPSVETLGSVNVICSDKT----- 373
            ++ +    +P  LP  +T+     + R+ ++         +   G ++V+C DKT     
Sbjct: 729  ALDIITIVVPPALPATLTIGTNFALSRLKEKGIFCISPTRLNISGKIDVMCFDKTGTLTE 788

Query: 374  ---------------------GTLTSNHMTVSKLWCLDSMSNKLNV------LSLDKNKK 406
                                 G L S+   V   + L+  S+ L+       +SL     
Sbjct: 789  DGLDVLGVQISEPNGVRGQKFGELLSDIRQVFPKFSLNDCSSPLDFKSRNFFMSLLTCHS 848

Query: 407  TKNSNGNLKNYLTEDVRETLTIGNLCNNASFSQEHAIFLGNPTDVALLE----------- 455
             ++ +GNL     +      T  +   +      H+++ G   D    E           
Sbjct: 849  LRSVDGNLLGDPLDFKMFQFTGWSFEEDFQKRAFHSLYEGRHEDDVFPENSEIIPAVVHP 908

Query: 456  ----QLANFEMPDIRNTVQKVQELPFNSKRKLMATKILNPVDNKCTVYVKGAFERILEYS 511
                +   F   D  N +  V+   F S+ + M+  +    D+    + KGA E I E  
Sbjct: 909  DSNNRENTFTDNDPHNFLGVVRSFEFLSELRRMSVIVKTNNDDVYWSFTKGAPEVISEIC 968

Query: 512  TSYLKSKGKKTEKLTEAQKATINECANSMASEGLRVFGFAKLTLSDSSTPLT-----EDL 566
                               A   E        G RV   A  TL   +   +     E++
Sbjct: 969  NK-------------STLPADFEEVLRCYTHNGYRVIACAGKTLPKRTWLYSQKVSREEV 1015

Query: 567  IKDLTFTGLIGMNDPPRPNVKFAIEQLLQGGVHIIMITGDSENTAVNIAKQIGI------ 620
              +L F G I   +  +      ++ L    +  IM TGD+  TA+++ ++ G+      
Sbjct: 1016 ESNLEFLGFIIFQNKLKKETSETLKSLQDANIRTIMCTGDNILTAISVGREAGLIQCSRV 1075

Query: 621  -------------PVI------DP------------KLS--------------VLSGDKL 635
                         PVI      +P            KL                +SGD  
Sbjct: 1076 YVPSINDTPLHGEPVIVWRDVNEPDKILDTKTLKPVKLGNNSVESLRECNYTLAVSGDVF 1135

Query: 636  -------DEMSDDQLANVIDHVNIFARATPEHKLNIVRALRKRGDVVAMTGDGVNDAPAL 688
                   +E+ ++ L  ++ + +I+AR +P+ K  ++  L+K    V   GDG ND  AL
Sbjct: 1136 RLLFRDENEIPEEYLNEILLNSSIYARMSPDEKHELMIQLQKLDYTVGFCGDGANDCGAL 1195

Query: 689  KLSDIGVSMGRIGTDVAKEASDMVLTDDDFSTILTAIEEGKGIFNNIQNFLTFQXXXXXX 748
            K +D+G+S+      VA   +  +    + S +L  I EG+     + +F  FQ      
Sbjct: 1196 KAADVGISLSEAEASVAAPFTSKIF---NISCVLDVIREGRAAL--VTSFACFQYMSLYS 1250

Query: 749  XXXXXXXXXXFKLPNPLNAMQILWINILMDGPPAQSLGVEPVDHEVMKKPPRKR--TDKI 806
                      +   + L   Q L+I++L+  P A  +       ++ KK P     + KI
Sbjct: 1251 AIQFITITILYSRGSNLGDFQFLYIDLLLIVPIAICMSWSKSYEKIDKKRPSANLVSPKI 1310

Query: 807  LTHDVMKRLLT----TAACIIVGTVYIFVKEM-AEDGKVTARDTTMTF 849
            L   ++   L         IIV  +  ++K +   D  V + D T+ F
Sbjct: 1311 LVPLLISVFLVFLFQFIPWIIVQKMSWYIKPIVGGDDAVQSSDNTVLF 1358

>Scas_583.14*
          Length = 875

 Score = 88.6 bits (218), Expect = 1e-17,   Method: Compositional matrix adjust.
 Identities = 121/515 (23%), Positives = 204/515 (39%), Gaps = 109/515 (21%)

Query: 248 HGKGIVV-GTGTNTSFGAVFEMMNNIEKPKTPLQLTMDKLGKD--------LSLVSFIVI 298
           HG  +VV  TG  T  G++  +M            + +++G D        L L++F V+
Sbjct: 17  HGALVVVTKTGFETYQGSLVRVM----------IYSAERVGVDNKEALMFILFLLNFAVV 66

Query: 299 G--MICLVGIIQGRSWLEMFQISVSLAVAAIPEGLPIIVTVTLALGVLRMAKRKAIVRRL 356
               + + G   GR   ++    + +    +P  LP+ +T+ +   +  ++K        
Sbjct: 67  ASWYVWVEGTKMGRIQSKLILDCILIITYVVPPELPMELTMAVNSSLAALSKFYVYCTEP 126

Query: 357 PSVETLGSVNVICSDKTGTLTSNHMTVSKLWCLDSMSNKLNVLSLDKNKKTKNSNGNLKN 416
             +   G ++V C DKTGTLT   +    L  L   S  +  L                 
Sbjct: 127 FRIPLAGRIDVCCFDKTGTLTGEDLVFEGLAGLSDKSEDVRHL----------------- 169

Query: 417 YLTEDVRETLTIGNLCNNASFSQEHAIFLGNPTDVALLEQLA------NFEMPDIRNTVQ 470
           + +ED  +   +     +A    +    +G+P + A L+ L       +F        +Q
Sbjct: 170 FSSEDASQETILVVGAAHALVKLDDGEIVGDPMEKATLKALGWKVEGNDFTSRPKTGKLQ 229

Query: 471 KVQELPFNSKRKLMATKILNPVDNKCTVYVKGAFERILEYSTSYLKSKGKKTEKLTEAQK 530
            ++   F+S  K  ++  +    +K    VKGA E I               E+L    K
Sbjct: 230 ILRRFQFSSALKRSSS--VASHKDKLFTAVKGAPETI--------------RERLAVVPK 273

Query: 531 ATINECANSMASEGLRVFGFAKLTLSDSSTPLTEDLIKD-----LTFTGLIGMNDPPRPN 585
              +E   S    G RV   A  +L + S+   +DL +D     LTF G +  + P +P+
Sbjct: 274 -NYDEIYKSFTRSGSRVLALASKSLPNLSSKQLDDLDRDEIETGLTFNGFLVFHCPLKPD 332

Query: 586 VKFAIEQLLQGGVHIIMITGDSENTAVNIAKQIGIP-----VIDPKLSVLSG-------- 632
               I+ L +     IMITGD+  TAV++AK++ I      ++D   +V  G        
Sbjct: 333 AVETIKMLNESAHRSIMITGDNPLTAVHVAKEVAIVTGETLILDKSETVGDGKLLFFNVE 392

Query: 633 -----------DKLD--EMSD-----------------DQLANVIDHVNIFARATPEHKL 662
                      DK D  E+ D                  QL ++I H  ++AR +P  K 
Sbjct: 393 ETIKIPFDPASDKFDHRELFDKYDIAVTGYALNLLEDHSQLKDLIRHTWVYARVSPSQKE 452

Query: 663 NIVRALRKRGDVVAMTGDGVNDAPALKLSDIGVSM 697
            I+  L++ G    M GDG ND  ALK + +GV++
Sbjct: 453 FILNNLKEMGYQTLMCGDGTNDVGALKQAHVGVAL 487

>KLLA0F07447g 700685..703612 similar to sp|P38995 Saccharomyces
           cerevisiae YDR270w CCC2 probable copper-transporting
           ATPase, start by similarity
          Length = 975

 Score = 87.8 bits (216), Expect = 2e-17,   Method: Compositional matrix adjust.
 Identities = 57/171 (33%), Positives = 90/171 (52%), Gaps = 31/171 (18%)

Query: 550 FAKLTLSD-SSTPLTEDLIK-DLTFTGLIGMNDPPRPNVKFAIEQLLQGGVHIIMITGDS 607
           F   +LSD +S+ LTE  +  D +  G   ++D  + +  F +E L   G+   M+TGD+
Sbjct: 717 FPDESLSDIASSTLTESYVSIDGSLVGKFEISDRVKEDAHFVVEYLQNLGIKCCMVTGDA 776

Query: 608 ENTAVNIAKQIGIPVIDPKLSVLSGDKLDEMSDDQLANVIDHVNIFARATPEHKLNIVRA 667
             +A+ +A+Q+GI   D                           +F+  TPE K +IV  
Sbjct: 777 HQSALKVAQQLGISAND---------------------------VFSEVTPEQKRDIVIQ 809

Query: 668 LRKRG-DVVAMTGDGVNDAPALKLSDIGVSMGRIGTDVAKEASDMVLTDDD 717
           L+  G + VA  GDG+ND+PAL  +D+G+S+   GTD+A EA+D+V+ D D
Sbjct: 810 LQNNGTERVAFVGDGINDSPALVEADLGISISS-GTDIAIEAADIVILDSD 859

 Score = 54.7 bits (130), Expect = 3e-07,   Method: Compositional matrix adjust.
 Identities = 66/284 (23%), Positives = 113/284 (39%), Gaps = 43/284 (15%)

Query: 119 SITLAIFIVVTVGFVQEYRSEKS--LEALNKLVPAECHL-MRCGQESHVLASTLVPGDLV 175
           ++ L  FI +      + +SE S  +  L  L P+ C + +  G    +    L P D+V
Sbjct: 373 AVMLLTFISLGKLLENKAKSETSTAMSKLISLTPSSCSIVLPDGSTREISVELLQPNDIV 432

Query: 176 HFRIGDRIPADIRIIEAIDLSIDESNLTGENEPVHKT--SQTIEKSSFNDQPNSIVPISE 233
               G +IPAD  +I   +  +DES +TGE+  V K   SQ I                 
Sbjct: 433 EVVPGMKIPADGVVIRN-ETEVDESLITGESMLVEKIVGSQVIG---------------- 475

Query: 234 RSCIAYMGTLVKEGHGKGIVVGTGTNTSFGAVFEMMNNIEKPKTPLQLTMDKLGK----- 288
                  G++   GH     +  G +T    +   M   +  K P+Q   DK+       
Sbjct: 476 -------GSVNGPGHFYFRAIRVGEDTKLANIIATMKKAQLSKAPIQKYADKMAGIFVPF 528

Query: 289 --DLSLVSFIVIGMIC-------LVGIIQGRSWLEMFQISVSLAVAAIPEGLPIIVTVTL 339
              LS ++FI   ++        L+   +   +    Q+S+S+ + A P  L +     +
Sbjct: 529 VISLSAITFITWMLVSYTMKTPPLIFNSENGKFFMCMQMSISVIIVACPCALGLAAPTAI 588

Query: 340 ALGVLRMAKRKAIVRRLPSVETLGSVNVICSDKTGTLTSNHMTV 383
            +G    A    +++    +E   ++     DKTGTLT+  M+V
Sbjct: 589 MVGTGVGASHGVLIKGGDVLEKCSALQTFLFDKTGTLTTGRMSV 632

>YIL048W (NEO1) [2619] chr9 (261436..264891) Member of the
           Drs2p-like ATPases family in the superfamily of P-type
           ATPases, overproduction confers neomycin resistance
           [3456 bp, 1151 aa]
          Length = 1151

 Score = 87.8 bits (216), Expect = 2e-17,   Method: Compositional matrix adjust.
 Identities = 165/668 (24%), Positives = 270/668 (40%), Gaps = 149/668 (22%)

Query: 172 GDLVHFRIGDRIPADIRIIEAIDLS----IDESNLTGENEPVHKTSQTIEKS-SFNDQPN 226
           GDL+    GDRIPAD+ ++++ + S    I    L GE +   + +  + ++ S ND  N
Sbjct: 273 GDLIKVHKGDRIPADLVLLQSSEPSGESFIKTDQLDGETDWKLRVACPLTQNLSENDLIN 332

Query: 227 SI---VPISERSCIAYMG----------------------TLVKEGHGKGIVVGTGTNTS 261
            I       E+S   ++G                       L   G     VV TG +T 
Sbjct: 333 RISITASAPEKSIHKFLGKVTYKDSTSNPLSVDNTLWANTVLASSGFCIACVVYTGRDTR 392

Query: 262 FGAVFEMMNNIEKPKTPL-QLTMDKLGKDLSLVSF-IVIGMICLVGIIQGRSWLEMFQIS 319
                 M     K KT L +L ++ + K L    F + I ++   G      ++++ +  
Sbjct: 393 QA----MNTTTAKVKTGLLELEINSISKILCACVFALSILLVAFAGFHNDDWYIDILRYL 448

Query: 320 VSLAVAAIPEGLPIIVTVTLALGVLRMAKRKAI----VRRLPSVETLGSVNVICSDKTGT 375
           + L    IP  L + + +  ++   ++   K I    VR     E LG +  + SDKTGT
Sbjct: 449 I-LFSTIIPVSLRVNLDLAKSVYAHQIEHDKTIPETIVRTSTIPEDLGRIEYLLSDKTGT 507

Query: 376 LTSNHMTVSKLW---------CLDSMSNKLNVLSLDKNKKTKNSNGNL---KNYLTEDVR 423
           LT N M + K+           LD +S+ +  L   KN    NS   L   +  ++  VR
Sbjct: 508 LTQNDMQLKKIHLGTVSYTSETLDIVSDYVQSLVSSKNDSLNNSKVALSTTRKDMSFRVR 567

Query: 424 ETLTIGNLCNNAS--FSQEHAIF-LGNPTDVALL---EQLANFEMPDIRNTVQKVQE--- 474
           + +    +C+N +  F  +   +   +P ++A++   E +        R+++  + E   
Sbjct: 568 DMILTLAICHNVTPTFEDDELTYQAASPDEIAIVKFTESVGLSLFKRDRHSISLLHEHSG 627

Query: 475 ----------LPFNSKRKLMATKILNPVDNKCTVYVKGAFERILEYSTSYLKSKGKKT-- 522
                      PFNS  K M   + +              E++ EY   +   KG  T  
Sbjct: 628 KTLNYEILQVFPFNSDSKRMGIIVRD--------------EQLDEY---WFMQKGADTVM 670

Query: 523 EKLTEAQKATINECANSMASEGLR--VFGFAKLT----------LSDSSTPL-------- 562
            K+ E+      E  N MA EGLR  V G  KL            +D+S  +        
Sbjct: 671 SKIVESNDWLEEETGN-MAREGLRTLVIGRKKLNKKIYEQFQKEYNDASLSMLNRDQQMS 729

Query: 563 ---TEDLIKDLTFTGLIGMNDPPRPNVKFAIEQLLQGGVHIIMITGDSENTA--VNI-AK 616
              T+ L  DL   GL G+ D  + +VK +IE L   G+ I M+TGD   TA  V+I AK
Sbjct: 730 QVITKYLEHDLELLGLTGVEDKLQKDVKSSIELLRNAGIKIWMLTGDKVETARCVSISAK 789

Query: 617 QIG--------IPVIDPKLS---------------VLSGDKLD---EMSDDQLANVIDHV 650
            I           V  P+ +               ++ G+ L    +  + +  +V+ H+
Sbjct: 790 LISRGQYVHTITKVTRPEGAFNQLEYLKINRNACLLIDGESLGMFLKHYEQEFFDVVVHL 849

Query: 651 N--IFARATPEHKLNIVRALRK-RGDVVAMTGDGVNDAPALKLSDIGVSM-GRIGTDVAK 706
              I  R TP+ K ++   +RK  G  V   GDG ND   ++ +D+GV + G+ G   A 
Sbjct: 850 PTVIACRCTPQQKADVALVIRKMTGKRVCCIGDGGNDVSMIQCADVGVGIVGKEGKQ-AS 908

Query: 707 EASDMVLT 714
            A+D  +T
Sbjct: 909 LAADFSIT 916

>Sklu_2193.1 YIL048W, Contig c2193 334-3765 reverse complement
          Length = 1143

 Score = 82.4 bits (202), Expect = 1e-15,   Method: Compositional matrix adjust.
 Identities = 179/772 (23%), Positives = 303/772 (39%), Gaps = 203/772 (26%)

Query: 84  LFKKFLSNFIEDRMILLLIGSAVVSLFMGNIDDAVSITLAIFIVVTVGF-----VQEYRS 138
           L+++F   F     +L+ +  A+ +L +G +   + + LA  ++VT+       +Q  + 
Sbjct: 186 LYEQF-KFFFNLYFLLVALSQAIPALRIGYLSSYI-VPLAFVLMVTMSKEAMDDIQRRQR 243

Query: 139 EKS-----LEALNK--LVPAECHLMRCGQESHVLASTLVPGDLVHFRIGDRIPADIRIIE 191
           +K       E LNK  LVP++                L  GDL+    G RIPAD+ +++
Sbjct: 244 DKESNNELYEVLNKAQLVPSK---------------DLKVGDLIKIHKGTRIPADLVLLQ 288

Query: 192 AIDLS----IDESNLTGENEPVHKTSQTIEKS-SFNDQPNSIVPIS---ERSCIAYMGTL 243
           + + S    I    L GE +   + + ++ ++ S +D  N I   +   E+S   ++G L
Sbjct: 289 SSEPSGESFIKTDQLDGETDWKLRVACSLTQNLSTDDLLNKISITASSPEKSIHRFLGKL 348

Query: 244 VKE----------------------GHGKGIVVGTGTNTSFGAVFEMMNNIEKPKTPL-Q 280
             +                      G   G VV TGT+T       M   +   KT L +
Sbjct: 349 TYKDSSSNALSVDNTMWANTVLASVGSCIGCVVYTGTDTRQA----MNTTMSSVKTGLLE 404

Query: 281 LTMDKLGKDLSLVSFIV-IGMICLVGIIQGRSWLEMFQISVSLAVAAIPEGLPIIVTVTL 339
           L ++ L K L    F++ I ++   G      ++++ +  +  +       +P+ + V L
Sbjct: 405 LEINSLSKILCACVFVLSIVLVAFAGFGNKDWYVDIMRYLILFSTI-----IPVSLRVNL 459

Query: 340 ALGVLRMAKR--------KAIVRRLPSVETLGSVNVICSDKTGTLTSNHMTVSKL----- 386
            LG    A++          IVR     E LG +  + SDKTGTLT N M + KL     
Sbjct: 460 DLGKSVYARQIEHDATIPDTIVRTSTIPEDLGRIEYLLSDKTGTLTQNDMQLKKLHLGTV 519

