Hit NameLength (aa)HSP LengthHSP ScoreHSP Significance
YGL164C (YRB30)44043320280.0
Scas_668.1741241711181e-151
CAGL0I04202g42542910971e-148
Sklu_1546.14293449511e-125
AEL296W4394387591e-96
Kwal_14.15422041953341e-36
YLR086W (SMC4)141896673.3
Kwal_33.14960757158664.5
Kwal_23.520693264648.3
BLASTP 2.2.26 [Sep-21-2011]

Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, 
Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), 
"Gapped BLAST and PSI-BLAST: a new generation of protein database search
programs",  Nucleic Acids Res. 25:3389-3402.

Reference for compositional score matrix adjustment: Altschul, Stephen F., 
John C. Wootton, E. Michael Gertz, Richa Agarwala, Aleksandr Morgulis,
Alejandro A. Schaffer, and Yi-Kuo Yu (2005) "Protein database searches
using compositionally adjusted substitution matrices", FEBS J. 272:5101-5109.

Query= YGL164C
         (433 letters)

Database: blastdb 
           34,618 sequences; 16,596,109 total letters

Searching..................................................done

                                                                 Score    E
Sequences producing significant alignments:                      (bits) Value

YGL164C (YRB30) [1825] chr7 complement(191982..193304) Protein o...   785   0.0  
Scas_668.17                                                           435   e-151
CAGL0I04202g complement(368221..369498) highly similar to sp|P53...   427   e-148
Sklu_1546.1 YGL164C, Contig c1546 317-1606 reverse complement         370   e-125
AEL296W [2209] [Homologous to ScYGL164C - SH] complement(86307.....   296   1e-96
Kwal_14.1542                                                          133   1e-36
YLR086W (SMC4) [3501] chr12 (302244..306500) Subunit of condensi...    30   3.3  
Kwal_33.14960                                                          30   4.5  
Kwal_23.5206                                                           29   8.3  

>YGL164C (YRB30) [1825] chr7 complement(191982..193304) Protein of
           unknown function, has moderate similarity to
           uncharacterized C. albicans Orf6.8006p [1323 bp, 440 aa]
          Length = 440

 Score =  785 bits (2028), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 398/433 (91%), Positives = 398/433 (91%)

Query: 1   MDEILAKAGSQAVTFAIKSGISIASTYALKTITNFVVQIPKDDARRIDQLKFKLESRMAI 60
           MDEILAKAGSQAVTFAIKSGISIASTYALKTITNFVVQIPKDDARRIDQLKFKLESRMAI
Sbjct: 1   MDEILAKAGSQAVTFAIKSGISIASTYALKTITNFVVQIPKDDARRIDQLKFKLESRMAI 60

Query: 61  VSSAIDLIKLVAARGNTNLQITLRLTKDLKEEIDRFDEKINEMTQKVEGSRSAKTQNEAI 120
           VSSAIDLIKLVAARGNTNLQITLRLTKDLKEEIDRFDEKINEMTQKVEGSRSAKTQNEAI
Sbjct: 61  VSSAIDLIKLVAARGNTNLQITLRLTKDLKEEIDRFDEKINEMTQKVEGSRSAKTQNEAI 120

Query: 121 KAVENYIKDLLLRIEEITPFINLSLTTSGANLNSALPYQLSPGLLLKASDFVSENNRKYE 180
           KAVENYIKDLLLRIEEITPFINLSLTTSGANLNSALPYQLSPGLLLKASDFVSENNRKYE
Sbjct: 121 KAVENYIKDLLLRIEEITPFINLSLTTSGANLNSALPYQLSPGLLLKASDFVSENNRKYE 180

Query: 181 KAMKSNEKGTGDKEILKVQVGPTFEVTLFSIFYNLTSENNGQSGIVWKEDMKRAKARIYR 240
           KAMKSNEKGTGDKEILKVQVGPTFEVTLFSIFYNLTSENNGQSGIVWKEDMKRAKARIYR
Sbjct: 181 KAMKSNEKGTGDKEILKVQVGPTFEVTLFSIFYNLTSENNGQSGIVWKEDMKRAKARIYR 240

