Hit NameLength (aa)HSP LengthHSP ScoreHSP Significance
YGL163C (RAD54)89888345680.0
Scas_668.1887588335860.0
CAGL0I04224g94294533030.0
KLLA0A03069g89590830170.0
AEL297W89592229300.0
Kwal_14.153784285725940.0
KLLA0F11814g93162710411e-127
Scas_718.409266339931e-120
AGL212W9036569691e-117
Kwal_27.105139006159621e-116
YBR073W (RDH54)9246249521e-114
CAGL0M01958g9206389401e-112
CAGL0I01694g10715406893e-76
Scas_549.410795376866e-76
KLLA0E22726g10335446794e-75
Sklu_2125.310525316761e-74
AEL065C10255676715e-74
YJR035W (RAD26)10855356416e-70
Scas_652.1710254925931e-63
YOR304W (ISW2)11204915932e-63
CAGL0I09614g10395745903e-63
CAGL0C01683g11154885903e-63
CAGL0M04807g17304835722e-60
KLLA0F24838g10624835682e-60
Scas_665.1710605585656e-60
Kwal_34.1592510254905638e-60
YOR290C (SNF2)17034835651e-59
Kwal_34.160827264735511e-59
Kwal_14.160011025295612e-59
KLLA0F06710g10964875532e-58
YER164W (CHD1)14684815543e-58
Scas_662.713424865543e-58
YBR245C (ISW1)11294875523e-58
Kwal_26.916414544835543e-58
Kwal_23.477713014895524e-58
Scas_594.717034835534e-58
KLLA0F04521g13444885524e-58
CAGL0L11770g14764775509e-58
AER375C12884825499e-58
Scas_597.810654945471e-57
AFR562C14444845463e-57
KLLA0E23804g18735425454e-57
KLLA0C17578g15254875445e-57
AFR537W10254865416e-57
Kwal_56.2344214354815436e-57
AFL040W10864875408e-57
YIL126W (STH1)13594835383e-56
KLLA0B08327g15344845374e-56
Scas_576.614574815365e-56
CAGL0H05533g19045345277e-55
AEL256C18665625232e-54
AGR123C14224815196e-54
CAGL0G08756g13544845161e-53
YPL082C (MOT1)18675615054e-52
Scas_664.918595415021e-51
ADL098C8045194896e-51
ACR286C10192693047e-28
CAGL0M01188g14501523012e-27
Sklu_1582.22831712822e-27
ADR309W14861752984e-27
Scas_520.58632582956e-27
KLLA0F07513g10482622966e-27
CAGL0H06193g11261562959e-27
YDR334W15141512951e-26
Scas_548.410541512932e-26
Scas_646.3*14561522932e-26
CAGL0E05038g14841562922e-26
KLLA0E08965g14891562922e-26
YFR038W8532612903e-26
KLLA0E04048g8262622884e-26
YGL150C (INO80)14891562895e-26
KLLA0F21758g15721712895e-26
CAGL0J02662g8442562859e-26
Kwal_55.2014314941542871e-25
YAL019W (FUN30)11311632842e-25
Kwal_26.712310812782832e-25
AGR379W14141552842e-25
Kwal_47.180778091642822e-25
Scas_669.2013971562814e-25
Kwal_27.1138813343022805e-25
AAR147W15801472422e-20
AFR220W10851602332e-19
Kwal_47.177719721812323e-19
CAGL0A03432g11511772224e-18
CAGL0G09493g14081902224e-18
Scas_721.10011371772181e-17
KLLA0F17479g11141782181e-17
CAGL0K07766g8301722153e-17
Kwal_23.36607681512109e-17
Kwal_14.186813571522091e-16
ADL345C7461742081e-16
YBR114W (RAD16)7901722081e-16
KLLA0B09240g8001722072e-16
YLR032W (RAD5)11691782072e-16
Scas_591.107721732063e-16
KLLA0C05368g16051392002e-15
YOR191W (RIS1)16191682002e-15
Sklu_2412.711271621902e-14
Scas_674.12d13231481875e-14
KLLA0F12166g15281961421e-08
AAL030C15391241384e-08
Kwal_14.128715181501366e-08
YLR247C15561561359e-08
Scas_573.91502651232e-06
CAGL0B05049g1470651204e-06
Sklu_2234.210061251027e-04
Sklu_2432.9147565990.001
KLLA0F23716g554153790.25
CAGL0L10230g37756731.4
YML091C (RPM2)120245712.5
Kwal_34.1608029042702.7
CAGL0C03399g47833685.6
KLLA0D08932g278135676.4
BLASTP 2.2.26 [Sep-21-2011]

Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, 
Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), 
"Gapped BLAST and PSI-BLAST: a new generation of protein database search
programs",  Nucleic Acids Res. 25:3389-3402.

Reference for compositional score matrix adjustment: Altschul, Stephen F., 
John C. Wootton, E. Michael Gertz, Richa Agarwala, Aleksandr Morgulis,
Alejandro A. Schaffer, and Yi-Kuo Yu (2005) "Protein database searches
using compositionally adjusted substitution matrices", FEBS J. 272:5101-5109.

Query= YGL163C
         (883 letters)

Database: blastdb 
           34,618 sequences; 16,596,109 total letters

Searching..................................................done

                                                                 Score    E
Sequences producing significant alignments:                      (bits) Value

YGL163C (RAD54) [1826] chr7 complement(193711..196407) DNA-depen...  1764   0.0  
Scas_668.18                                                          1385   0.0  
CAGL0I04224g complement(369858..372686) highly similar to sp|P32...  1276   0.0  
KLLA0A03069g complement(271516..274203) similar to sp|P32863 Sac...  1166   0.0  
AEL297W [2208] [Homologous to ScYGL163C (RAD54) - SH] complement...  1133   0.0  
Kwal_14.1537                                                         1003   0.0  
KLLA0F11814g complement(1089699..1092494) similar to sp|P38086 S...   405   e-127
Scas_718.40                                                           387   e-120
AGL212W [4100] [Homologous to ScYBR073W (RDH54) - SH] complement...   377   e-117
Kwal_27.10513                                                         375   e-116
YBR073W (RDH54) [263] chr2 (383172..385946) Protein required for...   371   e-114
CAGL0M01958g complement(238113..240875) similar to sp|P38086 Sac...   366   e-112
CAGL0I01694g complement(141422..144637) similar to sp|P40352 Sac...   270   3e-76
Scas_549.4                                                            268   6e-76
KLLA0E22726g complement(2018248..2021349) similar to sp|P40352 S...   266   4e-75
Sklu_2125.3 YJR035W, Contig c2125 6474-9632                           265   1e-74
AEL065C [2441] [Homologous to ScYJR035W (RAD26) - SH] (511520..5...   263   5e-74
YJR035W (RAD26) [2931] chr10 (497269..500526) Putative helicase ...   251   6e-70
Scas_652.17                                                           233   1e-63
YOR304W (ISW2) [5088] chr15 (884510..887872) Protein required fo...   233   2e-63
CAGL0I09614g 917707..920826 highly similar to tr|Q08773 Saccharo...   231   3e-63
CAGL0C01683g 178695..182042 highly similar to sp|P38144 Saccharo...   231   3e-63
CAGL0M04807g complement(514847..520039) similar to sp|P22082 Sac...   224   2e-60
KLLA0F24838g complement(2309842..2313030) similar to sgd|S000583...   223   2e-60
Scas_665.17                                                           222   6e-60
Kwal_34.15925                                                         221   8e-60
YOR290C (SNF2) [5074] chr15 complement(855144..860255) Component...   222   1e-59
Kwal_34.16082                                                         216   1e-59
Kwal_14.1600                                                          220   2e-59
KLLA0F06710g 645650..648940 similar to sp|P38144 Saccharomyces c...   217   2e-58
YER164W (CHD1) [1592] chr5 (505387..509793) Protein involved in ...   218   3e-58
Scas_662.7                                                            218   3e-58
YBR245C (ISW1) [424] chr2 complement(708107..711496) Putative AT...   217   3e-58
Kwal_26.9164                                                          218   3e-58
Kwal_23.4777                                                          217   4e-58
Scas_594.7                                                            217   4e-58
KLLA0F04521g complement(435649..439683) similar to sp|P32597 Sac...   217   4e-58
CAGL0L11770g 1254125..1258555 highly similar to sp|P32657 Saccha...   216   9e-58
AER375C [2876] [Homologous to ScYIL126W (STH1) - SH] (1332505..1...   216   9e-58
Scas_597.8                                                            215   1e-57
AFR562C [3754] [Homologous to ScYOR290C (SNF2) - SH] (1439983..1...   214   3e-57
KLLA0E23804g 2108059..2113680 similar to sp|P32333 Saccharomyces...   214   4e-57
KLLA0C17578g 1547890..1552467 similar to sp|P32657 Saccharomyces...   214   5e-57
AFR537W [3729] [Homologous to ScYOR304W (ISW2) - SH] complement(...   213   6e-57
Kwal_56.23442                                                         213   6e-57
AFL040W [3153] [Homologous to ScYBR245C (ISW1) - SH] complement(...   212   8e-57
YIL126W (STH1) [2550] chr9 (117992..122071) Component of abundan...   211   3e-56
KLLA0B08327g 742205..746809 similar to sp|P22082 Saccharomyces c...   211   4e-56
Scas_576.6                                                            211   5e-56
CAGL0H05533g 538045..543759 highly similar to sp|P32333 Saccharo...   207   7e-55
AEL256C [2250] [Homologous to ScYPL082C (MOT1) - SH] (156109..16...   206   2e-54
AGR123C [4434] [Homologous to ScYER164W (CHD1) - SH] (980963..98...   204   6e-54
CAGL0G08756g complement(829778..833842) highly similar to sp|P32...   203   1e-53
YPL082C (MOT1) [5362] chr16 complement(398475..404078) Transcrip...   199   4e-52
Scas_664.9                                                            197   1e-51
ADL098C [1643] [Homologous to ScYFR038W (MEI4) - SH] (508448..51...   192   6e-51
ACR286C [1333] [Homologous to ScYAL019W (FUN30) - SH] (877337..8...   121   7e-28
CAGL0M01188g complement(132330..136682) similar to sp|Q05471 Sac...   120   2e-27
Sklu_1582.2 , Contig c1582 197-1048                                   113   2e-27
ADR309W [2050] [Homologous to ScYDR334W (SWR1) - SH] complement(...   119   4e-27
Scas_520.5                                                            118   6e-27
KLLA0F07513g 707516..710662 similar to sp|P31380 Saccharomyces c...   118   6e-27
CAGL0H06193g 604422..607802 similar to sp|P31380 Saccharomyces c...   118   9e-27
YDR334W (SWR1) [1163] chr4 (1135923..1140467) Member of the Snf2...   118   1e-26
Scas_548.4                                                            117   2e-26
Scas_646.3*                                                           117   2e-26
CAGL0E05038g 488549..493003 similar to sp|P53115 Saccharomyces c...   117   2e-26
KLLA0E08965g complement(797861..802330) similar to sp|P53115 Sac...   117   2e-26
YFR038W (YFR038W) [1720] chr6 (229367..231928) Member of the Snf...   116   3e-26
KLLA0E04048g 375999..378479 similar to sp|P43610 Saccharomyces c...   115   4e-26
YGL150C (INO80) [1838] chr7 complement(221107..225576) Member of...   115   5e-26
KLLA0F21758g complement(2023805..2028523) similar to sp|Q05471 S...   115   5e-26
CAGL0J02662g 261909..264443 similar to sp|P43610 Saccharomyces c...   114   9e-26
Kwal_55.20143                                                         115   1e-25
YAL019W (FUN30) [49] chr1 (114922..118317) Member of the Snf2p f...   114   2e-25
Kwal_26.7123                                                          113   2e-25
AGR379W [4690] [Homologous to ScYGL150C (INO80) - SH] complement...   114   2e-25
Kwal_47.18077                                                         113   2e-25
Scas_669.20                                                           112   4e-25
Kwal_27.11388                                                         112   5e-25
AAR147W [335] [Homologous to ScYOR191W (RIS1) - SH] complement(6...    98   2e-20
AFR220W [3412] [Homologous to ScYLR032W (RAD5) - SH] complement(...    94   2e-19
Kwal_47.17771                                                          94   3e-19
CAGL0A03432g 345192..348647 similar to sp|P32849 Saccharomyces c...    90   4e-18
CAGL0G09493g complement(902228..906454) similar to tr|Q08562 Sac...    90   4e-18
Scas_721.100                                                           89   1e-17
KLLA0F17479g complement(1601287..1604631) similar to sp|P32849 S...    89   1e-17
CAGL0K07766g 770935..773427 highly similar to sp|P31244 Saccharo...    87   3e-17
Kwal_23.3660                                                           86   9e-17
Kwal_14.1868                                                           85   1e-16
ADL345C [1395] [Homologous to ScYBR114W (RAD16) - SH] (100332..1...    85   1e-16
YBR114W (RAD16) [303] chr2 (467204..469576) Nucleotide excision ...    85   1e-16
KLLA0B09240g complement(810178..812580) similar to sp|P31244 Sac...    84   2e-16
YLR032W (RAD5) [3450] chr12 (204992..208501) Single-stranded DNA...    84   2e-16
Scas_591.10                                                            84   3e-16
KLLA0C05368g 481598..486415 some similarities with sgd|S0005717 ...    82   2e-15
YOR191W (RIS1) [4987] chr15 (692475..697334) Protein involved in...    82   2e-15
Sklu_2412.7 YLR032W, Contig c2412 15481-18864                          78   2e-14
Scas_674.12d                                                           77   5e-14
KLLA0F12166g complement(1116715..1121301) weakly similar to sgd|...    59   1e-08
AAL030C [157] [Homologous to ScYLR247C - SH] (284758..289377) [4...    58   4e-08
Kwal_14.1287                                                           57   6e-08
YLR247C (YLR247C) [3643] chr12 complement(628686..633356) Protei...    57   9e-08
Scas_573.9                                                             52   2e-06
CAGL0B05049g 487186..491598 some similarities with tr|Q06554 Sac...    51   4e-06
Sklu_2234.2 YOR191W, Contig c2234 6350-9366 reverse complement         44   7e-04
Sklu_2432.9 , Contig c2432 20306-24733 reverse complement              43   0.001
KLLA0F23716g join(complement(2216857..2218129), some similaritie...    35   0.25 
CAGL0L10230g 1098614..1099747 similar to sp|Q08446 Saccharomyces...    33   1.4  
YML091C (RPM2) [3880] chr13 complement(87123..90731) Bifunctiona...    32   2.5  
Kwal_34.16080                                                          32   2.7  
CAGL0C03399g 341755..343191 similar to sp|P39008 Saccharomyces c...    31   5.6  
KLLA0D08932g 751943..752779 similar to sp|P09064 Saccharomyces c...    30   6.4  