Query: 387 -WCLDSMSNKLNVLS--LDKNKKTKNSNGNLKNYLTEDVRETLTIGNLCNNASFSQEH-- 441
            + +D+M    + +   +  +  T       K  L   VR+ +    +C+N + + E   
Sbjct: 520 SYTMDTMDIVTDYVQELVSSSTTTPMPQSTAKKDLPNRVRDLVVTLAICHNVTPTFEDGE 579

Query: 442 ----------------------AIFLGNPTDVALLEQLA--NFEMPDIRNTVQKVQELPF 477
                                 ++F  +   V+L  Q +  NFE  DI      +Q  PF
Sbjct: 580 LTYQAASPDEIAIVKFTESVGLSLFKRDRHSVSLFHQHSATNFEY-DI------LQVFPF 632

Query: 478 NSKRKLMATKILNPVDNKCTVYVKGA---FERILEYSTSYLKSKGKKTEKLTEAQKATIN 534
           NS  K M   + + V  +     KGA     RI++ S  +L                  +
Sbjct: 633 NSDTKRMGIIVYDKVKGEHWFMQKGADTVMARIVQ-SNDWL------------------D 673

Query: 535 ECANSMASEGLRVFGFAKLTLSDSS-----------------------TPLTEDLIKDLT 571
           E   +MA EGLR     +  LS  S                       + + + L  +L 
Sbjct: 674 EEVGNMAREGLRTLVIGRKKLSPKSYEQFRKEYHDASLSMLNRDETMSSVIKKHLEHNLE 733

Query: 572 FTGLIGMNDPPRPNVKFAIEQLLQGGVHIIMITGDSENTA---------------VNIAK 616
             GL G+ D  + +VK +IE L   GV I M+TGD   TA               V+   
Sbjct: 734 LLGLTGVEDKLQNDVKSSIELLRNAGVKIWMLTGDKVETARCVSISAKLISRGQYVHTVT 793

Query: 617 QIGIPVIDPKLSVLSGDKLDEMS-----------------DDQLANVIDHVNIFA-RATP 658
           ++  P  +  L+ L   K+++ S                  +    V+D   + A R TP
Sbjct: 794 KLSRP--EGALNALEYLKINKSSCLLIDGESLGMFLTYYKQEFFDIVVDLPAVIACRCTP 851

Query: 659 EHKLNIVRALRK-RGDVVAMTGDGVNDAPALKLSDIGVSMGRIGTDVAKEAS 709
           + K ++   +R+  G  V   GDG ND   ++ +D+GV  G +G +  K+AS
Sbjct: 852 QQKADVALLIREITGKRVCCIGDGGNDVSMIQCADVGV--GIVGKE-GKQAS 900

>KLLA0E22352g 1984522..1988142 highly similar to sp|P39986
           Saccharomyces cerevisiae YEL031w SPF1 P-type ATPase,
           start by similarity
          Length = 1206

 Score = 82.4 bits (202), Expect = 1e-15,   Method: Compositional matrix adjust.
 Identities = 155/714 (21%), Positives = 279/714 (39%), Gaps = 135/714 (18%)

Query: 66  NRRSLYGPNEITVEDDESLFKKFLSNFIEDRMILLLIGSAV-VSLFMGNIDDAVSITLA- 123
           + + LYG N   +         FL  F E  +    I     V+L++   DD    +L  
Sbjct: 171 HHKRLYGENSFDIP-----IPTFLELFKEHAVAPFFIFQLFCVALWL--FDDLWYYSLFN 223

Query: 124 IFIVVTVGFVQEYRSEKSLEALNKL--VPAECHLMRCGQESHVLASTLVPGDLVHF-RIG 180
           +F++V +     ++   +L+    +   P   ++ R G+   +    L P DLV   R  
Sbjct: 224 LFMIVAMEATSVFQRLTTLKEFRTMGIKPYAINVFRDGKWVEMQTDKLFPMDLVSITRTA 283

Query: 181 D--RIPADIRIIEAIDLSIDESNLTGENEPVHKTSQTIEKSSFNDQPNSIVPISERSCIA 238
           +   IP D+ +I+     ++E+ L+GE+ P+ K S  +  ++   Q + +    +++ + 
Sbjct: 284 EDSAIPCDLLLIDG-SCIVNEAMLSGESTPLLKESIKLRPANDQLQLDGV----DKNAVL 338

Query: 239 YMGTLV---------------KEGHGKGIVVGTGTNTSFGAVFEMMNNIEKPKTPLQLTM 283
           + GT                  +G    +V  TG  TS G++  +M  I   +       
Sbjct: 339 HGGTKALQVTAPENRTGVITPPDGGALAVVTKTGFETSQGSLVRVM--IFSAERVDVGNK 396

Query: 284 DKLGKDLSLVSFIVIG--MICLVGIIQGRSWLEMFQISVSLAVAAIPEGLPIIVTVTLAL 341
           + L   L L+ F ++    +   G   GR   ++    + +  + +P  LP+ +T+ +  
Sbjct: 397 EALYFILFLLIFAIVASWYVWKEGTRMGRIQSKLILDCILIITSVVPPELPMELTMAVNS 456

Query: 342 GVLRMAKRKAIVRRLPSVETLGSVNVICSDKTGTLTSNHMTVSKLWCLDSMSNKLNVLSL 401
            +  ++K          +   G ++V C DKTGTLT+  +    L  L   S+       
Sbjct: 457 SLAALSKFYVYCTEPFRIPYAGRIDVCCFDKTGTLTAEDLVFEGLAGLHDGSDI------ 510

Query: 402 DKNKKTKNSNGNLKNYLTEDVRETLTIGNLCNNASFSQEHAIFLGNPTDVALLEQLANFE 461
              +  K++N   +  L+        IG    +A    +    +G+P + A L+  A+  
Sbjct: 511 ---RTLKSANDASQEVLS-------AIG--AAHALVKLDDGEIVGDPMEKATLK--ASSW 556

Query: 462 MPDIRNTVQK--------VQELPFNSKRKLMATKILNPVDNKCTVYVKGAFERILEYSTS 513
             D ++ V++        ++   F+S  K  A+  +    N+    VKGA E I E   S
Sbjct: 557 TVDFKDVVKRAGADNIRILRRFQFSSSLKRSAS--IASQSNRFFAAVKGAPETIRERLNS 614

Query: 514 YLKSKGKKTEKLTEAQKATINECANSMASEGLRVFGFAKLTLSDSSTPLTEDLIKD---- 569
                            +  ++   S    G RV   A   L   S    +++ +D    
Sbjct: 615 V---------------PSDYDDIYKSFTRSGSRVLALAYKDLPKMSNSQIDNIDRDEIET 659

Query: 570 -LTFTGLIGMNDPPRPNVKFAIEQLLQGGVHIIMITGDSENTAVNIAKQIGIPVIDPKLS 628
            LTF   +  + P + +    I+ L +     IMITGD+  TAV++AK++GI  +D +  
Sbjct: 660 GLTFGAFLVFHCPLKDDAIETIKMLNESSHRSIMITGDNPLTAVHVAKEVGI--VDRETL 717

Query: 629 VL--------------------------SGDKLDE-------------------MSDDQL 643
           +L                            D  DE                       QL
Sbjct: 718 ILDEPIDGSSHALVMRDVNETIVKPFNPDADTFDEKEIFQKYDLAVTGHALKLLQGHKQL 777

Query: 644 ANVIDHVNIFARATPEHKLNIVRALRKRGDVVAMTGDGVNDAPALKLSDIGVSM 697
            +VI H  I+AR +P  K  I+  L+  G    M GDG ND  ALK + +G+++
Sbjct: 778 RDVIRHTWIYARVSPSQKEFILITLKDMGYQTLMCGDGTNDVGALKQAHVGIAL 831

>ADL079C [1662] [Homologous to ScYIL048W (NEO1) - SH]
           (544854..548354) [3501 bp, 1166 aa]
          Length = 1166

 Score = 82.0 bits (201), Expect = 1e-15,   Method: Compositional matrix adjust.
 Identities = 163/673 (24%), Positives = 261/673 (38%), Gaps = 159/673 (23%)

Query: 167 STLVP------GDLVHFRIGDRIPADIRIIEAIDLS----IDESNLTGENE--------- 207
           S LVP      GDLV      RIPAD+ ++++ + S    +    L GE +         
Sbjct: 280 SQLVPSKNLRVGDLVKLHKDSRIPADMILLQSSEPSGETFVKTDQLDGETDWKLRVAPSL 339

Query: 208 -----------PVHKTSQTIEKS--SFNDQ---PNSIVPISERSCIAYMGTLVKEGHGKG 251
                       VH T+   EKS   F  +     S  P+S  + +     L   G    
Sbjct: 340 TQNLTQDEMLTKVHITASAPEKSIHMFTGKLTYKGSSAPLSVDNTLWANTVLASSGTCVA 399

Query: 252 IVVGTGTNTSFGAVFEMMNNIEKP-KTPL-QLTMDKLGKDLSLVSFIVIGMICLVGIIQG 309
            V+ TGT+T      + MN  +   KT L +L ++ L K L +  F +  ++ ++G +  
Sbjct: 400 CVIYTGTDTR-----QAMNTSKSSVKTGLLELEINSLSKILCICVFTLSILLVVIGGLDD 454

Query: 310 RSWLEMFQISVSLAVAAIPEGLPIIVTVTLALGVLRMAKR--------KAIVRRLPSVET 361
             W     + +   +      +P+ + V L LG    A++          IVR     E 
Sbjct: 455 DKWY----VDIMRYLILFSTIIPVSLRVNLDLGKSVYARQIESDKSIPDTIVRTSTIPED 510

Query: 362 LGSVNVICSDKTGTLTSNHMTVSKLWCLDSMSNKLNVLSLDKNK-KTKNSNGNL------ 414
           LG +  + SDKTGTLT N M + K+  L ++S  +  + +  +  +T  S  N+      
Sbjct: 511 LGRIEYLLSDKTGTLTQNDMQLRKI-HLGTVSYTMETMDMVTDYIQTLTSPANMGAAGVA 569

Query: 415 ----KNYLTEDVRETLTIGNLCNNASFS---QEHAIFLGNPTDVALL---EQLANFEMPD 464
               +  +++ VR+ +     C+N + +    E A    +P ++A++   E++       
Sbjct: 570 VTGSRKEVSQRVRDLVVTLATCHNVTPNFEDNELAYQAASPDEIAIVKFTERVGLSLFKR 629

Query: 465 IRNTVQKVQE-------------LPFNSKRKLMATKILNPVDNKCTVYVKGAFERILEYS 511
            R+++    E              PF S  K M   + +   N+     KGA        
Sbjct: 630 DRHSLTLFHEYSGVNLQYDILHVFPFTSDTKRMGIIVRDRTKNEIWFLQKGA-------- 681

Query: 512 TSYLKSKGKKTEKLTEAQKATINECANSMASEGLRVFGFAKLTLS------------DSS 559
                       K+ ++      E +N MA EGLR    A+  LS            D+S
Sbjct: 682 -------DTVMSKIVQSNDWLEEEVSN-MAREGLRTLVIARKKLSTRLYEQFSKEYKDAS 733

Query: 560 TPL-----------TEDLIKDLTFTGLIGMNDPPRPNVKFAIEQLLQGGVHIIMITGDSE 608
             +              L  +L   GL G+ D  + +VK +IE L   GV I M+TGD  
Sbjct: 734 LSMLNRDEAMNEVVKRHLEHNLELLGLTGVEDKLQKDVKTSIELLRNAGVKIWMLTGDKV 793

Query: 609 NTAVNI---AKQIG----------IPVIDPKLSVLSGDKLDEMS-----DDQLANVIDH- 649
            TA  +   AK I           +   D  LS L   K +  S      D LA  + H 
Sbjct: 794 ETARCVCVSAKLISRGQYVHTITKLTRRDGALSRLEYLKANRNSCLLIDGDSLAIYMSHY 853

Query: 650 ------------VNIFARATPEHKLNIVRALRK-RGDVVAMTGDGVNDAPALKLSDIGVS 696
                       V I  R TP+ K ++   +R+  G  V   GDG ND   ++ +D+GV 
Sbjct: 854 RAEFFEIVICLPVVIACRCTPQQKADVALLIREMTGKRVCCIGDGGNDVSMIQCADVGV- 912

Query: 697 MGRIGTDVAKEAS 709
            G +G +  K+AS
Sbjct: 913 -GIVGKE-GKQAS 923

>Scas_704.38
          Length = 1161

 Score = 80.5 bits (197), Expect = 4e-15,   Method: Compositional matrix adjust.
 Identities = 168/691 (24%), Positives = 278/691 (40%), Gaps = 168/691 (24%)

Query: 163 HVL-ASTLVP------GDLVHFRIGDRIPADIRIIEAIDLS----IDESNLTGEN----- 206
           HVL  S LVP      GDL+    GDR+PAD+ ++++ + S    I    L GE      
Sbjct: 267 HVLNQSKLVPSKDLKVGDLIKISKGDRLPADLVLLQSSEPSGETFIKTDQLDGETDWKLR 326

Query: 207 ----------EP-----VHKTSQTIEKSSFN------DQPNSIVPISERSCIAYMGTLVK 245
                     EP     V  T+   EK+  N       +  S  P+S  + +     L  
Sbjct: 327 IAPALTQNLTEPDLMNKVSITASAPEKAIHNFLGKVTYKDTSSNPLSIDNTLWANTVLAS 386

Query: 246 EGHGKGIVVGTGTNTSFGAVFEMMNNIEKP-KTPL-QLTMDKLGKDLSLVSF-IVIGMIC 302
            G   G VV TG +T      + MN      KT L +L ++ + K L    F + I ++ 
Sbjct: 387 TGFCIGCVVYTGRDTR-----QAMNTTTATVKTGLLELEINSISKILCASVFALSIILVV 441

Query: 303 LVGIIQGRSWLEMFQISVSLAVAAIPEGLPIIVTVTLALGVLRMAKR--------KAIVR 354
             G      +L++ +  +  +       +P+ + V L L     A +        + IVR
Sbjct: 442 FAGFHNSDWYLDVMRYLILFSTI-----IPVSLRVNLDLAKSVYAHQIEHDDTIPETIVR 496

Query: 355 RLPSVETLGSVNVICSDKTGTLTSNHMTVSKLW---------CLDSMSNKLNVL---SLD 402
                E LG +  + SDKTGTLT N M + K+           LD +S+ ++ L   S  
Sbjct: 497 TSTIPEDLGRIEYLLSDKTGTLTQNDMQLKKIHLGTVSYTSETLDIVSDYVDALVNSSNS 556

Query: 403 KNKKTKNSNGNLKNYLTEDVRETLTIGNLCNNAS--FSQEHAIF-LGNPTDVALLEQLAN 459
            N   K+     +  L+  VR+ +    +C+N +  F  +   +   +P ++A+++   +
Sbjct: 557 ANPSGKSVPSTSRKDLSARVRDMVVTLAICHNVTPTFEDDELTYQAASPDEIAIVKFTES 616

Query: 460 FEMPDIRN----------------TVQKVQELPFNSKRKLMATKILNPVDNKCTVYVKGA 503
             +   +                 T + +Q  PFNS  K M   + +   ++     KGA
Sbjct: 617 VGLSLFKRDRHSISLLHGHSGSILTYEILQVFPFNSDSKRMGIIVHDEQKDEYWFMQKGA 676

Query: 504 ---FERILEYSTSYLKSKGKKTEKLTEAQKATINECANSMASEGLR--VFGFAKLT---- 554
                RI+E                       + E   +MA EGLR  V G  KL+    
Sbjct: 677 DTVMARIVE-------------------NNDWLEEETGNMAREGLRTLVVGRKKLSRNIY 717

Query: 555 ------LSDSSTPL-----------TEDLIKDLTFTGLIGMNDPPRPNVKFAIEQLLQGG 597
                   D+S  +           T+ L  DL   GL G+ D  + +VK +IE L   G
Sbjct: 718 DQFKKDYDDASLSMVNRDQQMNAVITKYLEYDLELLGLTGVEDKLQNDVKSSIELLRNAG 777

Query: 598 VHIIMITGDSENTA--VNIAKQI---GIPV-IDPKLSVLSG--DKLDEMSDDQLANVI-- 647
           + I M+TGD   TA  V+I+ ++   G  V I  KL+   G  ++L+ +  ++ A ++  
Sbjct: 778 IKIWMLTGDKVETARCVSISAKLISRGQYVHIITKLTKPEGALNQLEYLKVNKGACLLID 837

Query: 648 -DHVNIF--------------------ARATPEHKLNIVRALRK-RGDVVAMTGDGVNDA 685
            + + +F                     R TP+ K ++   +R+  G  V   GDG ND 
Sbjct: 838 GESLGMFLRYYKREFFDVVICLPTVVACRCTPQQKADVALVIREFTGKRVCCIGDGGNDV 897

Query: 686 PALKLSDIGVSM-GRIGTDVAKEASDMVLTD 715
             ++ +D+GV + G+ G   A  A+D  +T+
Sbjct: 898 SMIQCADVGVGIVGKEGKQ-ASLAADFSITE 927

>AFR354C [3546] [Homologous to ScYEL031W (SPF1) - SH]
           (1078275..1081907) [3633 bp, 1210 aa]
          Length = 1210

 Score = 79.7 bits (195), Expect = 7e-15,   Method: Compositional matrix adjust.
 Identities = 166/763 (21%), Positives = 301/763 (39%), Gaps = 140/763 (18%)

Query: 16  NREREILDATAEALSKPSPSLEYCTLSVDEALEKLDTDKNGGLRSSNEANNRRSLYGPN- 74
            ++R +  A  +A S P          VDE  +     ++ GL  S +  + + LYG N 
Sbjct: 131 QKKRFLWQADLQAFSSPK-------FLVDEEPKLGKLQQSRGL--SGDLTHMKLLYGENT 181

Query: 75  -EITVEDDESLFKKFLSNFIEDRMILLLIGSAVVSLFMGNIDDAVSITL----AIFIVVT 129
            +I V     LFK+   + +E   +  +     V+L++   D    ++L     IF +  
Sbjct: 182 FDIPVPSFLELFKE---HAVEPFFVFQIF---CVALWL--FDQMWYLSLFNLFMIFAMEA 233