Query: 241 LNSTGRKYDYFMKIEQDFNDGRYHEDDDKEDTPQELAIDLNHIKKLFFSVSGKLLRLEEQ 300
           LNSTGRKYDYFMKIEQDFNDGRYHEDDDKEDTPQELAIDLNHIKKLFFSVSGKLLRLEEQ
Sbjct: 241 LNSTGRKYDYFMKIEQDFNDGRYHEDDDKEDTPQELAIDLNHIKKLFFSVSGKLLRLEEQ 300

Query: 301 DSPVLVLKIDRSDDKENESSEGDKGLLDDITWYAVSGYEAIXXXXXXXXXXXXXXXXXXX 360
           DSPVLVLKIDRSDDKENESSEGDKGLLDDITWYAVSGYEAI                   
Sbjct: 301 DSPVLVLKIDRSDDKENESSEGDKGLLDDITWYAVSGYEAIEEDEEEDEEEDEEEGKDGE 360

Query: 361 XXXXXXXXXXXXXXXXSSITLLEYIIRLTSLQSNDQKSILEVSDERLSIYLNDENTNSRK 420
                           SSITLLEYIIRLTSLQSNDQKSILEVSDERLSIYLNDENTNSRK
Sbjct: 361 ERKEEEEEENKLEDKDSSITLLEYIIRLTSLQSNDQKSILEVSDERLSIYLNDENTNSRK 420

Query: 421 DRISNSTIEETEK 433
           DRISNSTIEETEK
Sbjct: 421 DRISNSTIEETEK 433

>Scas_668.17
          Length = 412

 Score =  435 bits (1118), Expect = e-151,   Method: Compositional matrix adjust.
 Identities = 230/417 (55%), Positives = 303/417 (72%), Gaps = 31/417 (7%)

Query: 1   MDEILAKAGSQAVTFAIKSGISIASTYALKTITNFVVQIPKDDARRIDQLKFKLESRMAI 60
           MD++LAKAGSQAVTFAI+SG+S+AS++A+KT+TNF+V IPK+DARRI+ L+ KLE+R+ I
Sbjct: 1   MDDLLAKAGSQAVTFAIRSGVSLASSFAIKTLTNFIVHIPKNDARRIESLRAKLENRIEI 60

Query: 61  VSSAIDLIKLVAARGNTNLQITLRLTKDLKEEIDRFDEKINEMTQKVEGSRSAKTQNEAI 120
           VSSAIDLIKLVAARGNTNL  TLRLTKDLK+EID FDEK+  +T+KV  S+S+K+Q EAI
Sbjct: 61  VSSAIDLIKLVAARGNTNLDSTLRLTKDLKQEIDSFDEKMKRLTEKVTTSKSSKSQEEAI 120

Query: 121 KAVENYIKDLLLRIEEITPFINLSLTTSGANLNSALPYQLSPGLLLKASDFVSENNRKYE 180
           K+VE YI+DLLLRIEE+TPFINLSL T+G +L++ALP Q+SPGLLL+AS+FVS +N    
Sbjct: 121 KSVEAYIEDLLLRIEEVTPFINLSLNTTGTSLSTALPQQVSPGLLLQASNFVSRSN---- 176

Query: 181 KAMKSNEKGTGDKEIL--KVQVGPTFEVTLFSIFYNLTSENNGQSGIVWKEDMKRAKARI 238
                      D +++  K++VGPTF+ T+FS+FYN++S  + ++ I W+EDMKRA  +I
Sbjct: 177 -----------DGKLIHGKLRVGPTFQATVFSVFYNMSSGADPKARITWREDMKRAFIKI 225

Query: 239 YRLNSTGRKYDYFMKIEQDFNDGRYHEDDDKEDTPQELAIDLNHIKKLFFSVSGKLLRLE 298
            R  S  ++++Y + IEQ F+DGRYH  +D E+ PQ+ A+D++ I+KLFFS+SGKLLRLE
Sbjct: 226 VRTESKEKEFEYQLIIEQSFDDGRYHNTEDGEEVPQKTALDISQIRKLFFSISGKLLRLE 285

Query: 299 EQDSPVLVLKIDRSDDKENESSEGDKGLLDDITWYAVSGYEAIXXXXXXXXXXXXXXXXX 358
           E+DSPVLVLK   +  KE    + D   L+ I WYA   +E                   
Sbjct: 286 ERDSPVLVLKTVSTQKKEKNKEKND---LESILWYAFGLFEE-----------DEESDDS 331