>YGL163C (RAD54) [1826] chr7 complement(193711..196407)
           DNA-dependent ATPase of the Snf2p family, required for
           mitotic recombination and DNA repair of X-ray damage
           [2697 bp, 898 aa]
          Length = 898

 Score = 1764 bits (4568), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 853/883 (96%), Positives = 853/883 (96%)

Query: 1   MARRRLPDRPPNGIGAGERPRLVPRPINVQDSVNRLTKPFRVPYKNTHIPPAAGRIATGS 60
           MARRRLPDRPPNGIGAGERPRLVPRPINVQDSVNRLTKPFRVPYKNTHIPPAAGRIATGS
Sbjct: 1   MARRRLPDRPPNGIGAGERPRLVPRPINVQDSVNRLTKPFRVPYKNTHIPPAAGRIATGS 60

Query: 61  DNIVGGRSLRKRSATVCYSGLDINADEAEYNSQDISFSQLTKRRKDALSAQRLAKDPTRL 120
           DNIVGGRSLRKRSATVCYSGLDINADEAEYNSQDISFSQLTKRRKDALSAQRLAKDPTRL
Sbjct: 61  DNIVGGRSLRKRSATVCYSGLDINADEAEYNSQDISFSQLTKRRKDALSAQRLAKDPTRL 120

Query: 121 SHIQYTLRRSFTVPIKGYVQRHSLPLTLGMKKKITPEPRPLHDPTDEFAIVLYDPSVDGE 180
           SHIQYTLRRSFTVPIKGYVQRHSLPLTLGMKKKITPEPRPLHDPTDEFAIVLYDPSVDGE
Sbjct: 121 SHIQYTLRRSFTVPIKGYVQRHSLPLTLGMKKKITPEPRPLHDPTDEFAIVLYDPSVDGE 180

Query: 181 MIVHDTSMDNKEEESKKMIKSTQEKDNINKEKNSQEERPTQRIGRHPALMTNGVRNKPLR 240
           MIVHDTSMDNKEEESKKMIKSTQEKDNINKEKNSQEERPTQRIGRHPALMTNGVRNKPLR
Sbjct: 181 MIVHDTSMDNKEEESKKMIKSTQEKDNINKEKNSQEERPTQRIGRHPALMTNGVRNKPLR 240

Query: 241 ELLGDSENSAENKKKFASVPVVIDPKLAKILRPHQVEGVRFLYRCVTGLVMKDYLEAEAF 300
           ELLGDSENSAENKKKFASVPVVIDPKLAKILRPHQVEGVRFLYRCVTGLVMKDYLEAEAF
Sbjct: 241 ELLGDSENSAENKKKFASVPVVIDPKLAKILRPHQVEGVRFLYRCVTGLVMKDYLEAEAF 300

Query: 301 NTSSEDPLKSDEKALTESQKTEQNNRGAYGCIMADEMGLGKTLQCIALMWTLLRQGPQGK 360
           NTSSEDPLKSDEKALTESQKTEQNNRGAYGCIMADEMGLGKTLQCIALMWTLLRQGPQGK
Sbjct: 301 NTSSEDPLKSDEKALTESQKTEQNNRGAYGCIMADEMGLGKTLQCIALMWTLLRQGPQGK 360

Query: 361 RLIDKCIIVCPSSLVNNWANELIKWLGPNTLTPLAVDGKKSSMGGGNTTVSQAIHAWAQA 420
           RLIDKCIIVCPSSLVNNWANELIKWLGPNTLTPLAVDGKKSSMGGGNTTVSQAIHAWAQA
Sbjct: 361 RLIDKCIIVCPSSLVNNWANELIKWLGPNTLTPLAVDGKKSSMGGGNTTVSQAIHAWAQA 420

Query: 421 QGRNIVKPVLIISYETLRRNVDQLKNCNVGLMLADEGHRLKNGDSLTFTALDSISCPRRV 480
           QGRNIVKPVLIISYETLRRNVDQLKNCNVGLMLADEGHRLKNGDSLTFTALDSISCPRRV
Sbjct: 421 QGRNIVKPVLIISYETLRRNVDQLKNCNVGLMLADEGHRLKNGDSLTFTALDSISCPRRV 480

Query: 481 ILSGTPIQNDLSEYFALLSFSNPGLLGSRAEFRKNFENPILRGRDADATDKEITKGEAQL 540
           ILSGTPIQNDLSEYFALLSFSNPGLLGSRAEFRKNFENPILRGRDADATDKEITKGEAQL
Sbjct: 481 ILSGTPIQNDLSEYFALLSFSNPGLLGSRAEFRKNFENPILRGRDADATDKEITKGEAQL 540

Query: 541 QKLSTIVSKFIIRRTNDILAKYLPCKYEHVIFVNLKPLQNELYNKLIKSREXXXXXXXXX 600
           QKLSTIVSKFIIRRTNDILAKYLPCKYEHVIFVNLKPLQNELYNKLIKSRE         
Sbjct: 541 QKLSTIVSKFIIRRTNDILAKYLPCKYEHVIFVNLKPLQNELYNKLIKSREVKKVVKGVG 600

Query: 601 XSQPLRAIGILKKLCNHPXXXXXXXXXXXXXXXXXXXXYNMPGSKARDVQTKYSAKFSIL 660
            SQPLRAIGILKKLCNHP                    YNMPGSKARDVQTKYSAKFSIL
Sbjct: 601 GSQPLRAIGILKKLCNHPNLLNFEDEFDDEDDLELPDDYNMPGSKARDVQTKYSAKFSIL 660

Query: 661 ERFLHKIKTESDDKIVLISNYTQTLDLIEKMCRYKHYSAVRLDGTMSINKRQKLVDRFND 720
           ERFLHKIKTESDDKIVLISNYTQTLDLIEKMCRYKHYSAVRLDGTMSINKRQKLVDRFND
Sbjct: 661 ERFLHKIKTESDDKIVLISNYTQTLDLIEKMCRYKHYSAVRLDGTMSINKRQKLVDRFND 720

Query: 721 PEGQEFIFLLSSKAGGCGINLIGANRLILMDPDWNPAADQQALARVWRDGQKKDCFIYRF 780
           PEGQEFIFLLSSKAGGCGINLIGANRLILMDPDWNPAADQQALARVWRDGQKKDCFIYRF
Sbjct: 721 PEGQEFIFLLSSKAGGCGINLIGANRLILMDPDWNPAADQQALARVWRDGQKKDCFIYRF 780