Query: 130 VGFVQEYRSEKSLEALNKLVPAECHLMRCGQESHVLASTLVPGDLVHFRIGDR---IPAD 186
           V   Q   + K  + +  + P   ++ R  +   +  + L+P DL+     D    +  D
Sbjct: 234 VSVFQRLTTLKEFKTMG-IKPYGINVFRDSKWQLLQTNELLPMDLISVTRTDEDSALSCD 292

Query: 187 IRIIEAIDLSIDESNLTGENEPVHKTSQTIEKSSFNDQPNSIVPISERSCIAYMGTLV-- 244
           + +++   + ++E+ L+GE+ P+ K S  +  S    Q   +    +++ + + GT V  
Sbjct: 293 MILVDGTCI-VNEAMLSGESTPLLKESVKLRSSEEKLQVEGL----DKNSVLHGGTKVLQ 347

Query: 245 --------------KEGHGKGIVVGTGTNTSFGAVFEMMNNIEKPKTPLQLTMDKLGKDL 290
                          +G    +V  TG  TS GA+  +M  I   +       + L   L
Sbjct: 348 VTAPEKGSSSIPAPPDGGALAVVSKTGFETSQGALVRVM--IYSSERVSVGNKEALYFIL 405

Query: 291 SLVSFIVIG--MICLVGIIQGRSWLEMFQISVSLAVAAIPEGLPIIVTVTLALGVLRMAK 348
            L+ F +     + + G   GR   ++    + +  + +P  LP+ +T+ +   +  ++K
Sbjct: 406 FLLIFAIAASWYVWVEGTRMGRVQSKLILDCILIITSVVPSELPMELTMAVNNSLAVLSK 465

Query: 349 RKAIVRRLPSVETLGSVNVICSDKTGTLTSNHMTVSKLWCLDSMSNKLNVL------SLD 402
                     +   G ++V C DKTGTLT   +    L  L   +  +N L       LD
Sbjct: 466 FYVYCTEPFRIPLAGRIDVCCFDKTGTLTGEDLVFEGLAGLAGKNQPVNHLFKGTEVPLD 525

Query: 403 KNKKTKNSNGNLKNYLTEDVRETLTIGNLCNNASFSQEHAIFLGNPTDVALLEQLANFEM 462
            N     ++  ++  L +D      +G+         E A        V + + L+N ++
Sbjct: 526 TNLVIGAAHALVR--LDDDE----VVGD-------PMEKATLAATGWKVGVKDSLSNEKV 572

Query: 463 PDIRNTVQKVQELPFNSKRKLMATKILNPVDNKCTVYVKGAFERILEYSTSYLKSKGKKT 522
            DI + +++ Q   F+S  K  +T  ++  + +    VKGA E I               
Sbjct: 573 GDI-SILRRFQ---FSSALKRSSTIAVH--NKQHYSAVKGAPETI--------------R 612

Query: 523 EKLTEAQKATINECANSMASEGLRVFGFAKLTLSDSSTPLTEDLIK-----DLTFTGLIG 577
           E+L++      ++   S    G RV   A   L   S    E L +     DL F G + 
Sbjct: 613 ERLSQV-PTDYDQVYKSFTRAGSRVLALASKKLPSMSIKQIEKLEREAVESDLEFKGFLV 671

Query: 578 MNDPPRPNVKFAIEQLLQGGVHIIMITGDSENTAVNIAKQIGI----------PV----- 622
            + P + +    I+ L +     IMITGD+  TAV++AK++ I          P+     
Sbjct: 672 FHCPLKDDAIETIKMLNESSHRCIMITGDNPLTAVHVAKEVAIVERETLILDEPIDGSSH 731

Query: 623 --------------IDPKLSVLSGDKLDEMSD--------------DQLANVIDHVNIFA 654
                          +P+       KL    D               QL  +I H  ++A
Sbjct: 732 ALVFRNIEETIVNPFNPEKDTFEHSKLFAKYDIAVTGHALQLLSGHSQLNELIRHTWVYA 791

Query: 655 RATPEHKLNIVRALRKRGDVVAMTGDGVNDAPALKLSDIGVSM 697
           R +P  K  I+ +L+  G    M GDG ND  ALK + +G+++
Sbjct: 792 RVSPAQKEFIMNSLKDMGYQTLMCGDGTNDVGALKQAHVGIAL 834

>CAGL0L00715g 86810..90244 highly similar to sp|P40527 Saccharomyces
           cerevisiae YIL048w NEO1 ATPase whose overproduction
           confers neomycin resistance, hypothetical start
          Length = 1144

 Score = 79.3 bits (194), Expect = 8e-15,   Method: Compositional matrix adjust.
 Identities = 150/673 (22%), Positives = 264/673 (39%), Gaps = 134/673 (19%)

Query: 159 GQESHVLASTLVPGDLVHFRIGDRIPADIRIIEAIDLS----IDESNLTGENEPVHKTSQ 214
           G+   V +  L  GDL+    G R+PAD+ ++++ + S    I    L GE +   + + 
Sbjct: 254 GRPRPVASKDLKVGDLIKISKGARVPADLILLQSSEPSGEAFIKTDQLDGETDWKLRIAC 313

Query: 215 TIEKSSFNDQPNSIVPIS----ERSCIAYMG----------------------TLVKEGH 248
           T+ ++   D     + I+    E+S  +++G                       L   G 
Sbjct: 314 TLTQNLNEDDLLEKITITASAPEKSIHSFLGRVTYKDTNTSGLTIDNTLWANTVLASSGF 373

Query: 249 GKGIVVGTGTNTSFGAVFEMMNNIE-KPKTPL-QLTMDKLGKDLSLVSFIVIGMICLVGI 306
             G V+ TG +T      + MN    K KT L +L ++ + K L    FI+  ++ +   
Sbjct: 374 CIGCVIYTGRDTR-----QAMNTTSAKVKTGLLELEINDISKILCACVFILSILLVVFAG 428

Query: 307 IQGRSWLEMFQISVSLAVAAIPEGLPIIVTVTLALGVLRMAKRKAI----VRRLPSVETL 362
           +    W       + L    IP  L + + +  ++   ++   K I    VR     E L
Sbjct: 429 LHNDDWYVDIMRYLILFSTIIPVSLRVNLDLAKSVYAHQIEHDKTIPETIVRTSTIPEDL 488

Query: 363 GSVNVICSDKTGTLTSNHMTVSKLW---------CLDSMSNKLNVLSLDKNKKTKN--SN 411
           G +  + SDKTGTLT N M + K+            D +S+ +  +   KN    N    
Sbjct: 489 GRIEYLLSDKTGTLTQNDMQLKKVHLGNVSYTTETADIVSDYIQGMIESKNDSVTNLGPR 548

Query: 412 GNLKNYLTEDVRETLTIGNLCNNAS--FSQEHAIF-LGNPTDVALL---EQLANFEMPDI 465
              +      V + +T   +C+N +  F  +   +   +P ++A++   E +        
Sbjct: 549 STTRKDAATHVIDLITTLAICHNVTPTFEDDELTYQAASPDEIAIVKFTESVGLSLFKRD 608

Query: 466 RNTVQKVQE-------------LPFNSKRKLMATKILNPVDNKCTVYVKGA---FERI-- 507
           R+++  + E              PFNS  K M   + +   ++     KGA     RI  
Sbjct: 609 RHSMSLLHEHSGTILNYDVLTMFPFNSDTKRMGIIVYDKQKDQYWFLQKGADTVMNRIVA 668

Query: 508 ----LEYSTSYLKSKG---------KKTEKLTEAQKATINECANSMASEGLRVFGFAKLT 554
               LE  T  +  +G         K T+K+ E  K    E + SM +            
Sbjct: 669 NNDWLEEETGNMAREGLRTLVIGRKKLTKKIYEQFKKEYEEVSASMYNRE---------- 718

Query: 555 LSDSSTPLTEDLIKDLTFTGLIGMNDPPRPNVKFAIEQLLQGGVHIIMITGDSENTA--- 611
             + +  +++ L  DL   GL G+ D  + +VK +IE L   G+ I M+TGD   TA   
Sbjct: 719 -QEMANTISKYLEHDLELLGLTGVEDKLQKDVKSSIELLRNAGIKIWMLTGDKVETARCV 777

Query: 612 ------------VNIAKQIGIP-----------VIDPKLSVLSGDKLD---EMSDDQLAN 645
                       V++  ++  P           V      ++ G+ L    +    +  +
Sbjct: 778 SISAKLISRGQYVHVVTKLSKPEGAFNQLEYLKVNKNACLLIDGESLGMFLKYYRQEFFD 837

Query: 646 VIDHVN--IFARATPEHKLNIVRALRK-RGDVVAMTGDGVNDAPALKLSDIGVSM-GRIG 701
           V+ H+   I  R TP+ K ++   +R+  G  V   GDG ND   ++ +D+GV + G+ G
Sbjct: 838 VVVHLPTVIACRCTPQQKADVALIIRELTGKRVCCIGDGGNDVSMIQCADVGVGIVGKEG 897

Query: 702 TDVAKEASDMVLT 714
              A  A+D  +T
Sbjct: 898 KQ-ASLAADFSIT 909

>ACR086C [1133] [Homologous to ScYDR270W (CCC2) - SH]
           (511968..514400) [2433 bp, 810 aa]
          Length = 810

 Score = 74.3 bits (181), Expect = 2e-13,   Method: Compositional matrix adjust.
 Identities = 46/167 (27%), Positives = 84/167 (50%), Gaps = 32/167 (19%)

Query: 574 GLIGMNDPPRPNVKFAIEQLLQGGVHIIMITGDSENTAVNIAKQIGIPVIDPKLSVLSGD 633
           G   ++D  R +    ++ LL  G ++ M+TGD+   A++++  +GIP+           
Sbjct: 581 GRFDLSDSLREDAYEVVQALLSRGHYVGMVTGDNHEAAMHVSHALGIPL----------- 629

Query: 634 KLDEMSDDQLANVIDHVNIFARATPEHKLNIVRALRKRGDVVAMTGDGVNDAPALKLSDI 693
                            N+F+   PE K +++R LR++ D VA  GDG+ND+ AL  SD+
Sbjct: 630 ----------------NNVFSERLPEGKCDVLRQLRQKYDYVAFIGDGINDSVALAESDL 673

Query: 694 GVSMGRIGTDVAKEASDMVLTDDD----FSTILTAIEEGKGIFNNIQ 736
           G+S+    +D+  +A+ +V+ D       + IL AI+  +  FN ++
Sbjct: 674 GISLSG-NSDIVADAAGIVVLDHSSAPPLTRILYAIDLARATFNRVK 719

 Score = 47.0 bits (110), Expect = 7e-05,   Method: Compositional matrix adjust.
 Identities = 65/287 (22%), Positives = 123/287 (42%), Gaps = 46/287 (16%)

Query: 109 LFMGNIDDAVSI---TLAIFIVVTVGFVQEYRSE-KSLEALNKLV---PAECHLMRCGQE 161
           +++G+ D   +    T+ +   + VG + E R+  ++ ++L ++V   P+ C +   G +
Sbjct: 203 VWLGSADPPSTFLDTTVMLVAFICVGKLLESRARARAADSLARMVSSAPSMCTIRESGSD 262

Query: 162 SHVLASTLVPGDLVHFRIGDRIPADIRIIEAIDLSIDESNLTGENE--PVHKTSQTIEKS 219
             V    L  GD+V  R G ++PAD  ++E  +  +DES +TGE+   P +  S+ +  S
Sbjct: 263 REVEVELLQAGDVVVMRPGTKLPADGTVLEG-EAEVDESLMTGESTLVPKYPGSRVLCGS 321

Query: 220 SFNDQPNSIVPISERSCIAYMGTLVKEGHGKGIVVGTGTNTSFGAVFEMMNNIEKPKTPL 279
                      ++  +   Y   LV            G  T    +   M   +  K P+
Sbjct: 322 -----------VNGAAGFLYRADLV------------GEETRLAGIVAAMKQAQLAKAPI 358

Query: 280 QLTMDKLGKD-------LSLVSFIVIGMICLV-----GIIQGRSWLEMF-QISVSLAVAA 326
           Q   D L          L+L++F+   +IC +      I    + L +  +I++++ V A
Sbjct: 359 QRYADFLASWFIPSVLILALLTFVCWMLICTLLATPPSIFNNSNRLYVCSRIAITVIVVA 418

Query: 327 IPEGLPIIVTVTLALGVLRMAKRKAIVRRLPSVETLGSVNVICSDKT 373
            P  L +     + +G    A+R  + +    +ET  +V  I  DKT
Sbjct: 419 CPCPLGLAAPTAIMVGTGLGAERGLLFKGGDVIETAAAVQAILFDKT 465

>Kwal_23.5789
          Length = 1133

 Score = 74.7 bits (182), Expect = 3e-13,   Method: Compositional matrix adjust.
 Identities = 182/794 (22%), Positives = 302/794 (38%), Gaps = 196/794 (24%)

Query: 68  RSLYGPNEITVED-------DESLFKKFLSNFIEDRMILLLIGSAVVSLFMGNIDDAVSI 120
           R  Y PN I+           + L+++F   F     +L+ +  A+ +L +G +   + +
Sbjct: 153 RYKYAPNAISNAKYNPVTFIPKILYEQF-KFFFNLYFLLVALSQAIPALRIGYLSSYI-V 210

Query: 121 TLAIFIVVTVGFVQEYRSEKSLEALNKLVPAECHLMRCGQESHVLA-STLVP------GD 173
            LA  + VT+          S EAL+ +           +   VL+ S LVP      GD
Sbjct: 211 PLAFVLTVTM----------SKEALDDIQRRRRDRESNNELYEVLSKSQLVPSKDLKVGD 260

Query: 174 LVHFRIGDRIPADIRIIEAIDLS----IDESNLTGENEPVHKTS----QTIEKSSFNDQP 225
           L+    G R PAD+ ++++ + S    I    L GE +   + +    Q + +     + 
Sbjct: 261 LIKIGKGARAPADLVLLQSSEPSGEIFIKTDQLDGETDWKLRIACPLTQHLSQDDLLYRI 320

Query: 226 NSIVPISERSCIAYMGTL----------------------VKEGHGKGIVVGTGTNTSFG 263
           +    + E+S   ++G L                         G     VV TG +T   
Sbjct: 321 SITASVPEKSINNFLGKLTFGEIQSQPLSVDNTMWANTVFASAGTAIACVVYTGADTRQA 380

Query: 264 AVFEMMNNIEKPKTPL-QLTMDKLGKDLSLVSFIV-IGMICLVGIIQGRSWLEMFQISVS 321
               M  ++   KT L +L ++ L K L    FI+ + ++   G      ++++ +  + 
Sbjct: 381 ----MNTSMSSVKTGLLELEINSLSKILCACVFILSVALVAFAGFNNNDWYVDIMRYLIL 436

Query: 322 LAVAAIPEGLPIIVTVTLALGVLRMAKR--------KAIVRRLPSVETLGSVNVICSDKT 373
            +       +P+ + V L LG    A +        + IVR     E LG +  + SDKT
Sbjct: 437 FSTI-----IPVSLRVNLDLGKSVYAHQIEHDSTIPETIVRTSTIPEDLGRIEYLLSDKT 491

Query: 374 GTLTSNHMTVSKL------WCLDSM----------SNKLNVLSLDKNKKTKNSNGNLKNY 417
           GTLT N M + KL      + +D+M          S+ LN  ++    K K+  G +++ 
Sbjct: 492 GTLTQNDMELKKLHLGTVSYTMDTMDIVTDYVRAMSDNLNSSAVPSASK-KDLPGRVRDL 550

Query: 418 -----LTEDVRETLTIGNLCNNASFSQEHAI-----------FLGNPTDVALLEQLA--N 459
                L   V  T   G L   A+   E AI           F  +   + LL   +  N
Sbjct: 551 VLTLALCHQVTPTFEDGELTYQAASPDEIAIVKFTESVGLTLFRRDRHSITLLHDQSGTN 610

Query: 460 FEMPDIRNTVQKVQELPFNSKRKLMATKILNPVDNKCTVYVKGA---FERILEYSTSYLK 516
           FE  DI      +   PFNS  K M   I +   ++     KGA     +I++       
Sbjct: 611 FEY-DI------LHVFPFNSDNKRMGIVIFDKQKDEYWFLQKGADVVMSKIVQ------- 656

Query: 517 SKGKKTEKLTEAQKATINECANSMASEGLRVFGFAKLTLSDS------------------ 558
               K + L E       E  N +A EGLR     +  LS                    
Sbjct: 657 ----KNDWLEE-------ETGN-LAREGLRTLVIGRKRLSKKLLQTFTKDYEDASLMMLN 704

Query: 559 -----STPLTEDLIKDLTFTGLIGMNDPPRPNVKFAIEQLLQGGVHIIMITGDSENTA-- 611
                S  +++ L  DL   GL G+ D  + +VK +IE L   G+ I M+TGD   TA  
Sbjct: 705 REVTMSNVISKHLEHDLEILGLTGVEDKLQEDVKSSIELLRNAGIKIWMLTGDKVETARC 764

Query: 612 -------------VNIAKQIGIP-----------VIDPKLSVLSGDKLD---EMSDDQLA 644
                        V+   ++  P           +      ++ G+ L    E    Q  
Sbjct: 765 VSISAKLVSRGQYVHTVTKVNKPEGALTHLELLKINTNSCLLIDGESLGLYLEYYRQQFF 824

Query: 645 NVIDHVN--IFARATPEHKLNIVRALRK-RGDVVAMTGDGVNDAPALKLSDIGVSM-GRI 700
            ++ ++   I  R TP+ K ++   +R+  G  V   GDG ND   ++ +D+GV + G+ 
Sbjct: 825 EIVVNLPAVIACRCTPQQKADVATFIREVTGKRVCCIGDGGNDVSMIQSADVGVGIVGKE 884

Query: 701 GTDVAKEASDMVLT 714
           G   A  A+D  +T
Sbjct: 885 GKQ-ASLAADFSIT 897

>KLLA0C08393g 734655..738101 highly similar to sp|P40527
           Saccharomyces cerevisiae YIL048w NEO1 ATPase whose
           overproduction confers neomycin resistance, start by
           similarity
          Length = 1148

 Score = 73.9 bits (180), Expect = 4e-13,   Method: Compositional matrix adjust.
 Identities = 138/652 (21%), Positives = 255/652 (39%), Gaps = 123/652 (18%)

Query: 172 GDLVHFRIGDRIPADIRIIEAIDLS----IDESNLTGENE-------------------- 207
           GD++  + G R+PAD+ +++  + +    I    L GE +                    
Sbjct: 276 GDIIKLKKGARVPADVVVLQTNEPNGESFIKTDQLDGETDWKLRLACSLTQSLTENDLLN 335