Query: 359 XXXXXXXXXXXXXXXXXXSSITLLEYIIRLTSLQSNDQKSILEVSDERLSIYLNDEN 415
                             SSI+LLEYIIRL SLQ +DQKSIL+++DERLSIYLNDE+
Sbjct: 332 DEEKEAGELEEQVKSDYSSSISLLEYIIRLVSLQEDDQKSILDINDERLSIYLNDES 388

>CAGL0I04202g complement(368221..369498) highly similar to sp|P53107
           Saccharomyces cerevisiae YGL164c, start by similarity
          Length = 425

 Score =  427 bits (1097), Expect = e-148,   Method: Compositional matrix adjust.
 Identities = 235/429 (54%), Positives = 300/429 (69%), Gaps = 20/429 (4%)

Query: 1   MDEILAKAGSQAVTFAIKSGISIASTYALKTITNFVVQIPKDDARRIDQLKFKLESRMAI 60
           MDEILAKAGSQAVTFAIKSG+SIASTYA+KTIT F+++IPKDDA+RI++L+ KL++R+ I
Sbjct: 1   MDEILAKAGSQAVTFAIKSGVSIASTYAIKTITGFILKIPKDDAKRIEKLRIKLQNRIEI 60

Query: 61  VSSAIDLIKLVAARGNTNLQITLRLTKDLKEEIDRFDEKINEMTQKVEGSRSAKTQNEAI 120
           VS AIDLI+LVAARGNTNL+ TLRLT DL+ EID+FD+KI+E+T+KVEGSR+AKTQ ++I
Sbjct: 61  VSYAIDLIRLVAARGNTNLESTLRLTSDLRVEIDQFDDKIHELTEKVEGSRTAKTQKDSI 120

Query: 121 KAVENYIKDLLLRIEEITPFINLSLTTSGANLNSALPYQLSPGLLLKASDFVSENNRKYE 180
            AVE YIKDLL RIEEITPFINLSLTTSGANL+S L   +SPGLLL AS++V +NN  + 
Sbjct: 121 NAVELYIKDLLDRIEEITPFINLSLTTSGANLSSNLTNTVSPGLLLSASNYVVKNNDMF- 179

Query: 181 KAMKSNEKGTGDKEILKVQVGPTFEVTLFSIFYNLTSENNGQSGIVWKEDMKRAKARIYR 240
                     G+     VQVGPTFE T FS+FY+L SE +    + WKEDMKR   RI R
Sbjct: 180 ---------AGE----DVQVGPTFETTYFSVFYHLPSEKHNNIRVTWKEDMKRGITRIIR 226

Query: 241 LNSTGRKYDYFMKIEQDFNDGRYHEDDDKEDTPQELAIDLNHIKKLFFSVSGKLLRLEEQ 300
                 K++Y ++I+Q F+DGRYH  ++ E+ P+ L +++  I KLFFSVSGKLL+L E+
Sbjct: 227 RKDETNKFNYVLRIDQSFDDGRYHNTENDEEKPRSLEMNICQIVKLFFSVSGKLLKLPER 286

Query: 301 DSPVLVLKIDRSDDKENESSEGDKGLLDDITWYAVSGYEAIXXXXXXXXXXXXXXXXXXX 360
           DSPVLV+K D++   +   S       +DI W+A+  YE+                    
Sbjct: 287 DSPVLVIKTDKNIKGKGIHSNSST---EDIEWFALGSYESTDSDSSSDEDSSDEDNSANY 343

Query: 361 X-XXXXXXXXXXXXXXXSSITLLEYIIRLTSLQSNDQKSILEVSDERLSIYLNDENTNSR 419
                            SSI+LLEYI+RL SLQ ND  SILEV DERLS+YLNDEN N+ 
Sbjct: 344 EDANSSNSNIIPSNERSSSISLLEYILRLVSLQFNDDMSILEVKDERLSVYLNDENPNAI 403

Query: 420 KDRISNSTI 428
           ++  +NS+I
Sbjct: 404 RE--TNSSI 410

>Sklu_1546.1 YGL164C, Contig c1546 317-1606 reverse complement
          Length = 429