Query: 781 ISTGTIEEKIFQRQSMKMSLSSCVVDAKEDVERLFSSDNLRQLFQKNENTICETHETYHC 840
           ISTGTIEEKIFQRQSMKMSLSSCVVDAKEDVERLFSSDNLRQLFQKNENTICETHETYHC
Sbjct: 781 ISTGTIEEKIFQRQSMKMSLSSCVVDAKEDVERLFSSDNLRQLFQKNENTICETHETYHC 840

Query: 841 KRCNAQGKQLKRAPAMLYGDATTWNHLNHDALEKTNDHLLKNE 883
           KRCNAQGKQLKRAPAMLYGDATTWNHLNHDALEKTNDHLLKNE
Sbjct: 841 KRCNAQGKQLKRAPAMLYGDATTWNHLNHDALEKTNDHLLKNE 883

>Scas_668.18
          Length = 875

 Score = 1385 bits (3586), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 677/883 (76%), Positives = 747/883 (84%), Gaps = 23/883 (2%)

Query: 1   MARRRLPDRPPNGIGAGERPRLVPRPINVQDSVNRLTKPFRVPYKNTHIPPAAGRIATGS 60
           MARR+LPDRPPNGIG G+RPRLVPRPINVQ+S++ L+KPF+VPYK T  P A        
Sbjct: 1   MARRKLPDRPPNGIGFGDRPRLVPRPINVQNSISTLSKPFKVPYK-TAKPRALSSEHEKE 59

Query: 61  DNIVGGRSLRKRSATVCYSGLDINADEAEYNSQDISFSQLTKRRKDALSAQRLAKDPTRL 120
              V GR LRKRS TV YSGLDI++  A+ +   ++FSQ TKRRKDALSA RLA DPTRL
Sbjct: 60  VVQVNGRILRKRSHTVSYSGLDISSAAADVDENSLTFSQSTKRRKDALSASRLANDPTRL 119

Query: 121 SHIQYTLRRSFTVPIKGYVQRHSLPLTLGMKKKITPEPRPLHDPTDEFAIVLYDPSVDGE 180
             I++TL+RSFTVPIKGY+QRHSLPLTLG KKKI  EPRPLHDPTDEFAIVLYDPSVDG+
Sbjct: 120 HSIEFTLKRSFTVPIKGYIQRHSLPLTLGTKKKIIMEPRPLHDPTDEFAIVLYDPSVDGD 179

Query: 181 MIVHDTSMDNKEEESKKMIKSTQEKDNINKEKNSQEERPTQRIGRHPALMTNGVRNKPLR 240
           MI+HD S D + ++      ST+EK   +K+   +E +   +   HP LMTNGVRNK L+
Sbjct: 180 MIMHDNSQDVRNDKKD----STKEKGTDSKD---EETKTGSKKFAHPKLMTNGVRNKSLK 232

Query: 241 ELLGDSENSAENKKKFASVPVVIDPKLAKILRPHQVEGVRFLYRCVTGLVMKDYLEAEAF 300
           ELLG SE   E KKKF +VPVVIDPKL KILRPHQVEGV+FLYRCVTGLVMKD+L+AEA 
Sbjct: 233 ELLGSSEED-EAKKKFPNVPVVIDPKLTKILRPHQVEGVKFLYRCVTGLVMKDFLDAEAV 291

Query: 301 NTSSEDPLKSDEKALTESQKTEQNNRGAYGCIMADEMGLGKTLQCIALMWTLLRQGPQGK 360
           NT                 KTEQNNRGAYGCIMADEMGLGKTLQCIALMWTLLRQGPQGK
Sbjct: 292 NTGI--------------VKTEQNNRGAYGCIMADEMGLGKTLQCIALMWTLLRQGPQGK 337

Query: 361 RLIDKCIIVCPSSLVNNWANELIKWLGPNTLTPLAVDGKKSSMGGGNTTVSQAIHAWAQA 420
           RLIDKCIIVCPSSLVNNWANEL+KWLGP TL+PLAVDGKKSS+  GN+TV++A+H+WAQA
Sbjct: 338 RLIDKCIIVCPSSLVNNWANELVKWLGPGTLSPLAVDGKKSSLASGNSTVAEAVHSWAQA 397

Query: 421 QGRNIVKPVLIISYETLRRNVDQLKNCNVGLMLADEGHRLKNGDSLTFTALDSISCPRRV 480
            GRNIVKPVLIISYETLRRNVDQL+NC+VGLMLADEGHRLKNGDSLTFTALDSI+CPRRV
Sbjct: 398 TGRNIVKPVLIISYETLRRNVDQLRNCDVGLMLADEGHRLKNGDSLTFTALDSINCPRRV 457

Query: 481 ILSGTPIQNDLSEYFALLSFSNPGLLGSRAEFRKNFENPILRGRDADATDKEITKGEAQL 540
           ILSGTPIQNDLSEYFALL+FSNPGLLG+R+EFRKNFE PILR RDAD+TD+EITKGE QL
Sbjct: 458 ILSGTPIQNDLSEYFALLNFSNPGLLGTRSEFRKNFELPILRSRDADSTDEEITKGEEQL 517

Query: 541 QKLSTIVSKFIIRRTNDILAKYLPCKYEHVIFVNLKPLQNELYNKLIKSREXXXXXXXXX 600
           QKLSTIVSKFIIRRTNDIL+KYLPCKYEHVIFVNLKP Q ++Y++L+KSR+         
Sbjct: 518 QKLSTIVSKFIIRRTNDILSKYLPCKYEHVIFVNLKPFQKDVYHRLLKSRDVNKMVKGVG 577

Query: 601 XSQPLRAIGILKKLCNHPXXXXXXXXXXXXXXXXXXXXYNMPGSKARDVQTKYSAKFSIL 660
            +QPL+AIG+LKKLCNHP                    YNM GSK+RDVQ ++S KF+IL
Sbjct: 578 GTQPLKAIGVLKKLCNHPNLINLDEEIDDFDDLEIPDEYNMQGSKSRDVQPQFSGKFAIL 637

Query: 661 ERFLHKIKTESDDKIVLISNYTQTLDLIEKMCRYKHYSAVRLDGTMSINKRQKLVDRFND 720
           ERFLHKIKTESDDKIVLISNYTQTLDLIEKMCR KHYS+VRLDGTM+INKRQKLVDRFND
Sbjct: 638 ERFLHKIKTESDDKIVLISNYTQTLDLIEKMCRNKHYSSVRLDGTMTINKRQKLVDRFND 697

Query: 721 PEGQEFIFLLSSKAGGCGINLIGANRLILMDPDWNPAADQQALARVWRDGQKKDCFIYRF 780
           PEGQEFIFLLSSKAGGCGINLIGANRLILMDPDWNPAADQQALARVWRDGQKKDCFIYRF
Sbjct: 698 PEGQEFIFLLSSKAGGCGINLIGANRLILMDPDWNPAADQQALARVWRDGQKKDCFIYRF 757

Query: 781 ISTGTIEEKIFQRQSMKMSLSSCVVDAKEDVERLFSSDNLRQLFQKNENTICETHETYHC 840
           ISTG+IEEKI+QRQSMKMSLSSCVVDAKEDVERLFSSDNLRQLFQ N+ TICETHETYHC
Sbjct: 758 ISTGSIEEKIYQRQSMKMSLSSCVVDAKEDVERLFSSDNLRQLFQYNDKTICETHETYHC 817

Query: 841 KRCNAQGKQLKRAPAMLYGDATTWNHLNHDALEKTNDHLLKNE 883
           KRCNA GKQ  R+ AMLYGD TTWNHLNH ALEKTNDHLL+NE
Sbjct: 818 KRCNAAGKQSVRSTAMLYGDPTTWNHLNHAALEKTNDHLLQNE 860

>CAGL0I04224g complement(369858..372686) highly similar to sp|P32863
           Saccharomyces cerevisiae YGL163c RAD54, start by
           similarity
          Length = 942

 Score = 1276 bits (3303), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 641/945 (67%), Positives = 736/945 (77%), Gaps = 80/945 (8%)

Query: 1   MARRRLPDRPPNGIGAGERPRLVPRPINVQDSVNRLTKPFRVPYKNTHIPPAAGRIATGS 60
           MARRRLPDRPPNGIGAGERPRLVPRPINV +S+++LTKPF+VP K+        +    +
Sbjct: 1   MARRRLPDRPPNGIGAGERPRLVPRPINVDESISKLTKPFKVPVKSQR-----SQTVPAN 55

Query: 61  DNIVGGRSLRKRSATVCYSGLDINA----DEAEYNSQDISFSQLTKRRKDALSAQRLAKD 116
            ++   R LR+RS TV Y+GLD+++    D  E    ++    + KRR DALSA+RL +D
Sbjct: 56  SDLSRQRQLRQRSQTVSYAGLDVDSKDEVDGKENIYDELGERVIKKRRVDALSARRLMED 115

Query: 117 PTRLSHIQYTLRRSFTVPIKGYVQRHSLPLTLGMKKKITPEPRPLHDPTDEFAIVLYDPS 176
           PTRL  I+ TL++SF VPIKGYVQRHSLPLTLG K K+ PEPRPLHDPTDEFAIVLYDPS
Sbjct: 116 PTRLDTIEVTLKKSFHVPIKGYVQRHSLPLTLGTKVKVIPEPRPLHDPTDEFAIVLYDPS 175

Query: 177 VDGEMIVHDTSMDNKEEESKKMIKSTQEKDNINKEKNSQEERPTQRIGRHPALMTNGVRN 236
           VDGEMI+ D      + E+ + ++S++++       N+QE    +   +HP +++NGV+N
Sbjct: 176 VDGEMIIQD------DTETVQNVQSSEDQ-------NAQEAEAEKSKYKHPKILSNGVKN 222

Query: 237 KPLRELLGDSE-NSAEN-KKKFASVPVVIDPKLAKILRPHQVEGVRFLYRCVTGLVMKDY 294
           K L+ELLG+S  N  E+ KKKFA+VPVVIDPKLAKILRPHQVEGV+FLYRCVTGLVMKD+
Sbjct: 223 KTLQELLGNSPFNPTESMKKKFANVPVVIDPKLAKILRPHQVEGVKFLYRCVTGLVMKDF 282