Query: 208 --------PVHKTSQTIEKSSFNDQPNSIVPISERSCIAYMGTLVKEGHGKGIVVGTGTN 259
                   P H     + K ++ D  +S  P+S  + +     L         +V TG  
Sbjct: 336 NITITASAPEHSIHNFLGKITYKDSTSS--PLSVDNTMWENTVLASSAACICCIVYTGRE 393

Query: 260 TSFGAVFEMMNNIE-KPKTPL-QLTMDKLGKDLSLVSFIVIGMICLVGIIQGRSWLEMFQ 317
           T      + +N  + K KT L +L ++ L K L    F++  M+          W     
Sbjct: 394 TR-----QALNTTKSKAKTGLLELEINGLSKILCACVFLLSIMLVAFAGFNNNDWYVDIM 448

Query: 318 ISVSLAVAAIPEGLPIIVTVTLALGVLRMAKRK----AIVRRLPSVETLGSVNVICSDKT 373
             + L    IP  L + + +  ++   ++   K     IVR     E LG +  + SDKT
Sbjct: 449 RYLILFSTIIPVSLRVNLDLGKSVYAYKIEHDKQIEDTIVRTSTIPEDLGRIEYLLSDKT 508

Query: 374 GTLTSNHMTVSK--LWCLDSMSNKLNVLS---LDKNKKTKNSN-GNLKNYLTEDVRETLT 427
           GTLT N M + K  L  +   +  +++++      N +T NS     +  +++ V + +T
Sbjct: 509 GTLTQNDMQLKKIHLGTVSYTNETMDIVTDFIQSMNSRTSNSTPTTTRKNISDRVIDLVT 568

Query: 428 IGNLCNNASFSQEHAIFL---GNPTDVALLEQLANFEMPDIRNTVQKVQEL--------- 475
              +C+N + + E         +P ++A+++   +  +   R     +            
Sbjct: 569 TLAICHNVTPTFEDGELTYQAASPDEIAIVKFTESVGLSLFRRDRHSISLFHDHSGMKLE 628

Query: 476 -------PFNSKRKLMATKILNPVDNKCTVYVKGA---------FERILEYSTSYLKSKG 519
                  PFNS  K M   I + +  +     KGA             LE  TS + ++G
Sbjct: 629 YDIKILFPFNSDSKRMGVIIFDKLKQEYWFLQKGADTVMSSIVVRNDWLEEETSNMATEG 688

Query: 520 KKTEKLTEAQKATINECANSMASEGLRVFGFAKLTLSDSSTPLTEDLIK----DLTFTGL 575
            +T  +   + +T      ++  +  + +  A LT+ D    +   + K    DL   GL
Sbjct: 689 LRTLVIGRKKLST------NLFEQFEKEYSEASLTMMDREVHMQNVVRKFLENDLELLGL 742

Query: 576 IGMNDPPRPNVKFAIEQLLQGGVHIIMITGDSENTA---------------VNIAKQIGI 620
            G+ D  + +VK +IE L   G+ I M+TGD   TA               V+   ++  
Sbjct: 743 TGVEDKLQKDVKSSIELLRNAGIKIWMLTGDKVETARCVSISAKLISRGQYVHTVTKVNK 802

Query: 621 P-----------VIDPKLSVLSGDKLD---EMSDDQLANVIDHVN--IFARATPEHKLNI 664
           P           V      ++ G+ L    +   D+  +++ ++   +  R TP+ K ++
Sbjct: 803 PEGALHHLEYLQVNQNSCLLIDGESLGLYLQYFPDEFFDIVVNLPTVVACRCTPQQKADV 862

Query: 665 VRALRK-RGDVVAMTGDGVNDAPALKLSDIGVSM-GRIGTDVAKEASDMVLT 714
              +R+  G  V   GDG ND   ++ +D+GV + G+ G   A  A+D  +T
Sbjct: 863 AVFIRQATGKRVCCIGDGGNDVSMIQCADVGVGIVGKEGKQ-ASLAADFSIT 913

>ADR350W [2091] [Homologous to ScYAL026C (DRS2) - SH]
           complement(1320732..1324667) [3936 bp, 1311 aa]
          Length = 1311

 Score = 72.4 bits (176), Expect = 1e-12,   Method: Compositional matrix adjust.
 Identities = 109/448 (24%), Positives = 174/448 (38%), Gaps = 96/448 (21%)

Query: 352 IVRRLPSVETLGSVNVICSDKTGTLTSNHMTVSKLWCLDSMSNKLNVLSLDKNKKTKNSN 411
           +VR    VE LG +  I SDKTGTLT N M      C  S++ +  + S+ ++K      
Sbjct: 537 VVRTSSLVEELGQIEYIFSDKTGTLTQNVMEFKS--C--SIAGRCYIQSIPEDKDAAFDE 592

Query: 412 GNLKNYLTED----------------VRETLTIGNLCNNA--SFSQEHAIFL--GNPTDV 451
           G    Y T D                + E LT+ ++C+     F +  +I     +P + 
Sbjct: 593 GIEVGYRTYDDMHELLHTPGSGDGAIIDEFLTLLSICHTVIPEFQENGSIKYQAASPDEG 652

Query: 452 ALLEQLANFEMPDI---RNTVQKVQE-------------LPFNSKRKLMATKILNPVDNK 495
           AL++  A+     I    N+V  ++E               FNS RK M+     P DN 
Sbjct: 653 ALVQGAADLGYKFIIRKPNSVTILREDITEEVVYELLNICEFNSTRKRMSAIFRFP-DNS 711

Query: 496 CTVYVKGA----FERILEYSTSYLKSKGKKTEKLTEAQKATI----NECANSMASEGLRV 547
             +  KGA     ER+   S  Y+ +  +  E        T+         S   E  ++
Sbjct: 712 IRLLCKGADTVILERLAATSNPYVAATLRHLEDYAAEGLRTLCIASRTIPESEYEEWSKL 771

Query: 548 FGFAKLTLSDSSTPL---TEDLIKDLTFTGLIGMNDPPRPNVKFAIEQLLQGGVHIIMIT 604
           +  A  T+ + S  L    E + K L   G   + D  +  V   I  L Q G+ + ++T
Sbjct: 772 YDAAATTMHNRSEELDKVAEMIEKGLVLLGATAIEDKLQDGVPETIHTLQQAGIKVWVLT 831

Query: 605 GDSENTAVNIAKQIGIPVIDPKLSVLSGD-----------KLDEMSDDQ--------LAN 645
           GD + TA+NI     +   D  L +++ D           KL  ++D Q        LA 
Sbjct: 832 GDRQETAINIGMSCKLLSEDMNLLIVNEDTKESTRNNLIDKLRAINDHQISQQDMNTLAL 891

Query: 646 VID-----------------------HVNIFARATPEHKLNIVRALRKRGDVVAMT-GDG 681
           VID                          I  R +P  K  +V+ +++R   + +  GDG
Sbjct: 892 VIDGKSLGFALEPDLEEFLLAIGKMCRAVICCRVSPLQKALVVKMVKRRTKSLLLAIGDG 951

Query: 682 VNDAPALKLSDIGVSM-GRIGTDVAKEA 708
            ND   ++ + +GV + G  G   A+ A
Sbjct: 952 ANDVSMIQAAHVGVGISGMEGMQAARSA 979

>Scas_615.9
          Length = 942

 Score = 72.0 bits (175), Expect = 2e-12,   Method: Compositional matrix adjust.
 Identities = 69/277 (24%), Positives = 117/277 (42%), Gaps = 56/277 (20%)

Query: 137 RSEKSLEALNKLVPAECHLMRCG---QESHVLAST--LVPGDLVHFRIGDRIPADIRIIE 191
           ++  SL  L +L P++C +++     Q SH+   T  L   D++  + G +IPAD  II+
Sbjct: 342 QTSSSLSKLIQLTPSKCIILQDKNNIQSSHIEIETNLLQRNDIIEIKPGMKIPADGIIIQ 401

Query: 192 AIDLSIDESNLTGENEPVHKTSQTIEKSSFNDQPNSIVPISERSCIAYMGTLVKEGHGKG 251
             +  IDES +TGE+  VHK                     ++      G+L   GH   
Sbjct: 402 G-ESEIDESLMTGESILVHK---------------------QKGSQVIAGSLNGPGHFYF 439

Query: 252 IVVGTGTNTSFGAVFEMMNNIEKPKTPLQLTMDKLGKDLSLVSFIVIGMICLVGIIQGRS 311
             +  G +T    + + M + +  K P+Q   D L       S  V  ++CL  II   +
Sbjct: 440 KAINIGDDTKLAQIIQTMKSAQLNKAPIQNNADYLA------SIFVPTILCL-SIITFIT 492

Query: 312 WLEM----------------------FQISVSLAVAAIPEGLPIIVTVTLALGVLRMAKR 349
           W+ +                      FQI++S+ V A P  L +     + +G    A+ 
Sbjct: 493 WITLSNLLTKPPVIFTNNNNGKFYTSFQIAISVIVVACPCALGLATPTAIMVGTGIGAQH 552

Query: 350 KAIVRRLPSVETLGSVNVICSDKTGTLTSNHMTVSKL 386
             +++    +E   ++  I  DKTGT+T+  MTV + 
Sbjct: 553 GVLIKGGDILERFNTITKIVFDKTGTITTGQMTVQRF 589

 Score = 70.1 bits (170), Expect = 5e-12,   Method: Compositional matrix adjust.
 Identities = 53/150 (35%), Positives = 76/150 (50%), Gaps = 33/150 (22%)

Query: 571 TFTGLIGMNDPPRPNVKFAIEQLLQGGVH--IIMITGDSENTAVNIAKQIGIPVIDPKLS 628
           T  G   + D  + +V   I Q LQG +H  I M+TGDS   A+ +A+Q+GI        
Sbjct: 693 TLVGKFEIRDSVKEDVA-DIIQYLQG-LHYDIYMVTGDSHGAAMKVAQQVGIA------- 743

Query: 629 VLSGDKLDEMSDDQLANVIDHVNIFARATPEHKLNIVRALRKRG-DVVAMTGDGVNDAPA 687
                          AN     N+++  TP  K  IV +L+      VA  GDG+ND+P 
Sbjct: 744 ---------------AN-----NVYSGVTPSGKCEIVESLQADSVGGVAFVGDGINDSPV 783

Query: 688 LKLSDIGVSMGRIGTDVAKEASDMVLTDDD 717
           L  SDIGV++   GTD+A EA+D+V+  +D
Sbjct: 784 LVTSDIGVALST-GTDIAMEAADIVVLGND 812

>Kwal_26.7070
          Length = 1315

 Score = 70.9 bits (172), Expect = 4e-12,   Method: Compositional matrix adjust.
 Identities = 158/693 (22%), Positives = 272/693 (39%), Gaps = 170/693 (24%)

Query: 172 GDLVHFRIGDRIPADIRIIEAID----LSIDESNLTGENEPVHKTSQTIEKSSFNDQ--- 224
           GD++     + IPAD+ +I + +      I+ +NL GE     K ++ IE S F D+   
Sbjct: 304 GDIIKVNSEEAIPADVIVIASSEPEGLCYIETANLDGETNLKIKQAR-IETSKFIDKDDL 362

Query: 225 -----------PNSI--------------VPISERSCIAYMGTLVKEGHGKGIVVGTGTN 259
                      PNS               + +S    +    TL       G+VV TG  
Sbjct: 363 AGMRGKVLSEHPNSSLYTYEGTMNLNGKNISLSPEQMVLRGATLRNTAWIYGLVVFTGHE 422

Query: 260 TSFGAVFEMMNNIEKPKTPLQLTMDKLGKDLSLVSF----IVIGMICLVG---------- 305
           T      ++M N     TP++ T  +   ++ +V+     IV+ +I  +G          
Sbjct: 423 T------KLMRN--ATATPIKRTAVERVINMQIVALFGVLIVLALISSIGNVIKVTSDAE 474

Query: 306 -----IIQGRSWLEMFQISVSLAVAAIPEGLPIIVTVTLALGVLRMAKRKA--------- 351
                 +QG + + +F   +          +PI + VT+ +     A   A         
Sbjct: 475 HLTYLYLQGTNKVGLFFKDILTYWILFSNLVPISLFVTVEMIKYYQAYMIASDLDLYDEA 534

Query: 352 -----IVRRLPSVETLGSVNVICSDKTGTLTSNHMTVSKLWCLDSMSNKLNVLSLDKNKK 406
                +VR    VE LG +  I SDKTGTLT N M      C  S++ K  + ++ ++K 
Sbjct: 535 SDSPTVVRTSSLVEELGQIEYIFSDKTGTLTRNVMEFKS--C--SIAGKCYIETIPEDKA 590

Query: 407 TKNSNG---------NLKNYL--TED-----VRETLTIGNLCNNA--SFSQEHAIFL--G 446
               +G         ++K  L  T+D     + + LT+   C+     F ++ +I     
Sbjct: 591 ATTEDGIEIGFRKFDSMKETLNDTQDPDSHIINDFLTLLATCHTVIPEFQEDGSIKYQAA 650

Query: 447 NPTDVALLEQLANFEMPDI---RNTV----------QKVQEL---PFNSKRKLMATKILN 490
           +P + AL+E  A+     I    N+V          Q+ Q L    FNS RK M+     
Sbjct: 651 SPDEGALVEGAASLGYKFIIRKPNSVSVLIEDLGQEQEYQLLNICEFNSTRKRMSAIFRL 710

Query: 491 PVDNKCTVYVKGA----FERILEYSTSYLKSKGKKTEKLTEAQKATI----NECANSMAS 542
           P + +  ++ KGA     ER+      Y+++  +  E        T+         S  +
Sbjct: 711 P-NGEIKLFCKGADTVILERLKAGENPYIEATLRHLEDYAAEGLRTLCLASRTVTESEYA 769

Query: 543 EGLRVFGFAKLTLSDSSTPL---TEDLIKDLTFTGLIGMNDPPRPNVKFAIEQLLQGGVH 599
           E   ++  A  TL D +  L    E + KDL   G   + D  +  V   I  L   G+ 
Sbjct: 770 EWKDIYDAASTTLDDRAQKLDDAAELIEKDLFLLGATAIEDKLQDGVPETIHTLQDAGIK 829

Query: 600 IIMITGDSENTAVNI-------AKQIGIPVIDP------------KLSVLSGDKLDEMSD 640
           + ++TGD + TAVNI       ++ + + +I+             KL  +S  ++ +   
Sbjct: 830 VWVLTGDRQETAVNIGMSCRLLSEDMNLLIINEEDKEATRKNLTEKLKAISDHQISQQDM 889

Query: 641 DQLANVIDHVNI-FA----------------------RATPEHKLNIVRALRKRGDVVAM 677
           + LA VID  ++ FA                      R +P  K  +V+ ++++ D + +
Sbjct: 890 NSLALVIDGKSLGFALEADLEDYLLAIGKLCKAVICCRVSPLQKALVVKMVKRKTDSLLL 949

Query: 678 T-GDGVNDAPALKLSDIGVSM-GRIGTDVAKEA 708
             GDG ND   ++ + +GV + G  G   A+ A
Sbjct: 950 AIGDGANDVSMIQAAHVGVGISGMEGMQAARSA 982

>YDR270W (CCC2) [1102] chr4 (1005667..1008681) Copper-transporting
           P-type ATPase, member of the heavy-metal transporting
           P-type ATPases in the superfamily of P-type ATPases
           [3015 bp, 1004 aa]
          Length = 1004

 Score = 70.5 bits (171), Expect = 5e-12,   Method: Compositional matrix adjust.
 Identities = 44/150 (29%), Positives = 79/150 (52%), Gaps = 31/150 (20%)

Query: 574 GLIGMNDPPRPNVKFAIEQLLQGGVHIIMITGDSENTAVNIAKQIGIPVIDPKLSVLSGD 633
           GL  +ND  + +    ++ L + G    MITGD+ + A  +A+++GI             
Sbjct: 757 GLFEINDEVKHDSYATVQYLQRNGYETYMITGDNNSAAKRVAREVGI------------- 803

Query: 634 KLDEMSDDQLANVIDHVNIFARATPEHKLNIVRALRKR--GDVVAMTGDGVNDAPALKLS 691
                            N+++  +P  K ++V+ ++ +   + VA+ GDG+NDAPAL LS
Sbjct: 804 --------------SFENVYSDVSPTGKCDLVKKIQDKEGNNKVAVVGDGINDAPALALS 849

Query: 692 DIGVSMGRIGTDVAKEASDMV-LTDDDFST 720
           D+G+++   GT++A EA+D+V L  +D +T
Sbjct: 850 DLGIAIST-GTEIAIEAADIVILCGNDLNT 878

 Score = 49.3 bits (116), Expect = 1e-05,   Method: Compositional matrix adjust.
 Identities = 60/269 (22%), Positives = 105/269 (39%), Gaps = 41/269 (15%)

Query: 137 RSEKSLEALNKLVPAECHLM---RCGQESHVLASTLVPGDLVHFRIGDRIPADIRIIEAI 193
           ++  +L  L +L P+ C ++      +   +    L   D+V  + G +IPAD  II   
Sbjct: 396 QTSTALSKLIQLTPSVCSIISDVERNETKEIPIELLQVNDIVEIKPGMKIPAD-GIITRG 454

Query: 194 DLSIDESNLTGENEPVHKTSQTIEKSSFNDQPNSIVPISERSCIAYMGTLVKEGHGKGIV 253
           +  IDES +TGE+  V K      K+ F        P+         G++   GH     
Sbjct: 455 ESEIDESLMTGESILVPK------KTGF--------PV-------IAGSVNGPGHFYFRT 493

Query: 254 VGTGTNTSFGAVFEMMNNIEKPKTPLQLTMDKLGKD-------LSLVSFIVIGMI----- 301
              G  T    + ++M   +  K P+Q   D L          L++++F +   I     
Sbjct: 494 TTVGEETKLANIIKVMKEAQLSKAPIQGYADYLASIFVPGILILAVLTFFIWCFILNISA 553

Query: 302 ----CLVGIIQGRSWLEMFQISVSLAVAAIPEGLPIIVTVTLALGVLRMAKRKAIVRRLP 357
                     +  ++    Q + S+ + A P  L +     + +G    A+   +++   
Sbjct: 554 NPPVAFTANTKADNFFICLQTATSVVIVACPCALGLATPTAIMVGTGVGAQNGVLIKGGE 613

Query: 358 SVETLGSVNVICSDKTGTLTSNHMTVSKL 386
            +E   S+     DKTGTLT+  M V K 
Sbjct: 614 VLEKFNSITTFVFDKTGTLTTGFMVVKKF 642