 Score =  370 bits (951), Expect = e-125,   Method: Compositional matrix adjust.
 Identities = 194/344 (56%), Positives = 258/344 (75%), Gaps = 30/344 (8%)

Query: 1   MDEILAKAGSQAVTFAIKSGISIASTYALKTITNFVVQIPKDDARRIDQLKFKLESRMAI 60
           MDEILAKAGSQAVTFAIKSGIS+AS+YA+KT+ NF+ +IPKDDA R+++L+ KLE+R+ I
Sbjct: 1   MDEILAKAGSQAVTFAIKSGISLASSYAIKTVANFLTKIPKDDAARLERLRKKLETRIEI 60

Query: 61  VSSAIDLIKLVAARGNTNLQITLRLTKDLKEEIDRFDEKINEMTQKVEGSRSAKTQNEAI 120
           VS AIDLIKLVAA+GNTNL  TLRLTKDLKEEID FD +I E+T+       AKTQ  +I
Sbjct: 61  VSPAIDLIKLVAAKGNTNLGSTLRLTKDLKEEIDSFDNRIAEITKNY----GAKTQRASI 116

Query: 121 KAVENYIKDLLLRIEEITPFINLSLTTSGANLNSALPYQLSPGLLLKASDFVSENNRKYE 180
            AVENYI+DLL RIEE+ P INLSLTTSGA+L++ALP  +SPG LL ASD++S+NN ++ 
Sbjct: 117 DAVENYIRDLLSRIEEVIPLINLSLTTSGASLSAALPQHVSPGSLLHASDYISKNNTQF- 175

Query: 181 KAMKSNEKGTGDKEILKVQVGPTFEVTLFSIFYNLTS---ENNGQSGIVWKEDMKRAKAR 237
                   G  D+     QVGPTFE+TLFSIFY++ +   + + ++ I WKEDMK+A   
Sbjct: 176 -------NGKDDR-----QVGPTFELTLFSIFYHIVTPDGQEDSRTRITWKEDMKKAIVT 223

Query: 238 IYRLNSTGRKYDYFMKIEQDFNDGRYHEDDDKEDTPQELAIDLNHIKKLFFSVSGKLLRL 297
           ++R +++ + YDY++KI + F+DGRYH  D KE+TP+ + +D+  I +LFFS SGKLL+L
Sbjct: 224 LWRRHNSKQDYDYYLKIRESFDDGRYH--DLKEETPKVINVDIYQIIRLFFSASGKLLKL 281

Query: 298 EEQDSPVLVLKID---RSDDKENESSEGDKGLLDDITWYAVSGY 338
           EE++SPVLVLK+D   RS  KE+ ++       +DI W+A+  Y
Sbjct: 282 EERNSPVLVLKVDSNLRSSFKEDHATST-----EDIEWFALGEY 320

 Score = 51.6 bits (122), Expect = 6e-07,   Method: Compositional matrix adjust.
 Identities = 25/32 (78%), Positives = 27/32 (84%)

Query: 389 TSLQSNDQKSILEVSDERLSIYLNDENTNSRK 420
           TSLQ NDQ SIL+V DERLS+YLNDEN NS K
Sbjct: 377 TSLQCNDQMSILQVHDERLSLYLNDENPNSIK 408

>AEL296W [2209] [Homologous to ScYGL164C - SH]
           complement(86307..87626) [1320 bp, 439 aa]
          Length = 439

 Score =  296 bits (759), Expect = 1e-96,   Method: Compositional matrix adjust.
 Identities = 183/438 (41%), Positives = 260/438 (59%), Gaps = 43/438 (9%)

Query: 1   MDEILAKAGSQAVTFAIKSGISIASTYALKTITNFVVQIPKDDARRIDQLKFKLESRMAI 60
           MDE+L++AGSQAV+FAIKS +S+ASTYA+K  T F+  +P+ DA R+ +L+ +LE+R+ I
Sbjct: 1   MDELLSRAGSQAVSFAIKSSVSLASTYAIKQFTKFLTGVPQQDASRLQKLRRQLETRIDI 60

Query: 61  VSSAIDLIKLVAARGNTNLQITLRLTKDLKEEIDRFDEKINEMTQ-----KVEGSRSAKT 115
           +++AI LIKL   RGNTNL+ TL L  DLK+E+  F+  +  ++      K+  S++ K 
Sbjct: 61  INNAIVLIKLCVVRGNTNLKSTLSLILDLKDELAEFNGDMEMLSSASVAGKLPASKNGKA 120