Query: 295 LE------------------------------------AEAFNTSSEDPLK--------- 309
           L+                                    +EA N  + + ++         
Sbjct: 283 LDQQLASQSSNINFLECSDDDVCSKEVSPIDGGGAHDNSEANNDEAGNAIQNAKKNVKSK 342

Query: 310 -----------SDEKALTESQKTEQNNRGAYGCIMADEMGLGKTLQCIALMWTLLRQGPQ 358
                      S+   L   +K++ NNRGAYGCIMADEMGLGKTLQCIALMWTLLRQGPQ
Sbjct: 343 KQKKTITKKQQSENDFLEALKKSQSNNRGAYGCIMADEMGLGKTLQCIALMWTLLRQGPQ 402

Query: 359 GKRLIDKCIIVCPSSLVNNWANELIKWLGPNTLTPLAVDGKKSSMGGGNTTVSQAIHAWA 418
           GKRLI KCIIVCPSSLVNNWANEL+KWLGPNTL+PLAVDGKKSS+  G T+V++AI  WA
Sbjct: 403 GKRLISKCIIVCPSSLVNNWANELVKWLGPNTLSPLAVDGKKSSLASGATSVAEAIKNWA 462

Query: 419 QAQGRNIVKPVLIISYETLRRNVDQLKNCNVGLMLADEGHRLKNGDSLTFTALDSISCPR 478
           QAQGRNIVKPVLIISY+TLRRNV QL+N  VGL+LADEGHRLKNGDSLTFTALDSI+CPR
Sbjct: 463 QAQGRNIVKPVLIISYDTLRRNVKQLQNTEVGLLLADEGHRLKNGDSLTFTALDSINCPR 522

Query: 479 RVILSGTPIQNDLSEYFALLSFSNPGLLGSRAEFRKNFENPILRGRDADATDKEITKGEA 538
           RVILSGTPIQNDLSEYFALL+FSNPGLLG+R EFR+NFE PILR RDADATD ++  GE 
Sbjct: 523 RVILSGTPIQNDLSEYFALLNFSNPGLLGTRNEFRRNFEIPILRSRDADATDNDVKSGEQ 582

Query: 539 QLQKLSTIVSKFIIRRTNDILAKYLPCKYEHVIFVNLKPLQNELYNKLIKSREXXXXXXX 598
           +LQ LS IVSKFIIRRTNDIL+KYLPCKYEHVIFVNL P Q ++YN LIKSR+       
Sbjct: 583 KLQLLSNIVSKFIIRRTNDILSKYLPCKYEHVIFVNLTPFQKQVYNMLIKSRDIKKVVKG 642

Query: 599 XXXSQPLRAIGILKKLCNHPXXXXXXXXXXXXXXXXXXXXYNMPGSKARDVQTKYSAKFS 658
              SQPL+AIG+LKKLCNHP                    Y++P  K+RDVQT++S KF+
Sbjct: 643 DGGSQPLKAIGVLKKLCNHPDLIKLDEELDNYNDLDIPDDYSIPTGKSRDVQTQFSGKFA 702

Query: 659 ILERFLHKIKTESDDKIVLISNYTQTLDLIEKMCRYKHYSAVRLDGTMSINKRQKLVDRF 718
           ILERFLHKIKTESDDKIVLISNYTQTLDLIE+MCR +HY++VRLDGTMSINKRQKLVDRF
Sbjct: 703 ILERFLHKIKTESDDKIVLISNYTQTLDLIERMCRNRHYASVRLDGTMSINKRQKLVDRF 762

Query: 719 NDPEGQEFIFLLSSKAGGCGINLIGANRLILMDPDWNPAADQQALARVWRDGQKKDCFIY 778
           NDPEGQEFIFLLSSKAGGCGINLIGANRLILMDPDWNPAADQQALARVWRDGQKKDCFIY
Sbjct: 763 NDPEGQEFIFLLSSKAGGCGINLIGANRLILMDPDWNPAADQQALARVWRDGQKKDCFIY 822

Query: 779 RFISTGTIEEKIFQRQSMKMSLSSCVVDAKEDVERLFSSDNLRQLFQKNENTICETHETY 838
           RFISTGTIEEKI+QRQSMKMSLSSCVVDAKEDVERLFS DNLRQLFQ N+ TIC+THET+
Sbjct: 823 RFISTGTIEEKIYQRQSMKMSLSSCVVDAKEDVERLFSVDNLRQLFQFNDKTICDTHETF 882

Query: 839 HCKRCNAQGKQLKRAPAMLYGDATTWNHLNHDALEKTNDHLLKNE 883
            CKRCN  G+Q+ RA AMLYGDATTWNHLNH ALEKTNDHLLKNE
Sbjct: 883 QCKRCNKHGQQIMRAAAMLYGDATTWNHLNHKALEKTNDHLLKNE 927

>KLLA0A03069g complement(271516..274203) similar to sp|P32863
           Saccharomyces cerevisiae YGL163c RAD54 DNA-dependent
           ATPase of the SNF2P family, start by similarity
          Length = 895

 Score = 1166 bits (3017), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 589/908 (64%), Positives = 688/908 (75%), Gaps = 53/908 (5%)

Query: 1   MARRRLPDRPPNGIGAGERPRLVPRPINVQDSVNRLTKPFRVPYKNTHIPPAAGRIATGS 60
           MARRRLPDRPPNGIGAG RP L PR ++   ++  LTKPF+VP+K      A        
Sbjct: 1   MARRRLPDRPPNGIGAGARPNLRPRRLDTNQALETLTKPFKVPFKVNKTDHAKR------ 54

Query: 61  DNIVGGRSLRKRSATVCYSGLDINADEAEYNSQDISFSQLTKRRKDALSAQRLAKDPTRL 120
               G RS R+   T  Y+ +D + D           S L  +RKDALS  RL  +P+RL
Sbjct: 55  ---YGVRSSRRSQTT--YANMDSSLD-----------SDLHVKRKDALSLSRLNAEPSRL 98

Query: 121 SHIQYTLRRSFTVPIKGYVQRHSLPLTLGMKKKITPEPRPLHDPTDEFAIVLYDPSVDGE 180
             I  TLRRSFTVPIKGYV RH++P+ LG K K+   PRPLHDPTDE AIVLYDP+VDG+
Sbjct: 99  DTIYSTLRRSFTVPIKGYVPRHNIPMALGTKAKVVIPPRPLHDPTDELAIVLYDPTVDGD 158

Query: 181 MIVHDTSMDNKEEESKKMIKSTQEKDNINKEKNSQEERPTQRIG-RHPALMTNGVRNKPL 239
           +      +++  + +    KS + KD+ ++++ ++E  P       HP +++NGV+NK L
Sbjct: 159 IPEQHEDLESFRQNAVDTKKSQKGKDSESQDQKAKESSPNSAPSIHHPKMLSNGVKNKTL 218

Query: 240 RELLGDSENSAENKKKFASVPVVIDPKLAKILRPHQVEGVRFLYRCVTGLVMKDYLEAEA 299
           +ELLG SE++    KKF +VPVVIDPKLAKILRPHQVEGVRFLYRCVTGLVMKD+L+A+ 
Sbjct: 219 KELLGSSEDNTS--KKFPNVPVVIDPKLAKILRPHQVEGVRFLYRCVTGLVMKDFLDAKT 276

Query: 300 F------------------NTSSEDPLKSDEKALTESQKTEQN--NRGAYGCIMADEMGL 339
                               T S+ P+++D  +L +  K  +N  NRGAYGCIMADEMGL
Sbjct: 277 VLDSSSQSMEKADTQADSNITGSKSPVETDVSSLKDVIKINENSRNRGAYGCIMADEMGL 336

Query: 340 GKTLQCIALMWTLLRQGPQGKRLIDKCIIVCPSSLVNNWANELIKWLGPNTLTPLAVDGK 399
           GKTLQC+ALMWT+L+QGPQG+R IDKCIIVCPSSLVNNWANE+ KWLGP +L+ LA+DGK
Sbjct: 337 GKTLQCLALMWTMLKQGPQGRRSIDKCIIVCPSSLVNNWANEIDKWLGPGSLSSLAIDGK 396

Query: 400 KSSMGGGNTTVSQAIHAWAQAQGRNIVKPVLIISYETLRRNVDQLKNCNVGLMLADEGHR 459
           KSS+  GN  V+ ++  WA AQGRNIVKPVLIISY+TLRRNV+QLKNC VGLMLADEGHR
Sbjct: 397 KSSLNNGN--VADSVSHWASAQGRNIVKPVLIISYDTLRRNVEQLKNCEVGLMLADEGHR 454

Query: 460 LKNGDSLTFTALDSISCPRRVILSGTPIQNDLSEYFALLSFSNPGLLGSRAEFRKNFENP 519
           LKN DSLTFTALDSI CPRRVILSGTPIQNDLSEYFALL+FSNPGLLGSR +FRKNFE P
Sbjct: 455 LKNADSLTFTALDSIRCPRRVILSGTPIQNDLSEYFALLNFSNPGLLGSRNDFRKNFELP 514

Query: 520 ILRGRDADATDKEITKGEAQLQKLSTIVSKFIIRRTNDILAKYLPCKYEHVIFVNLKPLQ 579
           IL+ RD+ ATD+E+T G+ +L++LS IVSKFIIRRTN+ILAKYLPCKYEHVIF+NL P Q
Sbjct: 515 ILQSRDSLATDEEVTLGKDRLRQLSNIVSKFIIRRTNNILAKYLPCKYEHVIFINLTPFQ 574

Query: 580 NELYNKLIKSREXXXXXXXXXXSQPLRAIGILKKLCNHPXXXXXXXX---XXXXXXXXXX 636
             LY   I+SR           +QPL+AIG+LKKLCNHP                     
Sbjct: 575 QSLYQHFIESR-AVKKIVKGDSNQPLKAIGLLKKLCNHPDLLELSEDIPGSEELIPDDYQ 633

Query: 637 XXYNMPGSKARDV-QTKYSAKFSILERFLHKIKTESDDKIVLISNYTQTLDLIEKMCRYK 695
              +   S+ R V QT +S+KFS+L RFL+KIKTES+DKIVLISNYTQTLDLIEKMC   
Sbjct: 634 SSVDSRTSRNRSVIQTAFSSKFSVLARFLYKIKTESNDKIVLISNYTQTLDLIEKMCFSN 693

Query: 696 HYSAVRLDGTMSINKRQKLVDRFNDPEGQEFIFLLSSKAGGCGINLIGANRLILMDPDWN 755
           HY  +RLDGTM+INKRQKLVDRFNDPEGQEFIFLLSSKAGGCGINLIGANRLIL+DPDWN
Sbjct: 694 HYGVLRLDGTMNINKRQKLVDRFNDPEGQEFIFLLSSKAGGCGINLIGANRLILLDPDWN 753