>CAGL0M08602g complement(856349..859387) similar to sp|P38995
           Saccharomyces cerevisiae YDR270w CCC2, start by
           similarity
          Length = 1012

 Score = 67.8 bits (164), Expect = 3e-11,   Method: Compositional matrix adjust.
 Identities = 41/137 (29%), Positives = 68/137 (49%), Gaps = 28/137 (20%)

Query: 580 DPPRPNVKFAIEQLLQGGVHIIMITGDSENTAVNIAKQIGIPVIDPKLSVLSGDKLDEMS 639
           D  + + K  I  L      + M+TGD+  +A+ +A+ + IP   P              
Sbjct: 763 DEVKSDAKDVIRYLRNNNYEVFMVTGDTHKSAMKVAEMVDIP---PN------------- 806

Query: 640 DDQLANVIDHVNIFARATPEHKLNIVRALRKRGDVVAMTGDGVNDAPALKLSDIGVSMGR 699
                      N+++  TP+ K   V  LR+ G V+A  GDG+ND+ AL  SD+G+++  
Sbjct: 807 -----------NVYSEVTPDGKSQTVEYLREEGRVIAFIGDGINDSLALVTSDLGIAISS 855

Query: 700 IGTDVAKEASDMVLTDD 716
            GT+VA EA+ +V+ +D
Sbjct: 856 -GTEVAIEAAGIVILND 871

 Score = 59.3 bits (142), Expect = 1e-08,   Method: Compositional matrix adjust.
 Identities = 68/296 (22%), Positives = 123/296 (41%), Gaps = 58/296 (19%)

Query: 121 TLAIFIVVTVG-FVQEYRSEKSLEALNKLV---PAECHLMRCGQES---HVLASTLVPGD 173
           ++ I   +++G +++     K+  AL+KL+   P+ C ++    +S    +    L  GD
Sbjct: 377 SVMIVAYISIGKYLENKAKSKTSTALSKLISLTPSSCIIVDKDDDSITQEIGIELLEVGD 436

Query: 174 LVHFRIGDRIPADIRIIEAIDLSIDESNLTGENEPVHKTSQTIEKSSFNDQPNSIVPISE 233
           +   + G +IP+D  + + I   +DES +TGE   V K                      
Sbjct: 437 IAMVKPGAKIPSDGIVTKGIS-EVDESLMTGETNLVVKE--------------------- 474

Query: 234 RSCIAYMGTLVKEG--HGKGI----VVGTGTNTSFGAVFEMMNNIEKPKTPLQLTMDKLG 287
                 +G++V  G  +G G+    V   G +T    + ++M N +  K  +Q   D + 
Sbjct: 475 ------IGSVVTGGTINGSGLIYFEVTSVGDDTKLANIIKVMKNAQLKKASIQRYTDYVA 528

Query: 288 KD-------LSLVSFIV----------IGMICLVGIIQGRSWLEMFQISVSLAVAAIPEG 330
                    LSL++FIV          I  + + G      +    QI+ S+ + A P  
Sbjct: 529 SIFVPTVLILSLLTFIVWTSLTRSEKIISKLSIFGETSESRFYMCLQIATSVVIVACPCA 588

Query: 331 LPIIVTVTLALGVLRMAKRKAIVRRLPSVETLGSVNVICSDKTGTLTSNHMTVSKL 386
           L +     + +G    ++   +++    +E    VN    DKTGTLT+ HMTV + 
Sbjct: 589 LGLATPTAIMVGTGVASENGVLIKGGDVLEKFNEVNTFVFDKTGTLTTGHMTVQQF 644

>KLLA0A04015g complement(355624..359655) similar to sp|P39524
           Saccharomyces cerevisiae YAL026c DRS2 P-type
           amino-phospholipids-ATPase, start by similarity
          Length = 1343

 Score = 67.4 bits (163), Expect = 5e-11,   Method: Compositional matrix adjust.
 Identities = 107/451 (23%), Positives = 182/451 (40%), Gaps = 103/451 (22%)

Query: 352 IVRRLPSVETLGSVNVICSDKTGTLTSNHMTVSKLWCLDSMSNKLNVLSLDKNKKTKNSN 411
           +VR    VE LG +  I SDKTGTLT N M    +    S++ +  + ++ ++++    +
Sbjct: 545 VVRTSSLVEELGQIEYIFSDKTGTLTRNVMEFKSV----SIAGRCYIETIPEDRRATVED 600

Query: 412 G---------NLKNYLT--ED-----VRETLTIGNLCN--------NASFSQEHAIFLGN 447
           G         +LK+ +T  ED     V E LT+   C+        + +   + A    +
Sbjct: 601 GIEIGFHSFESLKDKMTDPEDDEAGIVIEFLTLLATCHTVIPETQSDGTIKYQAA----S 656

Query: 448 PTDVALLEQLANFEMP-DIR--NTV------------QKVQELPFNSKRKLMATKILNPV 492
           P + AL++  A+     DIR  N+V            Q +    FNS RK M+     P 
Sbjct: 657 PDEGALVQGAADLGFRFDIRRPNSVSISTPFSEQLEYQLLNICEFNSTRKRMSAIFRMP- 715

Query: 493 DNKCTVYVKGAFERILEYSTS----YLKSKGKKTEKLTEAQKATINECANSMAS----EG 544
           D    ++ KGA   ILE   S    Y++S  +  E        T+   + ++      E 
Sbjct: 716 DGSIKLFCKGADTVILERLDSEFNPYVQSTLRHLEDYAAEGLRTLCIASRTIPEKEYEEW 775

Query: 545 LRVFGFAKLTLSDSSTPL---TEDLIKDLTFTGLIGMNDPPRPNVKFAIEQLLQGGVHII 601
            +++  A  T+ D +  L    E +  DL F G   + D  +  V   I  L + G+ + 
Sbjct: 776 SKIYEAASTTMKDRTEELDRAAELIEHDLFFLGATAIEDKLQEGVPETIHHLQEAGLKVW 835

Query: 602 MITGDSENTAVNIA-------------------KQIGIPVIDPKLSVLSGDKLDEMSDDQ 642
           ++TGD + TA+NI                    K+     +  KL+ +   ++ +   + 
Sbjct: 836 VLTGDRQETAINIGMSCRLLSEDMNLLIVNEETKEDTRTNLQSKLNAIESHQISQQDMNS 895

Query: 643 LANVIDHVN-----------------------IFARATPEHKLNIVRAL-RKRGDVVAMT 678
           LA VID  +                       I  R +P  K  +V+ + RK   ++   
Sbjct: 896 LALVIDGKSLGYALEEDLEDQFLTIGKLCKAVICCRVSPLQKALVVKMVKRKTSSLLLAI 955

Query: 679 GDGVNDAPALKLSDIGVSM-GRIGTDVAKEA 708
           GDG ND   ++ + +GV + G  G   A+ A
Sbjct: 956 GDGANDVSMIQAAHVGVGISGMEGMQAARSA 986

>Kwal_55.21575
          Length = 989

 Score = 63.9 bits (154), Expect = 5e-10,   Method: Compositional matrix adjust.
 Identities = 66/267 (24%), Positives = 107/267 (40%), Gaps = 42/267 (15%)

Query: 137 RSEKSLEALNKLVPAECHLMRCGQESHVLASTLVPGDLVHFRIGDRIPADIRIIEAIDLS 196
           ++  SL  L  L P+ C ++  G+   +    L  GD V  + G +IP D  IIE  +  
Sbjct: 395 KTNNSLSKLMSLAPSTCTIIENGKAREIPVEFLQVGDTVEIKPGAKIPTDGVIIEG-ESE 453

Query: 197 IDESNLTGEN--EPVHKTSQTIEKSSFNDQPNSIVPISERSCIAYMGTLVKEGHGKGIVV 254
           +DES +TGE+   P +K    I  S   + PN  +  +                      
Sbjct: 454 VDESLITGESLMVPRYKGFPVIAGSI--NGPNRFLLTA---------------------T 490

Query: 255 GTGTNTSFGAVFEMMNNIEKPKTPLQLTMDKLGKDLSLVSFIVIGMICLV-GIIQGR--- 310
             G +T    + + M   +  K P+Q   D L     + S +V+ MI  V   I  R   
Sbjct: 491 SVGDDTKLAQIIQTMKQAQLSKAPIQHYADYLASKF-VPSVLVLAMITFVTWTILSRVLS 549

Query: 311 -----------SWLEMFQISVSLAVAAIPEGLPIIVTVTLALGVLRMAKRKAIVRRLPSV 359
                       +    ++++S+ V A P  L +     + +G    AK   +++    +
Sbjct: 550 NPPSIFDSPNGKFFICLEMTISVIVVACPCALGLAAPTAIMVGTGLGAKHGVLIKGGDIL 609

Query: 360 ETLGSVNVICSDKTGTLTSNHMTVSKL 386
           E   S+     DKTGTLT+ HMTV + 
Sbjct: 610 EKCSSLETFLFDKTGTLTTGHMTVEQF 636

 Score = 63.2 bits (152), Expect = 8e-10,   Method: Compositional matrix adjust.
 Identities = 43/143 (30%), Positives = 73/143 (51%), Gaps = 29/143 (20%)

Query: 572 FTGLIGMNDPPRPNVKFAIEQLLQGGVHIIMITGDSENTAVNIAKQIGIPVIDPKLSVLS 631
             G   ++D  + +    ++ L + G  + M+TGD+  +A+ +A ++GI           
Sbjct: 739 LVGRFEISDFIKKDAAEVVQYLTEKGHRVCMVTGDNHKSAMKVALELGIE---------- 788

Query: 632 GDKLDEMSDDQLANVIDHVNIFARATPEHKLNIVRALRKRGDV-VAMTGDGVNDAPALKL 690
                       AN     N+++  TP  K  +V+ L+  G   VA  GDG+ND+PAL  
Sbjct: 789 ------------AN-----NVYSELTPADKNQLVQDLQDGGRKNVAFIGDGINDSPALVT 831

Query: 691 SDIGVSMGRIGTDVAKEASDMVL 713
           SD+GVS+   GTD+A EA+D+++
Sbjct: 832 SDLGVSIST-GTDIAMEAADVII 853

>KLLA0D04092g complement(344666..348124) some similarities with
            sp|P38995 Saccharomyces cerevisiae YDR270w CCC2 probable
            copper-transporting ATPase P16.2.f2.1, hypothetical start
          Length = 1152

 Score = 63.5 bits (153), Expect = 6e-10,   Method: Compositional matrix adjust.
 Identities = 45/141 (31%), Positives = 73/141 (51%), Gaps = 27/141 (19%)

Query: 575  LIGMNDPPRPNVKFAIEQLLQGGVHIIMITGDSENTAVNIAKQIGIPVIDPKLSVLSGDK 634
            +    D  RP  K  I++L + G+   MI+GD+E TA  +A+++ I  +  ++       
Sbjct: 924  MCAAKDEIRPEAKDVIKELRRSGIECWMISGDNEVTARAVAQELDIDNVIAEV------- 976

Query: 635  LDEMSDDQLANV--IDHVNIFARATPEHKLNIVRALRKRGDVVAMTGDGVNDAPALKLSD 692
               + +++ A V  I H NI A     HK            VVAM GDG+NDAPAL  +D
Sbjct: 977  ---LPEEKAAKVKWIQHNNIGANG--HHK------------VVAMVGDGINDAPALAAAD 1019

Query: 693  IGVSMGRIGTDVAKEASDMVL 713
            +G+++   G+++A  + D VL
Sbjct: 1020 VGIALAS-GSELAMTSCDFVL 1039

>AGL041C [4270] [Homologous to ScYDR270W - NSH] (628428..632129) [3702
            bp, 1233 aa]
          Length = 1233

 Score = 63.2 bits (152), Expect = 9e-10,   Method: Compositional matrix adjust.
 Identities = 45/173 (26%), Positives = 82/173 (47%), Gaps = 36/173 (20%)

Query: 573  TGLIGMNDPPRPNVKFAIEQLLQGGVHIIMITGDSENTAVNIAKQIGIPVIDPKLSVLSG 632
            T  + + D  RP  K  ++ L + G+   MI+GD+   A  +A ++GI            
Sbjct: 1011 TLFLAVRDELRPEAKEVVQALHERGIECWMISGDNSLAANAVALEVGIK----------- 1059

Query: 633  DKLDEMSDDQLANVIDHVNIFARATPEHKLNIVRALRK---RGDVVAMTGDGVNDAPALK 689
                              ++ A   PE K   ++ +R+   +G  +AM GDG+NDAPA+ 
Sbjct: 1060 ------------------HVIADVLPEGKAEKIQWIRETSGQGVAIAMVGDGMNDAPAIA 1101

Query: 690  LSDIGVSMGRIGTDVAKEASDMVL--TDDDFSTILTAIEEGKGIFNNIQ-NFL 739
             +D+G+S+   G+D+A  + D VL    +  + I+  ++  K +F  ++ NF+
Sbjct: 1102 AADVGISLAS-GSDLAMISCDFVLLSKKNPLTGIVVLLQLSKKVFRRVKFNFV 1153

 Score = 42.0 bits (97), Expect = 0.003,   Method: Compositional matrix adjust.
 Identities = 66/275 (24%), Positives = 116/275 (42%), Gaps = 23/275 (8%)

Query: 115 DDAVSITLAIFIVVTVGFVQEYRSEKSLEALNKLVPAECHLMRC------GQESHVLAST 168
           D  V +TL + I   +  + + +  K+LE+L  L      LM+        +E+ V A  
Sbjct: 604 DSVVFLTLFLLIGRLLESLSKSKMVKTLESLTSLKQRTGILMQADGARDFKKETSVSAEM 663

Query: 169 LVPGDLVHFRIGDRIPADIRIIEAIDLSIDESNLTGENEPV-HKTSQTIEKSSFN-DQPN 226
           L  GD +  + G     D  I++  +   DES+LTGE+ P+ H     I   + N  Q  
Sbjct: 664 LELGDHILIKPGASPAVDALIVQG-ETEFDESSLTGESRPITHFPGDQIFAGTVNVGQCA 722

Query: 227 SIVPISE---RSCIAYMGTLVKEGHGKGIVVGTGTNTSFGAVFEMMNNIEKPKTPLQLTM 283
            I  +S     S + ++ + V++G  +G  +    +   G     +  +      + L +
Sbjct: 723 VIAKVSTAPGNSLLDHVISAVRDGQLRGAPIERIADVLTGYFVPFIVLLAILTWAIWLIL 782

Query: 284 DKLGKDLSLVSFIVIGMICLVGIIQGRSWLEMFQISVSLAVAAIPEGLPIIVTVTLALGV 343
              G         V+    L G + G  +  + + ++++ V A P G+ +     L +G 
Sbjct: 783 GFAG---------VLSQEKLDGSVGGWPFWSL-EFAIAVFVIACPCGIGLAAPTALFVGA 832

Query: 344 LRMAKRKAIVRRLPSVETLGS-VNVICSDKTGTLT 377
              AK   + R   +   +GS V  +C DKTGTLT
Sbjct: 833 NIAAKYGILARGGSAAFQMGSKVTTVCFDKTGTLT 867

>CAGL0G06270g 598357..602343 highly similar to sp|P39524
           Saccharomyces cerevisiae YAL026c DRS2, start by
           similarity
          Length = 1328

 Score = 62.8 bits (151), Expect = 1e-09,   Method: Compositional matrix adjust.
 Identities = 160/706 (22%), Positives = 262/706 (37%), Gaps = 198/706 (28%)

Query: 172 GDLVHFRIGDRIPADIRIIEAID----LSIDESNLTGENEPVHKTSQT------------ 215
           GD++     + IPADI I+ + +      I+ +NL GE     K ++T            
Sbjct: 288 GDIIRVNSEEPIPADIIILSSSEPEGLCYIETANLDGETNLKIKQARTETAKIMDSRELR 347

Query: 216 -IEKSSFNDQPNSI--------------VPISERSCIAYMGTLVKEGHGKGIVVGTGTNT 260
            I+    ++QPNS               +P+S    I    TL   G   GIV+ TG  T
Sbjct: 348 NIKGVISSEQPNSSLYTYEGTLEMNGTKIPLSPEQMILRGATLRNTGWIFGIVIFTGHET 407

Query: 261 SFGAVFEMMNNIEKPKTPLQLTMDKLGKDLSLVSF----IVIGMICLVG----------- 305
                 ++M N     TP++ T  +   ++ +++     +V+ +I  +G           
Sbjct: 408 ------KLMRN--ATATPIKRTAVEKVINMQIIALFTVLVVLILISSIGNVIMSTADAKH 459

Query: 306 ----IIQGRS------------WL---EMFQISVSLAVAAIPEGLPIIVTVTLALGVLRM 346
                +QG +            W+    +  IS+ + V  I      ++   L L     
Sbjct: 460 LSYLYLQGTNKAGLFFKDFLTFWILFSNLVPISLFVTVELIKYYQAFMIGSDLDL-YYEE 518

Query: 347 AKRKAIVRRLPSVETLGSVNVICSDKTGTLTSNHMTVSKLWCLDSMSNKLNVLSLDKNKK 406
                +V+    VE LG +  I SDKTGTLT N M      C  S++ +     + ++K 
Sbjct: 519 TDTPTVVKTSSLVEELGQIEYIFSDKTGTLTRNIMEFKS--C--SIAGRCYAEHIPEDKA 574

Query: 407 TKNSNG---------NLKNYLTED------VRETLTIGNLCNNA--SFSQEHAIFL--GN 447
               +G         +LK  LT +      + E LT+   C+     F  + +I     +
Sbjct: 575 ATFEDGIEVGYRSFDDLKKQLTTNSDDCKIIDEFLTLLATCHTVIPEFQADGSIKYQAAS 634

Query: 448 PTDVALLE--QLANFEM----PD-----IRNTVQKVQEL----PFNSKRKLMATKILNPV 492
           P + AL+E   L  ++     P+     I    ++  +L     FNS RK M+     P 
Sbjct: 635 PDEGALVEGGALLGYKFLIRKPNSVTILINEEEEREYQLLNICEFNSTRKRMSAIFRFP- 693

Query: 493 DNKCTVYVKGA----FERILEYSTSYLKSKGKKTEKLTEAQKATINECANSMASEGLRVF 548
           D+   +  KGA     ER+ E    Y+ +  +  E                 A+EGLR  
Sbjct: 694 DDSIKLLCKGADSVILERLSETGNFYVDATTRHLE---------------DYATEGLRTL 738