Query: 116 QNEAIKAVENYIKDLLLRIEEITPFINLSLTTSGANLNSALPYQLSPGLLLKASDFVSEN 175
             +A+  +E  + +L+ RIE + P INLS+TTSG + +  LP  +SP LLL+AS++V   
Sbjct: 121 GVDAVSLMEAKMSELIHRIELVIPLINLSMTTSGVSSSMKLPSNVSPSLLLQASNYV--- 177

Query: 176 NRKYEKAMKSNEKGTGDKEILKVQVGPTFEVTLFSIFYNLTSENNGQSGIVWKEDMKRAK 235
                  +KSNE+   D     VQVGP F VT++ IF       +  S I+WKE M R  
Sbjct: 178 -------VKSNEQALADNYEKDVQVGPLFSVTVYDIF-------DKSSKIIWKETMARCD 223

Query: 236 ARIYRLNST----GRKYDYFMKIEQDFNDGRYHEDDDKEDTPQELAIDLNHIKKLFFSVS 291
            RI R++S     G +Y+Y ++++++F+D RYH  D KED P++L  ++  I +LFF++S
Sbjct: 224 LRIVRISSNIPDRGVEYNYHLELKENFDDDRYH--DIKEDKPRKLHWNVEQITRLFFTMS 281

Query: 292 GKLLRLEEQDSPVLVLKIDRSDDKENESSEGDKGLLDDITWYAVSGYEAIXXXXXXXXXX 351
           GKLL LEE+DSPVLVLK+ +S     ES E ++ L     W AV  YE            
Sbjct: 282 GKLLNLEERDSPVLVLKLVKS--LGGESGESNESL----HWLAVGEYEPASDLRDSDDDI 335

Query: 352 XXXXXXXXXXXXXXXXXXXXXXXXXSSIT---------LLEYIIRLTSLQSNDQKSILEV 402
                                       T         LLEYII+LTSLQ++DQ SIL+V
Sbjct: 336 PSPANADAEAPGQDSDNEDSYDSAQEDGTELEISSSLSLLEYIIKLTSLQNHDQASILDV 395

Query: 403 SDERLSIYLNDENTNSRK 420
            DERLS+YLNDEN NS K
Sbjct: 396 KDERLSLYLNDENPNSVK 413

>Kwal_14.1542
          Length = 204

 Score =  133 bits (334), Expect = 1e-36,   Method: Compositional matrix adjust.
 Identities = 80/195 (41%), Positives = 111/195 (56%), Gaps = 7/195 (3%)

Query: 231 MKRAKARIYRLNSTGRKYDYFMKIEQDFNDGRYHEDDDKEDTPQELAIDLNHIKKLFFSV 290
           M++A   ++R +   R+YDYF+++++ FNDGRYH  D +++TP+    D+  I KLFF+ 
Sbjct: 1   MRKALVTVWRKSIGDREYDYFIRLKESFNDGRYH--DPEQETPKLKERDIWQITKLFFTA 58

Query: 291 SGKLLRLEEQDSPVLVLKIDRSDDKENESSEGDKGLLDDITWYAVSGYEAIXXXXXXXXX 350
           SGKLL+LEE++SPVLVLK+D+  D ++  +E      +D+ W A   +            
Sbjct: 59  SGKLLKLEERNSPVLVLKVDK--DIKSPFAEDHGTSTEDVEWLA---FGECDFEADLEES 113

Query: 351 XXXXXXXXXXXXXXXXXXXXXXXXXXSSITLLEYIIRLTSLQSNDQKSILEVSDERLSIY 410
                                      SI LLEYIIRL SLQ NDQ SIL+V DERLS+Y
Sbjct: 114 SESEAEDEGDDESNYEETTESPVPVSDSIALLEYIIRLASLQCNDQLSILQVHDERLSMY 173

Query: 411 LNDENTNSRKDRISN 425
           LNDEN NS K +  N
Sbjct: 174 LNDENPNSIKSKRYN 188

>YLR086W (SMC4) [3501] chr12 (302244..306500) Subunit of condensin
            protein complex required for proper chromosome
            condensation and segregation, coiled-coil protein of the
            SMC family [4257 bp, 1418 aa]
          Length = 1418