Query: 756 PAADQQALARVWRDGQKKDCFIYRFISTGTIEEKIFQRQSMKMSLSSCVVDAKEDVERLF 815
           PAADQQALARVWRDGQKKDCFIYRFISTGTIEEKIFQRQSMKMSLSSCVVD KEDVERLF
Sbjct: 754 PAADQQALARVWRDGQKKDCFIYRFISTGTIEEKIFQRQSMKMSLSSCVVDEKEDVERLF 813

Query: 816 SSDNLRQLFQKNENTICETHETYHCKRCNAQGKQLKRAPAMLYGDATTWNHLNHDALEKT 875
           SSDNL+QLF+ +  TIC+THETY+CKRC   GKQ+ +AP MLYGDAT+WNHLNHDAL KT
Sbjct: 814 SSDNLKQLFKLDTKTICDTHETYNCKRCK-NGKQILKAPVMLYGDATSWNHLNHDALAKT 872

Query: 876 NDHLLKNE 883
           NDHLLKNE
Sbjct: 873 NDHLLKNE 880

>AEL297W [2208] [Homologous to ScYGL163C (RAD54) - SH]
           complement(83368..86055) [2688 bp, 895 aa]
          Length = 895

 Score = 1133 bits (2930), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 577/922 (62%), Positives = 680/922 (73%), Gaps = 81/922 (8%)

Query: 1   MARRRLPDRPPNGIGAGERPRLVPRPINVQDSVNRLTKPFRVPYKNTHIPPAAGRIATGS 60
           MA+R+LPDRPPNG GAGERP + PR ++   + + LT+PFRVP  +           T  
Sbjct: 1   MAKRKLPDRPPNGSGAGERPSVRPRRLDSGRAYSTLTQPFRVPLNSER---------TRH 51

Query: 61  DNIVGGRSLRKRSATVCYSGLDINADEAEYNSQDISFSQLTKRRKDALSAQRLAKDPTRL 120
               G R+ R+  A   Y      A+E    S++   + +  +R DALS QR++KD  RL
Sbjct: 52  GERYGVRATRR--AVTTY------AEEGGARSEE---NDVGGKRIDALSEQRVSKDAQRL 100

Query: 121 SHIQYTLRRSFTVPIKGYVQRHSLPLTLGMKKKITPEPRPLHDPTDEFAIVLYDPSVDGE 180
           + I+ TLRRSF+VPIKGYV RH++PL LGMK ++   PRPLHDPT+EFAIVLYDP+VDGE
Sbjct: 101 AGIERTLRRSFSVPIKGYVPRHNIPLALGMKMRVVAPPRPLHDPTEEFAIVLYDPTVDGE 160

Query: 181 MIVHDTSMDNKEEESKKMIKSTQEKDNINKEKNSQEERPTQRIGRHPALMTNGVRNKPLR 240
           +           +E+ +   + +E D  N+E    + RPT+R   HP  ++NG+RNK LR
Sbjct: 161 I----------PDETPREEPAQKENDGGNEE----QARPTRRTATHPEKLSNGLRNKTLR 206

Query: 241 ELLGDSENSAENKKKFASVPVVIDPKLAKILRPHQVEGVRFLYRCVTGLVMKDYLEAEAF 300
           ELLG    +     KF SVPVVIDP+LA+ILRPHQVEGVRFLYRCVTGL MKD+L+ +A 
Sbjct: 207 ELLG----TVTETPKFPSVPVVIDPRLARILRPHQVEGVRFLYRCVTGLAMKDFLDTQAV 262

Query: 301 NTSSE--------DPLKSDEKALT-------------------------ESQKTEQNNRG 327
             + E        DP   D + +                           +  T ++NRG
Sbjct: 263 LAAGEVQDDGTGKDPGSKDSEPIVVEVLEETPTPTPTPTPTPSPEILDANAAMTRESNRG 322

Query: 328 AYGCIMADEMGLGKTLQCIALMWTLLRQGPQGKRLIDKCIIVCPSSLVNNWANELIKWLG 387
           AYGCIMADEMGLGKTLQCIALMWTLLRQG QG+  I+KCIIVCPSSLVNNWANE++KWLG
Sbjct: 323 AYGCIMADEMGLGKTLQCIALMWTLLRQGSQGRPTIEKCIIVCPSSLVNNWANEIVKWLG 382

Query: 388 PNTLTPLAVDGKKSSMGGGNTTVSQAIHAWAQAQGRNIVKPVLIISYETLRRNVDQLKNC 447
           P+ L+PLA+DG+KSS+  G  +V+Q++  WA AQGRN+VKPVLIISYETLRRNV+ LK C
Sbjct: 383 PDALSPLAIDGRKSSLSNG--SVAQSVRQWAIAQGRNVVKPVLIISYETLRRNVENLKGC 440

Query: 448 NVGLMLADEGHRLKNGDSLTFTALDSISCPRRVILSGTPIQNDLSEYFALLSFSNPGLLG 507
            VGLMLADEGHRLKNGDSLTFT+LDSI+CPRRVILSGTPIQNDLSEYFALL+FSNPGLLG
Sbjct: 441 KVGLMLADEGHRLKNGDSLTFTSLDSINCPRRVILSGTPIQNDLSEYFALLNFSNPGLLG 500

Query: 508 SRAEFRKNFENPILRGRDADATDKEITKGEAQLQKLSTIVSKFIIRRTNDILAKYLPCKY 567
           +RA+FRKNFE PILRGRDADATDKEI  GE +L +LS IVSKFIIRRTNDIL+KYLPCKY
Sbjct: 501 TRAQFRKNFEIPILRGRDADATDKEIAAGEVKLHELSQIVSKFIIRRTNDILSKYLPCKY 560

Query: 568 EHVIFVNLKPLQNELYNKLIKSREXXXXXXXXXXSQPLRAIGILKKLCNHPXXXXXXXXX 627
           EH++FVNL P+Q  +Y   ++SRE          SQPL+AIG+LKKLCNHP         
Sbjct: 561 EHILFVNLSPMQKAIYEHFVRSREVAKLMKGTG-SQPLKAIGLLKKLCNHPDLLDLPDEI 619

Query: 628 XXXXX-----XXXXXXYNMPGSKAR-DVQTKYSAKFSILERFLHKIKTESDDKIVLISNY 681
                           +N  G ++  +VQT +S+KF+ILERFL KIK ES+DKIVLISNY
Sbjct: 620 AGSTNLIPDDYQSAMTHNSRGGRSHVEVQTTHSSKFAILERFLFKIKHESNDKIVLISNY 679

Query: 682 TQTLDLIEKMCRYKHYSAVRLDGTMSINKRQKLVDRFNDPEGQEFIFLLSSKAGGCGINL 741
           TQTLDLIEKMCRY HY  +RLDGTM+INKRQKLVD+FNDP G+EFIFLLSSKAGGCGINL
Sbjct: 680 TQTLDLIEKMCRYNHYGVLRLDGTMTINKRQKLVDKFNDPSGEEFIFLLSSKAGGCGINL 739

Query: 742 IGANRLILMDPDWNPAADQQALARVWRDGQKKDCFIYRFISTGTIEEKIFQRQSMKMSLS 801
           IGANRLILMDPDWNPAADQQALARVWRDGQKKDCFIYRFI+TG+IEEKI QR SMKMSLS
Sbjct: 740 IGANRLILMDPDWNPAADQQALARVWRDGQKKDCFIYRFITTGSIEEKISQRPSMKMSLS 799

Query: 802 SCVVDAKEDVERLFSSDNLRQLFQKNENTICETHETYHCKRCNAQGKQLKRAPAMLYGDA 861
           SCVV+ KEDVERLFSS+NLR LFQ + NT      TYHCKRC   GKQ+ +APAMLYGDA
Sbjct: 800 SCVVEEKEDVERLFSSENLRPLFQFDSNTHMRYPPTYHCKRCR-DGKQMIKAPAMLYGDA 858

Query: 862 TTWNHLNHDALEKTNDHLLKNE 883
           TTWNHLNHDAL KTNDHLL+NE
Sbjct: 859 TTWNHLNHDALLKTNDHLLRNE 880

>Kwal_14.1537
          Length = 842

 Score = 1003 bits (2594), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 540/857 (63%), Positives = 614/857 (71%), Gaps = 59/857 (6%)

Query: 1   MARRRLPDRPPNGIGAGERPRLVPRPINVQDSVNRLTKPFRVPYKNTHIPPAAGRIATGS 60
           MARR+LPDRPPNGIGAG+RP L PR ++   +   LT+PF+VP +           A  +
Sbjct: 1   MARRKLPDRPPNGIGAGQRPSLRPRQLDSLAAHATLTRPFKVPLRKLE----PNCAANPA 56

Query: 61  DNIVGGRSLRKRSATVCYSGLDINADEAEYNSQDISFSQLTKRRKDALSAQRLAKDPTRL 120
           +  +G R+   RS T  Y  L   A E E++  +    +   +R DALSA+RL++DP RL
Sbjct: 57  NAAIGKRT--TRSKTHVYE-LTETAPEFEHSESESGLKR--AKRPDALSARRLSRDPDRL 111

Query: 121 SHIQYTLRRSFTVPIKGYVQRHSLPLTLGMKKKITPEPRPLHDPTDEFAIVLYDPSVDGE 180
             I   LRRSFTVPIKGYV RH++PL+LG K KI   PRPLHDPT+EFAIVLYDPSVDG 
Sbjct: 112 RKIDSLLRRSFTVPIKGYVPRHNIPLSLGTKPKIVLGPRPLHDPTEEFAIVLYDPSVDGP 171

Query: 181 MIVHDTSMDNKEEESKKMIKSTQEKDNINKEKNSQEERPTQRIGRHPALMTNGVRNKPLR 240
                  M ++  +S      ++ + +    + S    P      HP  ++NG+ NK LR
Sbjct: 172 TPELLIQMRSQLPKSSSASALSKPRGSTRATQLSPTPPPPSPHPSHPKKLSNGLPNKTLR 231

Query: 241 ELLGDSENSAENKKKFASVPVVIDPKLAKILRPHQVEGVRFLYRCVTGLVMKDYLE---- 296
           ELLGD +      +KFASVPVVIDP L KILRPHQVEGVRFLYRCVTGLVMKDYL+    
Sbjct: 232 ELLGDRQVD----EKFASVPVVIDPLLVKILRPHQVEGVRFLYRCVTGLVMKDYLDQQAL 287