Query: 549 GFAKLTLS------------DSSTPL----------TEDLIKDLTFTGLIGMNDPPRPNV 586
             A   +             D++T L           E++   LT  G   + D  +  V
Sbjct: 739 CLATKDIPEDEYNAWNKKYMDAATTLDHRAEKLDAVAEEIESGLTLIGATAIEDKLQEGV 798

Query: 587 KFAIEQLLQGGVHIIMITGDSENTAVNIA-------------------KQIGIPVIDPKL 627
              I  L + G+ I ++TGD + TA+NI                    K+     ++ KL
Sbjct: 799 PDTIRTLQEAGIKIWVLTGDKQETAINIGMSCRLLSEDMNLLIISEETKEATRRNMEEKL 858

Query: 628 SVLSGDKLDEMSDDQLANVID-HVNIFA----------------------RATPEHKLNI 664
           + L    L E   + LA VID H   FA                      R +P  K  +
Sbjct: 859 AALHEHSLSEHDMNTLALVIDGHSLSFALEADLEDYFLAIGKMCKAVICCRVSPLQKALV 918

Query: 665 VRAL-RKRGDVVAMTGDGVNDAPALKLSDIGVSM-GRIGTDVAKEA 708
           V+ + RK   ++   GDG ND   ++ + +GV + G  G   A+ A
Sbjct: 919 VKMVKRKTNSLLLAIGDGANDVSMIQAAHVGVGISGMEGMQAARSA 964

>YAL026C (DRS2) [42] chr1 complement(95633..99700) Membrane-spanning
           Ca-ATPase (P-type) required for ribosome assembly and
           involved in late Golgi function, member of the cation
           transporting (E1-E2) P-type ATPase superfamily [4068 bp,
           1355 aa]
          Length = 1355

 Score = 57.0 bits (136), Expect = 7e-08,   Method: Compositional matrix adjust.
 Identities = 88/359 (24%), Positives = 148/359 (41%), Gaps = 60/359 (16%)

Query: 352 IVRRLPSVETLGSVNVICSDKTGTLTSNHMTVSKLWCLDSMSNKLNVLSLDKNKKTKNSN 411
           +VR    VE LG +  I SDKTGTLT N M      C  S++    +  + ++K     +
Sbjct: 541 VVRTSSLVEELGQIEYIFSDKTGTLTRNIMEFKS--C--SIAGHCYIDKIPEDKTATVED 596

Query: 412 G---------NLKNYLT----ED---VRETLTIGNLCNNA--SFSQEHAIFL--GNPTDV 451
           G         +LK  L     ED   + + LT+   C+     F  + +I     +P + 
Sbjct: 597 GIEVGYRKFDDLKKKLNDPSDEDSPIINDFLTLLATCHTVIPEFQSDGSIKYQAASPDEG 656

Query: 452 ALLEQLANFEMPDI----------------RNTVQKVQELPFNSKRKLMATKILNPVDNK 495
           AL++  A+     I                    Q +    FNS RK M+     P D  
Sbjct: 657 ALVQGGADLGYKFIIRKGNSVTVLLEETGEEKEYQLLNICEFNSTRKRMSAIFRFP-DGS 715

Query: 496 CTVYVKGA----FERILEYSTSYLKSKGKKTEKLTEAQKATI----NECANSMASEGLRV 547
             ++ KGA     ER+ + +  Y+++  +  E        T+     + +     E   +
Sbjct: 716 IKLFCKGADTVILERLDDEANQYVEATMRHLEDYASEGLRTLCLAMRDISEGEYEEWNSI 775

Query: 548 FGFAKLTLSDSSTPLTE--DLI-KDLTFTGLIGMNDPPRPNVKFAIEQLLQGGVHIIMIT 604
           +  A  TL + +  L E  +LI K+L   G   + D  +  V   I  L + G+ I ++T
Sbjct: 776 YNEAATTLDNRAEKLDEAANLIEKNLILIGATAIEDKLQDGVPETIHTLQEAGIKIWVLT 835

Query: 605 GDSENTAVNIAKQIGIPVIDPKLSVLSGDKLDEMSDDQLANVIDHVNIFARATPEHKLN 663
           GD + TA+NI     +   D  L +++    +E  DD   N+++ +N    A  EH+L+
Sbjct: 836 GDRQETAINIGMSCRLLSEDMNLLIIN----EETRDDTERNLLEKIN----ALNEHQLS 886

>YBR295W (PCA1) [472] chr2 (792805..796455) P-type copper-transporting
            ATPase, involved in resistance to cadmium [3651 bp, 1216
            aa]
          Length = 1216

 Score = 54.7 bits (130), Expect = 3e-07,   Method: Compositional matrix adjust.
 Identities = 62/251 (24%), Positives = 102/251 (40%), Gaps = 56/251 (22%)

Query: 513  SYLKSKGKKTEKLTEAQKATINECANSMASEGLRVFGFAKLTLSDSSTPLTEDLIKDL-- 570
            SYLK KG   + ++   KA   +     +  GL++ G     L  ++ P   D+ K L  
Sbjct: 948  SYLKEKGVSAQNVSNT-KAVTGKRVEGTSYSGLKLQGGNCRWLGHNNDP---DVRKALEQ 1003

Query: 571  -----------TFTGLIGMNDPPRPNVKFAIEQLLQGGVHIIMITGDSENTAVNIAKQIG 619
                       + T +  + D  R +    I  L Q G+ + +++GD +    ++A ++G
Sbjct: 1004 GYSVFCFSVNGSVTAVYALEDSLRADAVSTINLLRQRGISLHILSGDDDGAVRSMAARLG 1063

Query: 620  IPVIDPKLSVLSGDKLDEMSDDQLANVIDHVNIFARATPEHKLNIVRAL----------R 669
                                       I+  NI + ATP  K   ++ +          +
Sbjct: 1064 ---------------------------IESSNIRSHATPAEKSEYIKDIVEGRNCDSSSQ 1096

Query: 670  KRGDVVAMTGDGVNDAPALKLSDIGVSMGRIGTDVAKEASDMVLTDDDFSTILTAIE-EG 728
             +  VV   GDG NDA  L  + IGV +   G++VAK A+D+V+     + ILT I    
Sbjct: 1097 SKRPVVVFCGDGTNDAIGLTQATIGVHINE-GSEVAKLAADVVMLKPKLNNILTMITVSQ 1155

Query: 729  KGIFNNIQNFL 739
            K +F    NFL
Sbjct: 1156 KAMFRVKLNFL 1166

 Score = 47.4 bits (111), Expect = 5e-05,   Method: Compositional matrix adjust.
 Identities = 68/281 (24%), Positives = 122/281 (43%), Gaps = 46/281 (16%)

Query: 121 TLAIFIVVTVGFVQE---YRSEKSLEALNKLVPAECHLMRCGQESHVLASTLVPGDLVHF 177
           +L + +++   FV E   +R+ KS+   +    +   + + G+E+ +    L  GD+   
Sbjct: 663 SLLVTLIMVGRFVSELARHRAVKSISVRSLQASSAILVDKTGKETEINIRLLQYGDIFKV 722

Query: 178 RIGDRIPADIRIIEAIDLSIDESNLTGENEPVHKTSQTI-EKSSFNDQPNSIVPISE--- 233
               RIP D  +I      +DE+ +TGE+ PV K  Q+I    S N      V +S+   
Sbjct: 723 LPDSRIPTDGTVISG-SSEVDEALITGESMPVPKKCQSIVVAGSVNGTGTLFVKLSKLPG 781

Query: 234 RSCIAYMGTLVKEGHGKGIVVGTGTNTSFGAVFEMMNNIEKPKTPLQLTMDKLGK----- 288
            + I+ + T+V E                         + KPK  +Q   DK+       
Sbjct: 782 NNTISTIATMVDEA-----------------------KLTKPK--IQNIADKIASYFVPT 816

Query: 289 --DLSLVSFIVIGMICLVGIIQGRS--WLEMFQISVSLAVAAIPE--GLPIIVTVTLALG 342
              +++V+F V   + +    Q RS   ++    ++++ + + P   GL + +   +A G
Sbjct: 817 IIGITVVTFCVWIAVGIRVEKQSRSDAVIQAIIYAITVLIVSCPCVIGLAVPIVFVIASG 876

Query: 343 VLRMAKRKAIVRRLPSVETLGSVNVICSDKTGTLTSNHMTV 383
           V   AKR  I +   S+E   + + +  DKTGTLT   +TV
Sbjct: 877 V--AAKRGVIFKSAESIEVAHNTSHVVFDKTGTLTEGKLTV 915

>KLLA0E01650g complement(155975..160627) similar to sp|Q12674
            Saccharomyces cerevisiae YMR162c, start by similarity
          Length = 1550

 Score = 50.4 bits (119), Expect = 6e-06,   Method: Compositional matrix adjust.
 Identities = 51/201 (25%), Positives = 84/201 (41%), Gaps = 43/201 (21%)

Query: 551  AKLTLSDSSTPLTE---DLIKDLTFTGLIGMNDPPRPNVKFAIEQLLQGGVHIIMITGDS 607
            AK +L++ ST + E    +  DL   G   + D  +  V  AI+++ + G+ + M+TGD 
Sbjct: 977  AKTSLTNRSTQIAEVGGHIETDLELLGATAIEDKLQEGVPEAIQKIRRAGIKMWMLTGDK 1036

Query: 608  ENTAVNIAKQIGIPVIDPKLSVLS-------------GDKLDEMSDDQLANVIDHVN--- 651
              TA+NI     +      + +L              G++LD         VID  +   
Sbjct: 1037 RETAINIGYACKLIYDYSTVVILKKNDDNLISKMTALGEELDTGKIAHCVLVIDGASLAV 1096

Query: 652  ---------------------IFARATPEHKLNIVRALR-KRGDVVAMT-GDGVNDAPAL 688
                                 I  RA+P  K  IV  +R K  D+V +  GDG ND   +
Sbjct: 1097 FENNPTMMSVFIELCTKTDSVICCRASPSQKALIVTNIRLKNKDLVTLAIGDGANDIAMI 1156

Query: 689  KLSDIGVSM-GRIGTDVAKEA 708
            + +DIGV + G+ G   ++ +
Sbjct: 1157 QSADIGVGITGKEGLQASRSS 1177

 Score = 35.8 bits (81), Expect = 0.21,   Method: Compositional matrix adjust.
 Identities = 66/279 (23%), Positives = 103/279 (36%), Gaps = 72/279 (25%)

Query: 172 GDLVHFRIGDRIPADIRII-------EAI--DLSID-ESNLTGENE-------------- 207
           G+ V     D +PADI ++       EA    +++D E+NL  +N               
Sbjct: 280 GEFVLLNSDDWVPADILLLSTDGENNEAFVETMALDGETNLKSKNPLPELAKRMTSATGL 339

Query: 208 PVHKTSQTIEKSSFNDQPN---------SIVPISERSCIAYMGTLVKEGHG-KGIVVGTG 257
            +H  + T+E  + ND  N          + P+   + + Y G++++      GIV+ TG
Sbjct: 340 SMHSATTTLEDPN-NDLYNFEGTVEIDGELYPLGSDN-VVYRGSILRNTQSIVGIVIFTG 397

Query: 258 TNTSFGAVFEMMNNIEKPKTPLQLTMDKLGKDLSLVSFIVIGMICLVGIIQ--------- 308
             T        MN I+ P+T       K+   +  + F+V  M     + Q         
Sbjct: 398 EETKI-----RMNAIKNPRTKAPKLQGKINLIVLFMVFVVAAMAMFSYLGQHILKKNYVD 452

Query: 309 -GRSWLEMFQISVSLAVAA----------IPEGLPIIVTVTLALGVLRM----------A 347
             R+W  +FQ     A             IP  L +   +  A+    M          +
Sbjct: 453 NNRAWY-LFQEDAGTAPTIMSFIIMYNTLIPLSLYVTTEIIKAMQSKLMEWDIDMYHIES 511

Query: 348 KRKAIVRRLPSVETLGSVNVICSDKTGTLTSNHMTVSKL 386
                 R    +E LG V+ I SDKTGTLT N M   K 
Sbjct: 512 DTPCESRTATILEELGQVSYIFSDKTGTLTDNKMIFRKF 550

>Scas_89.1
          Length = 271

 Score = 47.4 bits (111), Expect = 2e-05,   Method: Compositional matrix adjust.
 Identities = 49/192 (25%), Positives = 79/192 (41%), Gaps = 42/192 (21%)

Query: 559 STPLTEDLIKDLTFTGLIGMNDPPRPNVKFAIEQLLQGGVHIIMITGDSENTA------- 611
           S+ + + L  +L   GL G+ D  + +VK +IE L   GV I M+TGD   TA       
Sbjct: 24  SSVIKKHLEHNLELLGLTGVEDKLQNDVKSSIELLRNAGVKIWMLTGDKVETARCVSISA 83

Query: 612 --------VNIAKQIGIPVIDPKLSVLSGDKLDEMS-----DDQLANVIDHVN------- 651
                   V+   ++  P  +  L+ L   K+++ S      + L   + +         
Sbjct: 84  KLISRGQYVHTVTKLSRP--EGALNALEYLKINKSSCLLIDGESLGMFLTYYKQEFFDIV 141

Query: 652 ------IFARATPEHKLNIVRALRK-RGDVVAMTGDGVNDAPALKLSDIGVSMGRIGTDV 704
                 I  R TP+ K ++   +R+  G  V   GDG ND   ++ +D+GV +      V
Sbjct: 142 VDLPAVIACRCTPQQKADVALLIREITGKRVCCIGDGGNDVSMIQCADVGVGI------V 195

Query: 705 AKEASDMVLTDD 716
            KE     L  D
Sbjct: 196 GKEGKQASLAAD 207

>AFL191W [3004] [Homologous to ScYMR162C (DNF3) - SH]
            complement(79156..83883) [4728 bp, 1575 aa]
          Length = 1575

 Score = 48.5 bits (114), Expect = 3e-05,   Method: Compositional matrix adjust.
 Identities = 49/182 (26%), Positives = 78/182 (42%), Gaps = 42/182 (23%)

Query: 568  KDLTFTGLIGMNDPPRPNVKFAIEQLLQGGVHIIMITGDSENTAVNI------------- 614
            +DLT  G IG+ D  +  V  AI++L + G+ + M+TGD   TA+NI             
Sbjct: 998  RDLTLLGTIGIEDKLQEGVPDAIDKLRRAGIKMWMLTGDKRETAINIGYSCRLIHDYSTV 1057

Query: 615  ----------AKQIG--------------IPVID-PKLSVLSGDKLDEMSDDQLANVIDH 649
                      A +I               + VID   L++  G+        +L    D 
Sbjct: 1058 IILAPNDENMASKITTITQEIEAGNVAHCVVVIDGATLTIFEGNLTLMTLFIELCTKTDS 1117

Query: 650  VNIFARATPEHKLNIVRALRK--RGDVVAMTGDGVNDAPALKLSDIGVSM-GRIGTDVAK 706
            V I  R++P  K  +V  +RK  +  V    GDG ND   ++ +DIGV + G+ G   ++
Sbjct: 1118 V-ICCRSSPSQKALMVTKIRKTDKKLVTLAIGDGANDIAMIQSADIGVDITGKEGLQASR 1176

Query: 707  EA 708
             +
Sbjct: 1177 SS 1178

 Score = 33.5 bits (75), Expect = 1.1,   Method: Compositional matrix adjust.
 Identities = 16/28 (57%), Positives = 18/28 (64%)

Query: 359 VETLGSVNVICSDKTGTLTSNHMTVSKL 386
           +E LG V+ I SDKTGTLT N M   K 
Sbjct: 495 LEELGQVSYIFSDKTGTLTDNRMIFRKF 522

>CAGL0H04477g 421857..426737 similar to sp|Q12674 Saccharomyces
            cerevisiae YMR162c, start by similarity
          Length = 1626

 Score = 44.3 bits (103), Expect = 5e-04,   Method: Compositional matrix adjust.
 Identities = 54/233 (23%), Positives = 91/233 (39%), Gaps = 64/233 (27%)

Query: 539  SMASEGLRVFGFAKLTLS------------DSSTPLTEDLIK----------DLTFTGLI 576
            S ++EGLR   FA   +S            ++ T L+E   K          +L   G  
Sbjct: 967  SFSTEGLRTLLFAHKWISNEDFEQWRTRYHEAKTSLSERKQKIDEVGAQIEDELYLLGAT 1026

Query: 577  GMNDPPRPNVKFAIEQLLQGGVHIIMITGDSENTAVN----------------------- 613
             + D  +  V  AIE++ + G+ + M+TGD   TA+N                       
Sbjct: 1027 AIEDKLQEGVSEAIEKIRRAGIKMWMLTGDKRETAINIGYSCKLIHDYSTVVILTTSDEN 1086

Query: 614  -------IAKQIGIPVIDPKLSVLSGDKLDEMSDD--------QLANVIDHVNIFARATP 658
                   I++++    +   + V+ G  L    D+        +L    D V +  RA+P
Sbjct: 1087 IISKMNAISQEVDSGNVAHCVIVIDGATLAMFEDNPTLMSVFTELCTKTDSV-VCCRASP 1145

Query: 659  EHKLNIVRALRK--RGDVVAMTGDGVNDAPALKLSDIGVSM-GRIGTDVAKEA 708
              K  +V  +R   +  V    GDG ND   ++ +DIGV + G+ G   ++ A
Sbjct: 1146 AQKALMVSNIRNTDKSIVTLAIGDGANDIAMIQSADIGVGIAGKEGLQASRSA 1198

 Score = 35.4 bits (80), Expect = 0.26,   Method: Compositional matrix adjust.
 Identities = 19/34 (55%), Positives = 21/34 (61%)

Query: 353 VRRLPSVETLGSVNVICSDKTGTLTSNHMTVSKL 386
           VR    +E LG V+ I SDKTGTLT N M   KL
Sbjct: 511 VRTATILEELGQVSYIFSDKTGTLTDNKMLFRKL 544

>Scas_576.8
          Length = 1591

 Score = 44.3 bits (103), Expect = 5e-04,   Method: Compositional matrix adjust.
 Identities = 54/211 (25%), Positives = 90/211 (42%), Gaps = 38/211 (18%)

Query: 461  EMPDIRNTVQKVQELPFNSKRKLMATKI----LNPVDN-KCTVYVKGAFERILEYSTSYL 515
            E+  ++   Q +  L FNS RK M+  +     NP D  +  +  KGA   I     S L
Sbjct: 842  EVQGVQKEFQILNTLEFNSTRKRMSCIVKIPGANPDDEPRALLICKGADSIIY----SRL 897