 Score = 30.4 bits (67), Expect = 3.3,   Method: Compositional matrix adjust.
 Identities = 23/96 (23%), Positives = 47/96 (48%), Gaps = 10/96 (10%)

Query: 58   MAIVSSAIDLIKLVAARGNTNLQITLRLTKDLKEEIDRFDEKINEMTQKVEGSRSAKTQN 117
            + ++   +   KL  A  +TN+  TL L  +LKE+ ++  E++ +M + +         N
Sbjct: 1030 LKVIEEQLKHTKLALAENDTNMNETLNLKVELKEQSEQLKEQMEDMEESI---------N 1080

Query: 118  EAIKAVENYIKDLLLRIEEITPFINLSLTTSGANLN 153
            E  K++E  +K+ L ++  +  +I   +T     LN
Sbjct: 1081 E-FKSIEIEMKNKLEKLNSLLTYIKSEITQQEKGLN 1115

>Kwal_33.14960
          Length = 757

 Score = 30.0 bits (66), Expect = 4.5,   Method: Compositional matrix adjust.
 Identities = 35/158 (22%), Positives = 75/158 (47%), Gaps = 11/158 (6%)

Query: 32  ITNFVVQIPKDDAR------RIDQLKFKLESRMAIVSSAIDLIKLVAARGNTNLQITLRL 85
           IT  +V + ++D+        ++QL+ +L  + +IV S I  +  +A++   ++++    
Sbjct: 599 ITPHLVNLRENDSELHSKLGELEQLRDQLVEKRSIVLSDISELDSLASKLKYDVRLLDNR 658

Query: 86  TKDLKEEIDRFDEKINEMTQKVEGSRSAKTQNEAI----KAVENYIKDLLLRIEEI-TPF 140
           T+D++E I +F  K+N +   +E  R  +    +     K +  Y K++L R     +  
Sbjct: 659 TRDVEERILQFGSKLNSIAALMEDKRVCQLMTSSFYSNPKKLVRYEKEILERAGRFKSQG 718

Query: 141 INLSLTTSGANLNSALPYQLSPGLLLKASDFVSENNRK 178
           + L+L     N++S +  +L    L     FV + + K
Sbjct: 719 VILNLWKHAKNMSSPILGELHHVWLYFCDKFVPQGHFK 756

>Kwal_23.5206
          Length = 932

 Score = 29.3 bits (64), Expect = 8.3,   Method: Compositional matrix adjust.
 Identities = 23/64 (35%), Positives = 36/64 (56%), Gaps = 7/64 (10%)

Query: 12  AVTFAIKSGISIASTYALKTITNFVVQIPKD------DARRIDQLKFKLESRMAIVSSAI 65
           A+T  +K+G S   +  +KTITNF+ +I  D      DA R   LKF  E + +I+   I
Sbjct: 359 AITSLLKTGTSNNISSLIKTITNFIHEISDDFKIIIIDAVRTMALKFPEEWK-SILGFLI 417

Query: 66  DLIK 69
           +++K
Sbjct: 418 NVLK 421

  Database: blastdb
    Posted date:  Apr 3, 2006  3:33 PM
  Number of letters in database: 16,596,109
  Number of sequences in database:  34,618
  
Lambda     K      H
   0.312    0.131    0.346 

Gapped
Lambda     K      H
   0.267   0.0410    0.140 

Matrix: BLOSUM62
Gap Penalties: Existence: 11, Extension: 1
Number of Sequences: 34618
Number of Hits to DB: 13,171,863
Number of extensions: 584476
Number of successful extensions: 2347
Number of sequences better than 10.0: 58
Number of HSP's gapped: 2331
Number of HSP's successfully gapped: 63
Length of query: 433
Length of database: 16,596,109
Length adjustment: 105
Effective length of query: 328
Effective length of database: 12,961,219
Effective search space: 4251279832
Effective search space used: 4251279832
Neighboring words threshold: 11
Window for multiple hits: 40
X1: 16 ( 7.2 bits)
X2: 38 (14.6 bits)
X3: 64 (24.7 bits)
S1: 42 (21.9 bits)
S2: 63 (28.9 bits)