Query: 297 ---AEAFNTSSE---------------------DP---LKSDEK---------ALTESQK 320
              A+A  TS E                     DP   L SDEK         A T+   
Sbjct: 288 LQNADAATTSKEQTPPADHLPSPPAELLPSPPADPAHTLTSDEKLPNQELDTPAPTDESS 347

Query: 321 TE-QNNRGAYGCIMADEMGLGKTLQCIALMWTLLRQGPQGKRLIDKCIIVCPSSLVNNWA 379
           +E   NRGAYGCIMADEMGLGKTLQCIAL+WTLLRQGPQGK  IDKCIIVCPSSLVNNWA
Sbjct: 348 SEVSQNRGAYGCIMADEMGLGKTLQCIALLWTLLRQGPQGKPTIDKCIIVCPSSLVNNWA 407

Query: 380 NELIKWLGPNTLTPLAVDGKKSSMGGGNTTVSQAIHAWAQAQGRNIVKPVLIISYETLRR 439
           NE++KWLG  TL  L +DGKKSS+  G  TV+QA+  WA A+GR++VKPVLIISYETLRR
Sbjct: 408 NEIVKWLGKGTLASLPIDGKKSSLNNG--TVAQAVRGWALARGRSVVKPVLIISYETLRR 465

Query: 440 NVDQLKNCNVGLMLADEGHRLKNGDSLTFTALDSISCPRRVILSGTPIQNDLSEYFALLS 499
           NV+ L NC +GL+LADEGHRLKN +S TFTALDSI+CPRRVILSGTPIQNDLSEYFALL+
Sbjct: 466 NVEHLNNCEIGLLLADEGHRLKNAESQTFTALDSINCPRRVILSGTPIQNDLSEYFALLN 525

Query: 500 FSNPGLLGSRAEFRKNFENPILRGRDADATDKEITKGEAQLQKLSTIVSKFIIRRTNDIL 559
           FSNPGLLG+R+EFR+NFENPIL  RDADATD EI KG  +LQ LSTIVSKFIIRRTNDIL
Sbjct: 526 FSNPGLLGTRSEFRRNFENPILLSRDADATDSEIAKGNEKLQALSTIVSKFIIRRTNDIL 585

Query: 560 AKYLPCKYEHVIFVNLKPLQNELYNKLIKSREXXXXXXXXXX-SQPLRAIGILKKLCNHP 618
           +KYLPCKYEHV+FVNLKP Q  +Y  ++K R+           SQPL+ IG LKKLCNHP
Sbjct: 586 SKYLPCKYEHVLFVNLKPFQRSVYELMLKCRDVKLAVKDGTTPSQPLKHIGALKKLCNHP 645

Query: 619 XXXXXXXXXXXXXXXXXXXXYNMPGSK--ARDVQTKYSAKFSILERFLHKIKTESDDKIV 676
                                N   SK    +VQT YS KFSIL RFLHKIKTESDDKIV
Sbjct: 646 DLLQLPEDVEGSEDVIPEDYRNSTLSKRGHAEVQTWYSGKFSILNRFLHKIKTESDDKIV 705

Query: 677 LISNYTQTLDLIEKMCRYKHYSAVRLDGTMSINKRQKLVDRFNDPEGQEFIFLLSSKAGG 736
           +ISNYTQTLD+IE+MCR   Y  VRLDGTM+INKRQKLVDRFND EGQEFIFLLSSKAGG
Sbjct: 706 IISNYTQTLDVIERMCRTSSYPVVRLDGTMTINKRQKLVDRFNDVEGQEFIFLLSSKAGG 765

Query: 737 CGINLIGANRLILMDPDWNPAADQQALARVWRDGQKKDCFIYRFISTGTIEEKIFQRQSM 796
           CGINLIGANRLILMDPDWNPAADQQALARVWRDGQKKDCFIYRFI TGTIEEKI+QRQSM
Sbjct: 766 CGINLIGANRLILMDPDWNPAADQQALARVWRDGQKKDCFIYRFICTGTIEEKIYQRQSM 825

Query: 797 KMSLSSCVVDAKEDVER 813
           KMSLSSCVVD KEDVER
Sbjct: 826 KMSLSSCVVDEKEDVER 842

>KLLA0F11814g complement(1089699..1092494) similar to sp|P38086
           Saccharomyces cerevisiae YBR073w RDH54 required for
           mitotic diploid-specific recombination and repair and
           meiosis, start by similarity
          Length = 931

 Score =  405 bits (1041), Expect = e-127,   Method: Compositional matrix adjust.
 Identities = 243/627 (38%), Positives = 345/627 (55%), Gaps = 86/627 (13%)

Query: 248 NSAENKKKFASVPVVIDPKLAKILRPHQVEGVRFLYRCVTGLVMKDYLEAEAFNTSSEDP 307
           N  EN K    V V++DP L+K LRPHQ EGV+FLY CV  +V                 
Sbjct: 259 NKTENHK----VSVIVDPLLSKTLRPHQREGVKFLYDCVMNMVHT--------------- 299

Query: 308 LKSDEKALTESQKTEQNNRGAYGCIMADEMGLGKTLQCIALMWTLLRQGP-------QGK 360
            K DE  + E       +    GC++ADEMGLGKTL  I L+WTLL+Q P       +G 
Sbjct: 300 -KGDESMILE------RDDDIKGCLLADEMGLGKTLMTITLIWTLLKQTPYPTIINQRGV 352

Query: 361 RL---IDKCIIVCPSSLVNNWANELIKWLGPNTLTPLAVDGKKSSMGGGNTTVSQAIHAW 417
            L   I K +IVCP +L+ NW  E  KWL  N +  L +  + S                
Sbjct: 353 TLAGEISKVLIVCPVTLIGNWKKEFKKWLPMNRIGVLTLHSRNSPTED------------ 400

Query: 418 AQAQGRNIVK-----PVLIISYETLRRNVDQLKNC--NVGLMLADEGHRLKNGDSLTFTA 470
            +AQ R+ +K      VLI+ YE L    D+L+N   N+ L++ DEGHRLKN DS     
Sbjct: 401 -KAQVRSFLKVPRTYQVLIVGYEKLLSIKDELQNEKRNLDLVICDEGHRLKNKDSKILKV 459

Query: 471 LDSISCPRRVILSGTPIQNDLSEYFALLSFSNPGLLGSRAEFRKNFENPILRGRDADATD 530
           L S+   ++++LSGTPIQNDL E++ ++ F NPG+LGS   F++ +  PI R RD +A  
Sbjct: 460 LQSLDIEKKIVLSGTPIQNDLEEFYTIIDFINPGILGSFGRFKREYILPIARSRDVNAKQ 519

Query: 531 KE--ITKGEAQLQKLSTIVSKFIIRRTNDILAKYLPCKYEHVIFVNLKPLQNELYNKLIK 588
            +  + +G  +  +L  I  +FI+RRTN+IL +YLP + + +IF      Q E ++K++ 
Sbjct: 520 NQTLVEQGLLRSDQLIEITKRFILRRTNEILQQYLPPRTDLIIFCKPTAEQVEAFHKILT 579

Query: 589 SREXXXXXXXXXXSQPLRAIGILKKLCNHPXXXXXXXXXXXXXXXXXXXXYNMPGSKARD 648
             E          +  L  I + KK+CN                      Y    S+ + 
Sbjct: 580 --EGQLNFSNMTFNSSLGLITLFKKICN------------STRLIKTDPYYEERLSQVQT 625

Query: 649 VQTK---YSAKFSILERFLHKIKTESDDKIVLISNYTQTLDLIEKMCRYKHYSAVRLDGT 705
             T     S K  IL   LH++KT++D+K+V+ISNYTQTLD+IE  C  + Y++ RLDG+
Sbjct: 626 SSTSGKFTSGKLRILLSLLHELKTKTDEKVVVISNYTQTLDIIEGHCSSEGYTSARLDGS 685

Query: 706 MSINKRQKLVDRF-NDPEGQEFIFLLSSKAGGCGINLIGANRLILMDPDWNPAADQQALA 764
            +   R ++V  F NDP    F+FLLS+K+GG G+NLIGA+RL+L D DWNP+ D QA++
Sbjct: 686 TATKTRDQIVTSFNNDPS--IFVFLLSAKSGGVGLNLIGASRLVLFDNDWNPSIDLQAMS 743

Query: 765 RVWRDGQKKDCFIYRFISTGTIEEKIFQRQSMKMSLSSCVVDAKEDVER----LFSSDNL 820
           R+ RDGQ++ CFIYR ++TG I+EKI QRQ MK++LS   +D+  D  +    LF  + L
Sbjct: 744 RIHRDGQRRPCFIYRLVTTGCIDEKILQRQLMKIALSKKFLDSATDQSKNDDDLFQQEEL 803

Query: 821 RQLFQKNENTICETHETYHCKRCNAQG 847
           + LF  N +T+  TH+      CN  G
Sbjct: 804 KDLFTINLSTLSNTHDLI----CNCSG 826

>Scas_718.40
          Length = 926

 Score =  387 bits (993), Expect = e-120,   Method: Compositional matrix adjust.
 Identities = 246/633 (38%), Positives = 341/633 (53%), Gaps = 80/633 (12%)

Query: 252 NKKKFASVPVVIDPKLAKILRPHQVEGVRFLYRCVTGLVMKDYLEAEAFNTSSEDPLKSD 311
           NK + A V V++DP L K+LRPHQ EGV+F+Y CV GL   ++ E +  NT     L+ D
Sbjct: 240 NKWRDADVDVIVDPLLGKLLRPHQREGVKFMYDCVMGLAT-NHQETDEDNTGKSLILEKD 298

Query: 312 EKALTESQKTEQNNRGAYGCIMADEMGLGKTLQCIALMWTLLRQGPQGKR---------- 361
                             GC++ADEMGLGKTL  I L+WTLL+Q P  K           
Sbjct: 299 S--------------DIGGCLLADEMGLGKTLMTITLIWTLLKQSPSLKNIACSQSGVPL 344

Query: 362 --LIDKCIIVCPSSLVNNWANELIKWLGPNTLTPLAVDGKKSSMGGGNTTVSQAIHAWAQ 419
             L  K ++VCP +L+ NW  E  KWL  N +  L +  + +      T V   +     
Sbjct: 345 HGLCRKILVVCPVTLIGNWKREFAKWLNLNRIGILTLSSRNTP-EMDKTAVKNFLRVQRT 403