Query: 516  KSK-GKKTEKLTEAQKATINECANSMASEGLRVFGFAKLTLS------------------ 556
             +K G  +E L E     + +     A+EGLR    A+  LS                  
Sbjct: 898  GTKNGANSENLLEKTALHLEQ----YATEGLRTLCIAQRELSWPEYLEWNKRYDIAAASV 953

Query: 557  ----DSSTPLTEDLIKDLTFTGLIGMNDPPRPNVKFAIEQLLQGGVHIIMITGDSENTAV 612
                +    +++++ ++LT  G   + D  +  V  +I  L Q G+ + ++TGD   TA+
Sbjct: 954  TNREEQLEAVSDEIERELTLLGGTAIEDRLQDGVPESISILAQAGIKLWVLTGDKVETAI 1013

Query: 613  NIAKQIGIPVIDPKLSVL--SGDKLDEMSDD 641
            NI     +   D +L V+  +GD + E  +D
Sbjct: 1014 NIGFSCNLLNNDMELLVVKTNGDDVQEFGND 1044

 Score = 33.9 bits (76), Expect = 0.83,   Method: Compositional matrix adjust.
 Identities = 65/290 (22%), Positives = 110/290 (37%), Gaps = 88/290 (30%)

Query: 172 GDLVHFRIGDRIPADIRIIEAID----LSIDESNLTGE-NEPVH---------KTSQTIE 217
           GD+V     D IPADI ++   D      ++  NL GE N  V          + S+ I 
Sbjct: 420 GDIVRIHNNDEIPADIILLSTSDSDGGCYLETKNLDGETNLKVRESLKCSHSIRNSRDIA 479

Query: 218 KSSF----------------------------NDQPNSIVPISERSCIAYMGTLVKEGHG 249
           ++ F                             ++P +I  +  R C     TL      
Sbjct: 480 RTKFWVESEGPHANLYSYQGNVKWVDSKDGDLKNEPVTINNLLLRGC-----TLRNTKWA 534

Query: 250 KGIVVGTGTNTSFGAVFEMMNNIEKPKTPLQLTMDKLGKDLSLVSFIVIGMICLV-GIIQ 308
            G+VV TG +T       M+N+   P    +++ + L   +SL +F+ + +IC +  II 
Sbjct: 535 MGMVVFTGDDTKI-----MLNSGATPTKKSRISRE-LNLSVSL-NFLFLFIICFISAIIN 587

Query: 309 G---------RSWLEMFQIS--------VSLAVAAIPEGLPIIVTVTLALGVLRMAKRKA 351
           G         R + E   ++        VS  VA I     + +++ +++ +++ A+   
Sbjct: 588 GVDYDKHPRSRDFFEFGTVAGSASTNGFVSFWVAVILYQSLVPISLYISVEIIKTAQAAF 647

Query: 352 IV----------------RRLPSVETLGSVNVICSDKTGTLTSNHMTVSK 385
           I                 +     + +G +  I SDKTGTLT N M   K
Sbjct: 648 IYGDVLLYNAKLDYPCTPKSWNISDDMGQIEYIFSDKTGTLTQNVMEFKK 697

>Scas_669.3
          Length = 1638

 Score = 42.7 bits (99), Expect = 0.001,   Method: Compositional matrix adjust.
 Identities = 43/153 (28%), Positives = 68/153 (44%), Gaps = 32/153 (20%)

Query: 485  ATKILNPVDNKCTVYVKGAFERILEYSTSYLKSKGKKTEKLTEAQKATINECANSMASEG 544
            A   L PV  +     KG  E I   S   L + G   EK  +A    I+E     ++EG
Sbjct: 957  AKHYLKPVSTEDARVEKGMLEYIG--SDDLLLNDGYVIEKTIQA----IDE----FSTEG 1006

Query: 545  LR--VFGF-----------------AKLTLSDSSTPLTE---DLIKDLTFTGLIGMNDPP 582
            LR  V+ +                 AK++L++  + + E   ++ +DL   G   + D  
Sbjct: 1007 LRTLVYSYKWVDLQEYQQWEDRYHDAKISLTNRKSKIAEVGEEIEQDLQLLGATAIEDKL 1066

Query: 583  RPNVKFAIEQLLQGGVHIIMITGDSENTAVNIA 615
            +  V  AIE++ + G+ I M+TGD   TA+NI 
Sbjct: 1067 QEGVSEAIEKIRRAGIKIWMLTGDKRETAINIG 1099

 Score = 33.5 bits (75), Expect = 0.97,   Method: Compositional matrix adjust.
 Identities = 39/180 (21%), Positives = 74/180 (41%), Gaps = 35/180 (19%)

Query: 237 IAYMGTLVKEGHGK-GIVVGTGTNTSFGAVFEMMNNIEKPKTPLQLTMDKLGKDLSLVSF 295
           +AY G++++      G+V+ TG  T        MN +  P+T        +   ++ + F
Sbjct: 393 VAYRGSIIRNTDNVIGMVIYTGKETKI-----RMNALNNPRTKAPKLQKNINIIITFMVF 447

Query: 296 IV--IGMICLVG-IIQGRSWLEMFQISVSLA--VAAIPEGLPIIV--------TVTLALG 342
           +V  I +   +G ++Q +  ++  Q    L     A P  +  I+        ++ + + 
Sbjct: 448 VVAVISLFSYLGHVLQNKKAIDENQAWYLLTKDAGAAPTIMSFIIMYNTIIPLSLYVTME 507

Query: 343 VLRMAKRKAI----------------VRRLPSVETLGSVNVICSDKTGTLTSNHMTVSKL 386
           +++  + K +                 R    +E LG V+ + SDKTGTLT N M   K 
Sbjct: 508 IIKAMQSKMMEWDIDMYHSETNTPCESRTATILEELGQVSYMFSDKTGTLTDNKMIFRKF 567

>YER166W (DNF1) [1594] chr5 (512739..517454) Member of the haloacid
            dehalogenase or epoxide hydrolase family, has low
            similarity to S. cerevisiae Drs2p, which is a
            membrane-spanning Ca-ATPase (P-type) required for
            ribosome assembly and involved in late Golgi function
            [4716 bp, 1571 aa]
          Length = 1571

 Score = 40.4 bits (93), Expect = 0.007,   Method: Compositional matrix adjust.
 Identities = 46/182 (25%), Positives = 75/182 (41%), Gaps = 34/182 (18%)

Query: 461  EMPDIRNTVQKVQELPFNSKRKLMATKI----LNPVDN-KCTVYVKGAFERILEYSTSYL 515
            EM  I+   + +  L FNS RK M+  +    LNP D  +  +  KGA + I+    S  
Sbjct: 826  EMQGIQKEFEILNILEFNSSRKRMSCIVKIPGLNPGDEPRALLICKGA-DSIIYSRLS-- 882

Query: 516  KSKGKKTEKLTEAQKATINECANSMASEGLRVFGFAKLTLS------------------- 556
            +  G  +E + E     + +     A+EGLR    A+  LS                   
Sbjct: 883  RQSGSNSEAILEKTALHLEQ----YATEGLRTLCIAQRELSWSEYEKWNEKYDIAAASLA 938

Query: 557  ---DSSTPLTEDLIKDLTFTGLIGMNDPPRPNVKFAIEQLLQGGVHIIMITGDSENTAVN 613
               D    + + + ++L   G   + D  +  V   IE L + G+ + ++TGD   TA+N
Sbjct: 939  NREDELEVVADSIERELILLGGTAIEDRLQDGVPDCIELLAEAGIKLWVLTGDKVETAIN 998

Query: 614  IA 615
            I 
Sbjct: 999  IG 1000

 Score = 34.7 bits (78), Expect = 0.52,   Method: Compositional matrix adjust.
 Identities = 66/288 (22%), Positives = 114/288 (39%), Gaps = 84/288 (29%)

Query: 172 GDLVHFRIGDRIPADIRIIEAIDLS----IDESNLTGE-NEPVH---------KTSQTIE 217
           GD+V     D IPADI ++   D      ++  NL GE N  V          +TS+ I 
Sbjct: 404 GDIVRIHNNDEIPADIILLSTSDTDGACYVETKNLDGETNLKVRQSLKCTNTIRTSKDIA 463

Query: 218 KSSF---NDQPNSIV--------------------PISERSCIAYMGTLVKEGHGKGIVV 254
           ++ F   ++ P+S +                    PI+  + +    TL       G+V+
Sbjct: 464 RTKFWIESEGPHSNLYTYQGNMKWRNLADGEIRNEPITINNVLLRGCTLRNTKWAMGVVM 523

Query: 255 GTGTNTSFGAVFEMMNNIEKPKTPLQLTMDKLGKDLSL---VSFIVIGMICLVGII---- 307
            TG +T       M+N+   P         ++ ++L+    ++F+++ ++C V  I    
Sbjct: 524 FTGGDTKI-----MLNSGITPTKK-----SRISRELNFSVVINFVLLFILCFVSGIANGV 573

Query: 308 ----QGRSWL--EMFQIS--------VSLAVAAIPEGLPIIVTVTLALGVLRMAKRKAIV 353
               +GRS    E   I+        VS  VA I     + +++ +++ +++ A+   I 
Sbjct: 574 YYDKKGRSRFSYEFGTIAGSAATNGFVSFWVAVILYQSLVPISLYISVEIIKTAQAAFIY 633

Query: 354 ----------------RRLPSVETLGSVNVICSDKTGTLTSNHMTVSK 385
                           +     + LG V  I SDKTGTLT N M   K
Sbjct: 634 GDVLLYNAKLDYPCTPKSWNISDDLGQVEYIFSDKTGTLTQNVMEFKK 681

 Score = 30.8 bits (68), Expect = 6.5,   Method: Compositional matrix adjust.
 Identities = 13/45 (28%), Positives = 26/45 (57%), Gaps = 1/45 (2%)

Query: 655  RATPEHKLNIVRALRKRGDVVAMT-GDGVNDAPALKLSDIGVSMG 698
            R +P  K  +V+ ++   DV+ +  GDG ND   ++ +D+G+ + 
Sbjct: 1104 RVSPSQKAAVVKLVKDSLDVMTLAIGDGSNDVAMIQSADVGIGIA 1148

>YMR162C (DNF3) [4117] chr13 complement(578950..583920) Member of the
            Drs2p-like family of the P-type ATPase superfamily of
            membrane transporters [4971 bp, 1656 aa]
          Length = 1656

 Score = 40.0 bits (92), Expect = 0.012,   Method: Compositional matrix adjust.
 Identities = 49/200 (24%), Positives = 84/200 (42%), Gaps = 45/200 (22%)

Query: 551  AKLTLSDSSTPLTE---DLIKDLTFTGLIGMNDPPRPNVKFAIEQLLQGGVHIIMITGDS 607
            AK +L+D    + E   ++   L   G+  + D  +  V  AIE++ + G+ + M+TGD 
Sbjct: 1058 AKTSLTDRKIKVDEAGAEIEDGLNLLGVTAIEDKLQDGVSEAIEKIRRAGIKMWMLTGDK 1117

Query: 608  ENTAVNIA------KQIGIPV--------IDPKLSVLSGDKLDEMSDDQLANVID----- 648
              TA+NI       K     V        I  K++ +S  ++D  +      VID     
Sbjct: 1118 RETAINIGYSCMLIKDYSTVVILTTTDENIISKMNAVS-QEVDSGNIAHCVVVIDGATMA 1176

Query: 649  -------HVNIF------------ARATPEHKLNIVRALRKRGD--VVAMTGDGVNDAPA 687
                   ++++F             RA+P  K  +V  +R      V    GDG ND   
Sbjct: 1177 MFEGNPTYMSVFVELCTKTDSVICCRASPSQKALMVSNIRNTDPNLVTLAIGDGANDIAM 1236

Query: 688  LKLSDIGVSM-GRIGTDVAK 706
            ++ +DIGV + G+ G   ++
Sbjct: 1237 IQSADIGVGIAGKEGLQASR 1256

 Score = 37.7 bits (86), Expect = 0.051,   Method: Compositional matrix adjust.
 Identities = 62/286 (21%), Positives = 111/286 (38%), Gaps = 66/286 (23%)

Query: 148 LVPAECHLMRC-GQESHVLASTLVPGDLVHFRIGDRIPADIRIIEAI------------- 193
            VPA+  L+ C G+ S     T+      + +     P   ++ +A              
Sbjct: 315 WVPADLLLLTCDGENSECFVETMALDGETNLKSKQPHPELNKLTKAASGLANINAQVTVE 374

Query: 194 DLSIDESNLTGENEPVHKTSQTIEKSSFNDQPNSIVPISERSCIAYMGTLVKEGHGK-GI 252
           D +ID  N  G  E  +  + TI K      P++++         Y G++++      G+
Sbjct: 375 DPNIDLYNFEGNLELKNHRNDTIMKYPLG--PDNVI---------YRGSILRNTQNVVGM 423

Query: 253 VVGTGTNTSFGAVFEMMNNIEKPKTPLQLTMDKLGKDLSLVSFIV--IGMICLVG----- 305
           V+ +G  T        MN ++ P+T       K+   +  + F+V  I +   +G     
Sbjct: 424 VIFSGEETKI-----RMNALKNPRTKAPKLQRKINMIIVFMVFVVATISLFSYLGHVLHK 478

Query: 306 ---IIQGRSWLEMFQISVSLA------VAAIPEGLPIIVTVTLALGVLRMAKRKAI---- 352
              I Q ++W  +FQ    +A      +      +P+ + VT+   ++++ + K +    
Sbjct: 479 KKYIDQNKAWY-LFQADAGVAPTIMSFIIMYNTVIPLSLYVTME--IIKVVQSKMMEWDI 535

Query: 353 ------------VRRLPSVETLGSVNVICSDKTGTLTSNHMTVSKL 386
                        R    +E LG V+ I SDKTGTLT N M   K 
Sbjct: 536 DMYHAETNTPCESRTATILEELGQVSYIFSDKTGTLTDNKMIFRKF 581

>Kwal_23.3556
          Length = 1597

 Score = 39.3 bits (90), Expect = 0.016,   Method: Compositional matrix adjust.
 Identities = 43/180 (23%), Positives = 70/180 (38%), Gaps = 42/180 (23%)

Query: 570  LTFTGLIGMNDPPRPNVKFAIEQLLQGGVHIIMITGDSENTAVNIAKQIGI--------- 620
            L   G   + D  +  V  AI+++ + G+ + M+TGD   TA+NI     +         
Sbjct: 1019 LHLLGATAIEDKLQEGVADAIDKIRRAGIKMWMLTGDKRETAINIGYSCNLIHDYSTVVI 1078

Query: 621  -----PVIDPKLS----------------VLSGDKLDEMSDD--------QLANVIDHVN 651
                   I  KL+                V+ G  L     +        +L    D V 
Sbjct: 1079 LSAKDENISSKLTAVSQEIERGNIAHCVVVIDGSTLTTFESNPTLMSVFVELCTKTDSV- 1137

Query: 652  IFARATPEHKLNIVRALRK--RGDVVAMTGDGVNDAPALKLSDIGVSM-GRIGTDVAKEA 708
            I  RA+P  K  +V  +R   +  V    GDG ND   ++ +DIGV + G+ G   ++ +
Sbjct: 1138 ICCRASPSQKALMVTHIRNTDKKLVTLAIGDGANDIAMIQSADIGVGIAGKEGLQASRSS 1197

 Score = 32.7 bits (73), Expect = 2.0,   Method: Compositional matrix adjust.
 Identities = 50/185 (27%), Positives = 74/185 (40%), Gaps = 45/185 (24%)

Query: 237 IAYMGTLVKE-GHGKGIVVGTGTNTSFGAVFEMMNNIEKPKTPLQLTMDKLGKDLSLVS- 294
           I Y G++++   +  G+VV TG  T        MN I+ P+    +   KL + ++L+  
Sbjct: 371 IIYRGSIIRNTSNAVGMVVFTGEETKI-----RMNAIKNPR----IKAPKLQRAINLIVL 421

Query: 295 ---FIVIGM--ICLVG--IIQ------GRSWLEMFQISVSLAVAA----------IPEGL 331
              F+V  M    L+G  II+       R+W  +F     LA             IP  L
Sbjct: 422 FMVFVVASMALFSLLGQRIIKKKYVDNNRAWY-LFNSDAGLAPTVMSFIIMYNTLIPLSL 480

Query: 332 PIIVTVTLALGVLRM----------AKRKAIVRRLPSVETLGSVNVICSDKTGTLTSNHM 381
            + + +  A+    M                 R    +E LG V+ I SDKTGTLT N M
Sbjct: 481 YVTMEIIKAMQSKLMEWDIDMYHAETNTPCESRTATILEELGQVSYIFSDKTGTLTDNKM 540

Query: 382 TVSKL 386
               L
Sbjct: 541 VFRAL 545

>Scas_636.16
          Length = 1554

 Score = 38.1 bits (87), Expect = 0.044,   Method: Compositional matrix adjust.
 Identities = 54/210 (25%), Positives = 84/210 (40%), Gaps = 36/210 (17%)

Query: 461  EMPDIRNTVQKVQELPFNSKRKLMATKI-LNPVDNK----CTVYVKGAFERILEYSTSYL 515
            E+  I+   Q +  L FNS RK M+  + L P   K      +  KGA   I    +   
Sbjct: 805  EVQGIQKEFQILNILEFNSSRKRMSCIVKLPPATEKDEPRALLICKGADSVIY---SRLS 861

Query: 516  KSKGKKTEKLTEAQKATINECANSMASEGLRV-------------------FGFAKLTLS 556
            +  G   E L E     + +     A+EGLR                    +  A  +L+
Sbjct: 862  RKPGYNDETLLEKTALHLEQ----YATEGLRTLCVGQREISWSEYQEWNEKYNIAAASLA 917

Query: 557  DSSTPLTE--DLI-KDLTFTGLIGMNDPPRPNVKFAIEQLLQGGVHIIMITGDSENTAVN 613
                 L    DLI +DL   G   + D  +  V  +I  L + G+ + ++TGD   TA+N
Sbjct: 918  GREEELDHVADLIERDLVLLGGTAIEDRLQDGVPDSIALLAEAGIKLWVLTGDKVETAIN 977

Query: 614  IAKQIGIPVIDPKLSVL--SGDKLDEMSDD 641
            I     +   D +L V+  +G+ + E  DD
Sbjct: 978  IGFSCNLLNTDMELLVIKTTGEDVKEFGDD 1007

 Score = 31.6 bits (70), Expect = 4.3,   Method: Compositional matrix adjust.
 Identities = 21/83 (25%), Positives = 38/83 (45%), Gaps = 2/83 (2%)