Query: 420 AQGRNIVKPVLIISYETLRRNVDQLKNCN--VGLMLADEGHRLKNGDSLTFTALDSISCP 477
            Q       VL+I YE L    ++L      + L++ DEGHRLKNG S     L ++   
Sbjct: 404 FQ-------VLVIGYEKLLSVSEELHGSRDLIDLLICDEGHRLKNGSSKVLNVLKNLEIK 456

Query: 478 RRVILSGTPIQNDLSEYFALLSFSNPGLLGSRAEFRKNFENPILRGRDADATDKE--ITK 535
           R+++LSGTPIQNDL+E++ ++ F NPG+LGS   F+K F  PI RGRD +    E  I  
Sbjct: 457 RKILLSGTPIQNDLNEFYTIIDFLNPGILGSYPYFKKRFIAPITRGRDTENRHNEDIIEL 516

Query: 536 GEAQLQKLSTIVSKFIIRRTNDILAKYLPCKYEHVIFVNLKPLQNEL--YNKLIKSREXX 593
           GE + +++  I  KF +RRTN IL+KYLP K + ++F   KP Q++L  +N ++ SR   
Sbjct: 517 GEGRSKEMIDITRKFTLRRTNAILSKYLPPKTDIILFC--KPTQSQLLAFNDIL-SRSRI 573

Query: 594 XXXXXXXXSQPLRAIGILKKLCNHPXXXXXXXXXXXXXXXXXXXXYNMPGSKARD---VQ 650
                   S  L  I + KK+CN P                         SK R    +Q
Sbjct: 574 DFANLSFNSS-LGLITLFKKICNSPTLIGDDSYYQ---------------SKIRPDGVIQ 617

Query: 651 TKY-----SAKFSILERFLHKIKTESD-DKIVLISNYTQTLDLIEKMCRYKHYSAVRLDG 704
            +Y     S K  IL   L KIK  ++ +K+V++SNYTQTLD+I+ +       + RLDG
Sbjct: 618 ERYDRSLNSGKLKILMTLLEKIKGNTNNEKVVIVSNYTQTLDIIQNLMNSAQMVSCRLDG 677

Query: 705 TMSINKRQKLVDRFN-DPEGQEFIFLLSSKAGGCGINLIGANRLILMDPDWNPAADQQAL 763
           +    +R  +V+ FN +P    F FLLS+K+GG G+NLIGA+RLIL D DWNP+ D QA+
Sbjct: 678 STPAKQRDSIVNTFNRNPS--IFAFLLSAKSGGVGLNLIGASRLILFDNDWNPSIDLQAM 735

Query: 764 ARVWRDGQKKDCFIYRFISTGTIEEKIFQRQSMKMSLSSCVVDAKEDVER------LFSS 817
           +R+ RDGQKK C+IYR I+TG I+EKI QRQ MK SLS   +D+     +      LF+ 
Sbjct: 736 SRIHRDGQKKHCYIYRLITTGCIDEKILQRQLMKHSLSKKFLDSSYTTGKTGSNDDLFTK 795

Query: 818 DNLRQLFQKNENTICETHETYHCKRCNAQGKQL 850
           ++L+ LF   E T   TH+   C  C   GK +
Sbjct: 796 EDLKDLFTIMETTKSNTHDLI-CD-CEGTGKSV 826

>AGL212W [4100] [Homologous to ScYBR073W (RDH54) - SH]
           complement(295808..298519) [2712 bp, 903 aa]
          Length = 903

 Score =  377 bits (969), Expect = e-117,   Method: Compositional matrix adjust.
 Identities = 240/656 (36%), Positives = 346/656 (52%), Gaps = 86/656 (13%)

Query: 224 GRHPALMTNGVRNKPLRELLGDSENSAENKKKFASVPVVIDPKLAKILRPHQVEGVRFLY 283
           GRH AL      + PL            NK     V VV+DP L+K LR HQ  G++F+Y
Sbjct: 216 GRHCALFDKTQIDDPL----------VMNKAGDDEVEVVVDPILSKKLRQHQRTGIKFMY 265

Query: 284 RCVTGLVMKDYLEAEAFNTSSEDPLKSDEKALTESQKTEQNNRGAYGCIMADEMGLGKTL 343
            CV GL   +               K D++ +       + +    GC++ADEMGLGKT 
Sbjct: 266 DCVRGLARSE---------------KDDDRTVM----ILEYDSDVKGCLLADEMGLGKTC 306

Query: 344 QCIALMWTLLRQGPQG------------KRLIDKCIIVCPSSLVNNWANELIKWLGPNTL 391
             IAL+WTLL+Q P+             + +  K ++VCP +L+ NW  E IKWL  N +
Sbjct: 307 MTIALIWTLLKQHPRPSSVPCSQLGVALQGICQKVLVVCPVTLIGNWKKEFIKWLPMNRI 366

Query: 392 TPLAVDGKKSSMGGGNTTVSQAIHAWAQAQGRNIVK-----PVLIISYETLRR---NVDQ 443
             L +  K +     N               RN ++      VLI+ YE L      +DQ
Sbjct: 367 GILTLSSKNTPEKDKNDV-------------RNFLRVQRTYQVLILGYEKLLNVFSELDQ 413

Query: 444 LKNCNVGLMLADEGHRLKNGDSLTFTALDSISCPRRVILSGTPIQNDLSEYFALLSFSNP 503
            K+  + L++ DEGHRLKN  S     L  +   R+VIL+GTPIQNDL+E++ +++F NP
Sbjct: 414 AKS-KLDLLICDEGHRLKNSSSKILKCLTDLEIERKVILTGTPIQNDLNEFYTIINFINP 472

Query: 504 GLLGSRAEFRKNFENPILRGRDAD--ATDKEITKGEAQLQKLSTIVSKFIIRRTNDILAK 561
           G+LG+ A F++ +  PI R RD +    D+ ++ GE++ Q L  I  KFI+RRT+ I+A 
Sbjct: 473 GILGTFAHFKRVYITPITRARDVNNKHNDQIVSLGESRSQDLIEITKKFILRRTSSIIAD 532

Query: 562 YLPCKYEHVIFVNLKPLQNEL--YNKLIKSREXXXXXXXXXXSQPLRAIGILKKLCNHPX 619
           YLP + + V+F   KP Q++L  +N+++              S  L  I + KK+CN P 
Sbjct: 533 YLPPRTDIVVFC--KPTQHQLDAFNQVLVGTRVDFQNMSFNSS--LGLITLFKKICNSPS 588

Query: 620 XXXXXXXXXXXXXXXXXXXYNMPGSKARDVQTKYSAKFSILERFLHKIKTESD-DKIVLI 678
                               N      R  Q+  S K  +L   LH+I   SD +K+V+I
Sbjct: 589 LVSSDSYFQSK--------VNGGTPALRIAQSTTSGKLKVLMSLLHQIAHRSDNEKVVVI 640

Query: 679 SNYTQTLDLIEKMCRYKHYSAVRLDGTMSINKRQKLVDRFNDPEGQEFIFLLSSKAGGCG 738
           SNYTQTLD+I  +      S +RLDG+    +R  +V+ FN  +   F FLLS+K+GG G
Sbjct: 641 SNYTQTLDIIGNLMSSASLSYLRLDGSTPAKERDAIVNDFNRSQ-TIFGFLLSAKSGGVG 699

Query: 739 INLIGANRLILMDPDWNPAADQQALARVWRDGQKKDCFIYRFISTGTIEEKIFQRQSMKM 798
           +NL+GA+RLIL D DWNP+ D QA++R+ RDGQKK CFIYR ++TG I+EKIFQRQ MK 
Sbjct: 700 LNLVGASRLILFDNDWNPSVDLQAMSRIHRDGQKKPCFIYRLVTTGCIDEKIFQRQLMKN 759

Query: 799 SLSSCVVDAKED---VERLFSSDNLRQLFQKNENTICETHETYHCKRCNAQGKQLK 851
           +LS   +D   D    + +F  ++L+ LF     T+  TH+   C  C   G++ +
Sbjct: 760 NLSKKFLDDHCDDKSSDNVFEQEDLKDLFSVQSGTLSNTHDLL-CS-CEGSGEEFE 813

>Kwal_27.10513
          Length = 900

 Score =  375 bits (962), Expect = e-116,   Method: Compositional matrix adjust.
 Identities = 231/615 (37%), Positives = 329/615 (53%), Gaps = 68/615 (11%)

Query: 257 ASVPVVIDPKLAKILRPHQVEGVRFLYRCVTGLVMKDYLEAEAFNTSSEDPLKSDEKALT 316
           A   VV+DP L+K LRPHQ  GV+F+Y C+ GL      E +                 T
Sbjct: 237 ADTDVVVDPILSKHLRPHQRIGVKFMYDCILGLSRPSCYEDDG----------------T 280

Query: 317 ESQKTEQNNRGAYGCIMADEMGLGKTLQCIALMWTLLRQGP--------------QGKRL 362
            S K ++ N    GC++ADEMGLGKTL  I L+WTLL+Q P              QG  L
Sbjct: 281 FSTKLKRTNE-IQGCLLADEMGLGKTLMTITLVWTLLKQTPIPSKANSSQNGISLQG--L 337

Query: 363 IDKCIIVCPSSLVNNWANELIKWLGPNTLTPLAVDGKKSSMGGGNTTVSQAIHAWAQAQG 422
            +K ++VCP +L+ NW  E  KWL  N +  L +  K S+      TV   +      Q 
Sbjct: 338 CNKILVVCPVTLIGNWKREFSKWLNVNRIGILTLSSK-SNAEKDKLTVRNFLRVQRTYQ- 395

Query: 423 RNIVKPVLIISYETLRRNVDQL--KNCNVGLMLADEGHRLKNGDSLTFTALDSISCPRRV 480
                 VL+I YE L    ++L      + L++ DEGHRLKNG S T  A+ S+  PR++
Sbjct: 396 ------VLVIGYEKLLSVTEELLEAKSKIDLVICDEGHRLKNGQSKTLKAISSLEVPRKI 449

Query: 481 ILSGTPIQNDLSEYFALLSFSNPGLLGSRAEFRKNFENPILRGRDADATDKEIT--KGEA 538
           +L+GTPIQNDL+E+F +  F N G+LG+ ++F+++F NPI R RD +     +   KG  
Sbjct: 450 MLTGTPIQNDLAEFFTIADFLNDGILGTFSKFKRDFINPITRARDLNNKHNNLIQEKGRD 509