Query: 654  ARATPEHKLNIVRALRKRGDVVAMT-GDGVNDAPALKLSDIGVSMGRIGTDVAKEASDMV 712
             R +P  K  +V+ ++   DV+ +  GDG ND   ++ +D+GV +       A   SD  
Sbjct: 1082 CRVSPAQKAAVVKLVKDTLDVMTLAIGDGSNDVAMIQSADVGVGIAGEEGRQAVMCSDYA 1141

Query: 713  LTDDDFSTILTAIEEGKGIFNNI 735
            +    + T L  +  GK  +  +
Sbjct: 1142 IGQFRYVTRLVLV-HGKWCYKRL 1163

>KLLA0C17644g 1557138..1561868 similar to sp|P32660 Saccharomyces
           cerevisiae YER166w, start by similarity
          Length = 1576

 Score = 37.7 bits (86), Expect = 0.048,   Method: Compositional matrix adjust.
 Identities = 70/288 (24%), Positives = 121/288 (42%), Gaps = 84/288 (29%)

Query: 172 GDLVHFRIGDRIPADIRIIEAID----LSIDESNLTGE-NEPVHKT---------SQTIE 217
           GD+V     D IPADI ++ + D      ++  NL GE N  V ++         S+ I 
Sbjct: 449 GDIVRVHNNDEIPADIILLSSSDSDGACYVETKNLDGETNLKVRQSLKCSHMIRNSRNIT 508

Query: 218 KSSF---NDQPNSIV--------------------PISERSCIAYMGTLVKEGHGKGIVV 254
           ++ F   ++ P+S +                    P++  + +    TL       GIVV
Sbjct: 509 RTKFKVESEGPHSNLYSYQGNLKWVDRETGLEKNEPVNINNLLLRGCTLRNTKWAMGIVV 568

Query: 255 GTGTNTSFGAVFEMMNNIEKPKTPLQLTMDKLGKDLSL---VSFIVIGMICLV-GIIQG- 309
            TG +T       M+N      TP +++  ++ ++L+L   ++F ++ ++C   GI+ G 
Sbjct: 569 FTGPDTKI-----MLN---AGVTPTKVS--RISRELNLSVFMNFALLFVLCFAAGIVNGV 618

Query: 310 --------RSWLEMFQIS--------VSLAVAAIPEGLPIIVTVTLALGVLRMAKRKAIV 353
                   R++ E   I+        VS  VA I     + +++ +++ +++ A+   I 
Sbjct: 619 YYRTDNTSRNYFEFGSIAGSAAANGVVSFWVALILYQSVVPISLYISIEIIKTAQALFIY 678

Query: 354 -------RRL-----PSVET----LGSVNVICSDKTGTLTSNHMTVSK 385
                   RL     P   T    LG +  I SDKTGTLT N M   K
Sbjct: 679 GDVALYNERLDYPCTPKSWTISDDLGQIEYIFSDKTGTLTQNVMEFKK 726

 Score = 37.0 bits (84), Expect = 0.100,   Method: Compositional matrix adjust.
 Identities = 48/191 (25%), Positives = 77/191 (40%), Gaps = 39/191 (20%)

Query: 475  LPFNSKRKLMATKILNPVDN-----KCTVYVKGAFERILEYSTSYLKSKGKKTEKLTEAQ 529
            L FNS RK M+  +  P +N     +  +  KGA   I      Y +      EKL E  
Sbjct: 885  LEFNSTRKRMSCILKIPSENPNEEPRALLICKGADSII------YSRLSKNNDEKLLEKT 938

Query: 530  KATINECANSMASEGLRVFGFAKLTLS----------------------DSSTPLTEDLI 567
               + +     A+EGLR    A+  LS                      D    + + + 
Sbjct: 939  ALHLEQ----YATEGLRTLCIAQRELSWKEYQEWNEKHEIAAAALVDREDEMEKVADVIE 994

Query: 568  KDLTFTGLIGMNDPPRPNVKFAIEQLLQGGVHIIMITGDSENTAVNIAKQIGIPVIDPKL 627
            ++LT  G   + D  +  V  +I  L + G+ + ++TGD   TA+NI     +   + +L
Sbjct: 995  RELTLLGGTAIEDRLQDGVPDSIATLGEAGIKLWVLTGDKVETAINIGFSCNLLNNEMEL 1054

Query: 628  SVL--SGDKLD 636
             V+  SGD +D
Sbjct: 1055 LVIKASGDDVD 1065

 Score = 32.0 bits (71), Expect = 2.9,   Method: Compositional matrix adjust.
 Identities = 18/64 (28%), Positives = 32/64 (50%), Gaps = 7/64 (10%)

Query: 654  ARATPEHKLNIVRALRKRGDVVAMT-GDGVNDAPALKLSDIGVSMGRIGTDVAKEASDMV 712
             R +P  K  +V+ ++   DV+ +  GDG ND   ++ +DIGV +        +E    V
Sbjct: 1145 CRVSPAQKAAVVKLVKNTLDVMTLAIGDGSNDVAMIQSADIGVGIA------GEEGRQAV 1198

Query: 713  LTDD 716
            ++ D
Sbjct: 1199 MSSD 1202

>CAGL0L11814g 1262124..1266854 highly similar to sp|P32660
           Saccharomyces cerevisiae YER166w or sp|Q12675
           Saccharomyces cerevisiae YDR093w, start by similarity
          Length = 1576

 Score = 37.4 bits (85), Expect = 0.077,   Method: Compositional matrix adjust.
 Identities = 68/293 (23%), Positives = 114/293 (38%), Gaps = 94/293 (32%)

Query: 172 GDLVHFRIGDRIPADIRIIEAID----LSIDESNLTGE-NEPVH---------KTSQTIE 217
           GD+V     D IPADI ++   D      ++  NL GE N  V          KTS+ I 
Sbjct: 400 GDIVRIHNNDEIPADIILLSTSDSDGGCYVETKNLDGETNLKVRQALKCSYKIKTSRDIA 459

Query: 218 KSSF----------------------------NDQPNSIVPISERSCIAYMGTLVKEGHG 249
           ++ F                             ++P +I  +  R C     TL      
Sbjct: 460 RTRFWIESEGPHANLYSYQGNLKWKDSTNNELRNEPVTINNMLLRGC-----TLRNTKWA 514

Query: 250 KGIVVGTGTNTSFGAVFEMMNNIEKPKTPLQLTMDKLGKDLS---LVSFIVIGMICLV-G 305
            GIVV TG +T       M+N      TP + +  ++ ++L+   L++F+V+ ++C + G
Sbjct: 515 MGIVVFTGDDTKI-----MLN---AGVTPTKKS--RISRELNFSVLINFLVLFILCFISG 564

Query: 306 IIQG---------RSWLEMFQIS--------VSLAVAAIPEGLPIIVTVTLALGVLRMAK 348
           +  G         R + E   ++        VS  VA I     + +++ +++ +++ A+
Sbjct: 565 LANGIDYDKHPRSRDFFEFGTVAGNPATNGFVSFWVAVILYQSLVPISLYISVEIIKTAQ 624

Query: 349 RKAIV----------------RRLPSVETLGSVNVICSDKTGTLTSNHMTVSK 385
              I                 +     + LG +  I SDKTGTLT N M   K
Sbjct: 625 AAFIYGDVLLYNAKLDYPCTPKSWNISDDLGQIEYIFSDKTGTLTQNVMEFKK 677

 Score = 35.8 bits (81), Expect = 0.19,   Method: Compositional matrix adjust.
 Identities = 65/270 (24%), Positives = 109/270 (40%), Gaps = 38/270 (14%)

Query: 461  EMPDIRNTVQKVQELPFNSKRKLMATKILNPV-----DNKCTVYVKGAFERILEYSTSYL 515
            E+  I+   + +  L FNS RK M+  I  P      + +  +  KGA   I  YS    
Sbjct: 822  EIQGIQKEFEILNILEFNSARKRMSCIIKIPGATPNDEPRALLICKGADSVI--YSRLST 879

Query: 516  KSKGKKTEKLTEAQKATINECANSMASEGLRVFGFAKLTLSDSSTP-------------- 561
            K+ G+  E L E     + +     A+EGLR    A+  L+ S                 
Sbjct: 880  KA-GENDETLLEKTALHLEQ----YATEGLRTLCLAQRELTWSEYTEWNARYDIAAASLT 934

Query: 562  --------LTEDLIKDLTFTGLIGMNDPPRPNVKFAIEQLLQGGVHIIMITGDSENTAVN 613
                    +++ + +DL   G   + D  +  V  +I  L + G+ + ++TGD   TA+N
Sbjct: 935  NREEQLEIVSDSIERDLILLGGTAIEDRLQDGVPESIALLAEAGIKLWVLTGDKVETAIN 994

Query: 614  IAKQIGIPVIDPKLSVL--SGDKLDEMSDDQLANVIDHVNIFARATPEHKLNIVRALRKR 671
            I     +   D +L V+  +G+ + E  +D    V   ++ + R       + +     +
Sbjct: 995  IGFSCNLLNNDMELLVVKTAGEDVLEYGEDPHEVVNSLISKYLREKFGLSGSEMELDNAK 1054

Query: 672  GDVVAMTGDG--VNDAPALKLSDIGVSMGR 699
            GD     GD   V D  ALK++  G  M R
Sbjct: 1055 GDHSFPKGDFAVVIDGDALKIALTGDDMKR 1084

 Score = 30.4 bits (67), Expect = 8.4,   Method: Compositional matrix adjust.
 Identities = 13/46 (28%), Positives = 26/46 (56%), Gaps = 1/46 (2%)

Query: 654  ARATPEHKLNIVRALRKRGDVVAMT-GDGVNDAPALKLSDIGVSMG 698
             R +P  K  +V+ ++   DV+ +  GDG ND   ++ +D+G+ + 
Sbjct: 1099 CRVSPAQKAAVVKLVKNTLDVMTLAIGDGSNDVAMIQSADVGIGIA 1144

>YDR093W (DNF2) [945] chr4 (631276..636114) Member of the haloacid
            dehalogenase or epoxide hydrolase family, has low
            similarity to familial intrahepatic cholestasis 1 (human
            ATP8B1), which is an aminophospholipid ATPase transporter
            associated with familial intrahepatic cholestasis [4839
            bp, 1612 aa]
          Length = 1612

 Score = 37.0 bits (84), Expect = 0.084,   Method: Compositional matrix adjust.
 Identities = 58/225 (25%), Positives = 95/225 (42%), Gaps = 40/225 (17%)

Query: 461  EMPDIRNTVQKVQELPFNSKRKLMATKILNPV-----DNKCTVYVKGAFERILEYSTSYL 515
            E+  ++   Q +  L FNS RK M+  I  P      + K  +  KGA         S +
Sbjct: 871  EIQGVQKEFQVLNVLEFNSSRKRMSCIIKIPGSTPKDEPKALLICKGA--------DSVI 922

Query: 516  KSKGKKTEK-LTEAQKATINECANSMASEGLRVFGFAK--LTLSD-------------SS 559
             S+  +T+   T  +K  ++      A+EGLR    A+  LT S+             S 
Sbjct: 923  YSRLDRTQNDATLLEKTALH--LEEYATEGLRTLCLAQRELTWSEYERWVKTYDVAAASV 980

Query: 560  TPLTEDLIK-------DLTFTGLIGMNDPPRPNVKFAIEQLLQGGVHIIMITGDSENTAV 612
            T   E+L K       +L   G   + D  +  V  +I  L + G+ + ++TGD   TA+
Sbjct: 981  TNREEELDKVTDVIERELILLGGTAIEDRLQDGVPDSIALLAEAGIKLWVLTGDKVETAI 1040

Query: 613  NIAKQIGIPVIDPKLSVL--SGDKLDEMSDDQLANVIDHVNIFAR 655
            NI     +   D +L V+  SG+ ++E   D +  V + V  + R
Sbjct: 1041 NIGFSCNVLNNDMELLVVKASGEDVEEFGSDPIQVVNNLVTKYLR 1085

 Score = 33.9 bits (76), Expect = 0.86,   Method: Compositional matrix adjust.
 Identities = 22/83 (26%), Positives = 39/83 (46%), Gaps = 2/83 (2%)

Query: 654  ARATPEHKLNIVRALRKRGDVVAMT-GDGVNDAPALKLSDIGVSMGRIGTDVAKEASDMV 712
             R +P  K  +V+ ++K  DV+ +  GDG ND   ++ +D+GV +       A   SD  
Sbjct: 1146 CRVSPAQKAAVVKLVKKTLDVMTLAIGDGSNDVAMIQSADVGVGIAGEEGRQAVMCSDYA 1205

Query: 713  LTDDDFSTILTAIEEGKGIFNNI 735
            +    + T L  +  GK  +  +
Sbjct: 1206 IGQFRYVTRLVLV-HGKWCYKRL 1227

>CAGL0G08085g 763185..767921 highly similar to sp|Q12675 Saccharomyces
            cerevisiae YDR093w, hypothetical start
          Length = 1578

 Score = 37.0 bits (84), Expect = 0.100,   Method: Compositional matrix adjust.
 Identities = 45/182 (24%), Positives = 71/182 (39%), Gaps = 35/182 (19%)

Query: 461  EMPDIRNTVQKVQELPFNSKRKLMATKILNPVDN-----KCTVYVKGAFERILEYSTSYL 515
            E+  I    Q +  L FNS RK M+  +  P D+     K  +  KGA   I     S L
Sbjct: 833  EVQGIEKEFQILNILEFNSSRKRMSCIVKIPGDDANGKPKALLICKGADSVIY----SRL 888

Query: 516  KSKGKKTEKLTEAQKATINECANSMASEGLRVFGFAKLTLS------------------- 556
               G   E L E     + +     A+EGLR    A+  LS                   
Sbjct: 889  DKTGLNEESLLEKTALHLEQ----YATEGLRTLCLAQRELSWEEYERWNKKYDIAAAAVV 944

Query: 557  ---DSSTPLTEDLIKDLTFTGLIGMNDPPRPNVKFAIEQLLQGGVHIIMITGDSENTAVN 613
               +    +++++ + L   G   + D  +  V  +I  L + G+ + ++TGD   TA+N
Sbjct: 945  DREEELEKVSDEIERHLILLGGTAIEDRLQDGVPDSIALLGEAGIKLWVLTGDKVETAIN 1004

Query: 614  IA 615
            I 
Sbjct: 1005 IG 1006

>Scas_227.0d
          Length = 307

 Score = 32.7 bits (73), Expect = 1.2,   Method: Compositional matrix adjust.
 Identities = 16/32 (50%), Positives = 20/32 (62%)

Query: 363 GSVNVICSDKTGTLTSNHMTVSKLWCLDSMSN 394
           GS   +C DKTGTLT N M+V + +  DS  N
Sbjct: 3   GSATAVCFDKTGTLTENVMSVVRGFVGDSYFN 34

>AGR120C [4431] [Homologous to ScYER166W (DNF1) - SH; ScYDR093W (DNF2)
            - SH] (972456..977099) [4644 bp, 1547 aa]
          Length = 1547

 Score = 33.1 bits (74), Expect = 1.5,   Method: Compositional matrix adjust.
 Identities = 14/45 (31%), Positives = 27/45 (60%), Gaps = 1/45 (2%)

Query: 655  RATPEHKLNIVRALRKRGDVVAMT-GDGVNDAPALKLSDIGVSMG 698
            R +P  K  +V+ +++  DVV +  GDG ND   ++ +D+G+ + 
Sbjct: 1109 RVSPSQKAAVVKLVKESLDVVTLAIGDGSNDVAMIQAADVGIGIA 1153

>CAGL0M13189g complement(1294293..1295918) weakly similar to
           sp|P33749 Saccharomyces cerevisiae YKL062w MSN4
           transcriptional activator, hypothetical start
          Length = 541

 Score = 30.8 bits (68), Expect = 6.1,   Method: Compositional matrix adjust.
 Identities = 32/114 (28%), Positives = 50/114 (43%), Gaps = 8/114 (7%)

Query: 8   ASLLDEDSNREREILDATAEALSKPSPSLEYCTLSVDEALEKLDTDKNGGLRSSNEANNR 67
           AS L +  NR + +       ++K  PSLE    S    L+ L ++ N   R +N A   
Sbjct: 277 ASKLTKYRNRRQSVHGPVGSGVTKRKPSLESPLTSPTRTLQAL-SNANNQYRLTNNAGAL 335

Query: 68  RSLYGPNEITVEDDESLFKKFLSNFIEDRMILLLIGSAVVSLFM-GNIDDAVSI 120
            S+    +  + DD+ L      N  EDR  + +   A   LF+ GN D A+ +
Sbjct: 336 NSMLLWEDAVLSDDDDL------NEGEDRRNMFIASPASSGLFLNGNEDAALEV 383

>CAGL0E04950g 478626..480647 similar to sp|P53118 Saccharomyces
           cerevisiae YGL144c or tr|Q12103 Saccharomyces cerevisiae
           YDL109c, hypothetical start
          Length = 673

 Score = 30.4 bits (67), Expect = 7.8,   Method: Compositional matrix adjust.
 Identities = 17/41 (41%), Positives = 22/41 (53%), Gaps = 3/41 (7%)

Query: 53  DKNGGLRSSNEANNRRSLYGPNEITVEDDESLFKKFLSNFI 93
           D +  L+   E    +SL GPN ITV D+ + F K   NFI
Sbjct: 389 DYDAILKKLREKEENKSLSGPNNITVSDNTAFFNK---NFI 426

  Database: blastdb
    Posted date:  Apr 3, 2006  3:33 PM
  Number of letters in database: 16,596,109
  Number of sequences in database:  34,618
  
Lambda     K      H
   0.319    0.135    0.381 

Gapped
Lambda     K      H
   0.267   0.0410    0.140 

Matrix: BLOSUM62
Gap Penalties: Existence: 11, Extension: 1
Number of Sequences: 34618
Number of Hits to DB: 28,681,474
Number of extensions: 1245283
Number of successful extensions: 4440
Number of sequences better than 10.0: 99
Number of HSP's gapped: 4373
Number of HSP's successfully gapped: 180
Length of query: 934
Length of database: 16,596,109
Length adjustment: 111
Effective length of query: 823
Effective length of database: 12,753,511
Effective search space: 10496139553
Effective search space used: 10496139553
Neighboring words threshold: 11
Window for multiple hits: 40
X1: 16 ( 7.4 bits)
X2: 38 (14.6 bits)
X3: 64 (24.7 bits)
S1: 41 (21.7 bits)
S2: 66 (30.0 bits)