Query: 539 QLQKLSTIVSKFIIRRTNDILAKYLPCKYEHVIFVNLKPLQNELYNKLIKSREXXXXXXX 598
           + Q+L  I   F +RRT + ++K+LP K + V+F      Q + + K + + +       
Sbjct: 510 KTQELIEITKNFTLRRTAETISKFLPSKTDVVLFCKPTSGQLDAFRKTLSAAQLDFSRLT 569

Query: 599 XXXSQPLRAIGILKKLCNHPXXXXXXXXXXXXXXXXXXXXYNMPGSKARDVQTKYSAKFS 658
              S  L  I + KK+CN P                       P S+ + +    S K  
Sbjct: 570 FNSS--LGLITLFKKICNSPSLISQDSYYLETIK---------PNSEVK-ISAPDSGKLR 617

Query: 659 ILERFLHKIKTES-DDKIVLISNYTQTLDLIEKMCRYKHYSAVRLDGTMSINKRQKLVDR 717
           +L   L  ++  S  +K+V++SNYTQTLD+I+ M      S  RLDG+ +   R K+V+ 
Sbjct: 618 VLMALLDNLRKLSPQEKVVIVSNYTQTLDIIQNMICSNSLSFTRLDGSTANKDRDKIVNS 677

Query: 718 FNDPEGQEFIFLLSSKAGGCGINLIGANRLILMDPDWNPAADQQALARVWRDGQKKDCFI 777
           FN      F FLLS+K+GG G+NLIGA+RLIL D DWNPA D QA++R+ RDGQK++C+I
Sbjct: 678 FNTVPSI-FAFLLSAKSGGMGLNLIGASRLILFDNDWNPAIDLQAMSRIHRDGQKRECYI 736

Query: 778 YRFISTGTIEEKIFQRQSMKMSLSSCVVDAKEDV-----ERLFSSDNLRQLFQKNENTIC 832
           YR ++TG I+EKIFQRQ  K SLSS  +    D      + LF S++L+ LF  +  T  
Sbjct: 737 YRLLTTGCIDEKIFQRQLAKTSLSSKFMGDSADSNTESGDDLFGSEDLKDLFTVHATTSS 796

Query: 833 ETHETYHCKRCNAQG 847
            TH+      C+ QG
Sbjct: 797 NTHDLI----CSCQG 807

>YBR073W (RDH54) [263] chr2 (383172..385946) Protein required for
           mitotic diploid-specific recombination and repair and
           for meiosis [2775 bp, 924 aa]
          Length = 924

 Score =  371 bits (952), Expect = e-114,   Method: Compositional matrix adjust.
 Identities = 231/624 (37%), Positives = 341/624 (54%), Gaps = 61/624 (9%)

Query: 252 NKKKFASVPVVIDPKLAKILRPHQVEGVRFLYRCVTGLVMKDYLEAEAFNTSSEDPLKSD 311
           NK   A V V++DP L K LRPHQ EGV+F+Y C+ GL             + E+P   D
Sbjct: 243 NKNAAAEVDVIVDPLLGKFLRPHQREGVKFMYDCLMGLA----------RPTIENP---D 289

Query: 312 EKALTESQKTEQNNRGAYGCIMADEMGLGKTLQCIALMWTLLRQGPQGKR---------- 361
               T+S   E N+    GC++AD+MGLGKTL  I L+WTL+RQ P   +          
Sbjct: 290 IDCTTKSLVLE-NDSDISGCLLADDMGLGKTLMSITLIWTLIRQTPFASKVSCSQSGIPL 348

Query: 362 --LIDKCIIVCPSSLVNNWANELIKWLGPNTLTPLAVDGKKSSMGGGNTTVSQAIHAWAQ 419
             L  K ++VCP +L+ NW  E  KWL  + +  L +  + S           A+  + +
Sbjct: 349 TGLCKKILVVCPVTLIGNWKREFGKWLNLSRIGVLTLSSRNSP-----DMDKMAVRNFLK 403

Query: 420 AQGRNIVKPVLIISYETLRRNVDQLKNCN--VGLMLADEGHRLKNGDSLTFTALDSISCP 477
            Q       VLII YE L    ++L+     + +++ DEGHRLKNG S     L S+   
Sbjct: 404 VQR---TYQVLIIGYEKLLSVSEELEKNKHLIDMLVCDEGHRLKNGASKILNTLKSLDIR 460

Query: 478 RRVILSGTPIQNDLSEYFALLSFSNPGLLGSRAEFRKNFENPILRGRD-ADATDKEIT-K 535
           R+++L+GTPIQNDL+E+F ++ F NPG+LGS A F++ F  PI R RD A+  ++E+  K
Sbjct: 461 RKLLLTGTPIQNDLNEFFTIIDFINPGILGSFASFKRRFIIPITRARDTANRYNEELLEK 520

Query: 536 GEAQLQKLSTIVSKFIIRRTNDILAKYLPCKYEHVIFVNLKPLQNELYNKLIKSREXXXX 595
           GE + +++  I  +FI+RRTN IL KYLP K + ++F   KP   ++       +     
Sbjct: 521 GEERSKEMIEITKRFILRRTNAILEKYLPPKTDIILFC--KPYSQQILAFKDILQGARLD 578

Query: 596 XXXXXXSQPLRAIGILKKLCNHPXXXXXXXXXXXXXXXXXXXXYNMPGSKARDVQTKY-- 653
                 S  L  I +LKK+CN P                     ++  ++++D  ++   
Sbjct: 579 FGQLTFSSSLGLITLLKKVCNSPGLVGSDPYYKS----------HIKDTQSQDSYSRSLN 628

Query: 654 SAKFSILERFLHKIKTESDDKIVLISNYTQTLDLIEKMCRYKHYSAVRLDGTMSINKRQK 713
           S K  +L   L  I+  + +K+V++SNYTQTLD+IE +      S  RLDG++   +R  
Sbjct: 629 SGKLKVLMTLLEGIRKGTKEKVVVVSNYTQTLDIIENLMNMAGMSHCRLDGSIPAKQRDS 688

Query: 714 LVDRFNDPEGQEFIFLLSSKAGGCGINLIGANRLILMDPDWNPAADQQALARVWRDGQKK 773
           +V  FN      F FLLS+K+GG G+NL+G +RLIL D DWNP+ D QA++R+ RDGQKK
Sbjct: 689 IVTSFNRNPAI-FGFLLSAKSGGVGLNLVGRSRLILFDNDWNPSVDLQAMSRIHRDGQKK 747

Query: 774 DCFIYRFISTGTIEEKIFQRQSMKMSLSSCVVDAKE------DVERLFSSDNLRQLFQKN 827
            CFIYR ++TG I+EKI QRQ MK SLS   +   E        + LF+ ++L+ LF  +
Sbjct: 748 PCFIYRLVTTGCIDEKILQRQLMKNSLSQKFLGDSEMRNKESSNDDLFNKEDLKDLFSVH 807

Query: 828 ENTICETHETYHCKRCNAQGKQLK 851
            +T   TH+   C  C+  G++++
Sbjct: 808 TDTKSNTHDLI-CS-CDGLGEEIE 829

>CAGL0M01958g complement(238113..240875) similar to sp|P38086
           Saccharomyces cerevisiae YBR073w RDH54, hypothetical
           start
          Length = 920

 Score =  366 bits (940), Expect = e-112,   Method: Compositional matrix adjust.
 Identities = 235/638 (36%), Positives = 347/638 (54%), Gaps = 68/638 (10%)

Query: 257 ASVPVVIDPKLAKILRPHQVEGVRFLYRCVTGLVMKDYLEAEAFNTSSEDPLKSDEKALT 316
           + V +++DP L K+LR HQ  GV+F+Y C+ GL  +  L AE+          +D+K+  
Sbjct: 253 SEVDIIVDPLLCKMLRNHQRIGVKFMYDCLLGL--ETNLTAES----------TDDKSCR 300

Query: 317 ESQKTEQNNRGAYGCIMADEMGLGKTLQCIALMWTLLRQGPQGKR------------LID 364
             + ++       GCI+AD+MGLGKTL  I L+WTLL+Q P   +            +I 
Sbjct: 301 LERDSD-----IKGCILADDMGLGKTLMTITLIWTLLKQTPFASKVQCSQLGVPLSGMIS 355

Query: 365 KCIIVCPSSLVNNWANELIKWLGPNTLTPLAVDGKKSSMGGGNTTVSQAIHAWAQAQGRN 424
           K +IVCP +L+ NW  E  KWLG N +  L ++  K+++     +V   I      Q   
Sbjct: 356 KVVIVCPVTLIGNWKREFKKWLGLNRIGILTLN-PKNNVDMDKISVRNFIKVNRTYQ--- 411

Query: 425 IVKPVLIISYETLRRNVDQL--KNCNVGLMLADEGHRLKNGDSLTFTALDSISCPRRVIL 482
               VLI+ YE +    ++L  +   + L++ DEGHRLKNG S     L S+   ++VIL
Sbjct: 412 ----VLILGYEKVLTVQEELLKQKDKLDLLICDEGHRLKNGASKILKVLKSLDIDKKVIL 467

Query: 483 SGTPIQNDLSEYFALLSFSNPGLLGSRAEFRKNFENPILRGRDAD--ATDKEITKGEAQL 540
           +GTPIQNDL+E+F ++ F NPG+LG+ A F+K + NPI R RD +     K I +GE + 
Sbjct: 468 TGTPIQNDLNEFFTIIDFVNPGVLGTYASFKKLYINPISRARDINNKFNTKVIEQGEEKS 527

Query: 541 QKLSTIVSKFIIRRTNDILAKYLPCKYEHVIFVNLKPLQNELYNKLIKSREXXXXXXXXX 600
            +L     +FI+RR+N+IL+K+LP K + ++F      Q + +  +I++           
Sbjct: 528 NQLIEFTKRFILRRSNNILSKFLPPKTDIILFCRPTIEQIKAFRDIIENVRVDMNNITFN 587

Query: 601 XSQPLRAIGILKKLCNHPXXXXXXXXXXXXXXXXXXXXYNMPGSKARDVQTKYSAKFSIL 660
            S  L  I ++KK+CN P                     N   S         S K ++L
Sbjct: 588 TS--LGLINLMKKVCNSPSLLCNDPYYQSNVDSNIFTVSNKSNS---------SGKLTVL 636

Query: 661 ERFLHKIKTESD-DKIVLISNYTQTLDLIEKMCRYKHYSAVRLDGTMSINKRQKLVDRFN 719
              L +IK  S  +K+V++SNYTQ+LD+I+ +      S  RLDG     +R  LV+ FN
Sbjct: 637 LELLLEIKATSPMEKVVIVSNYTQSLDIIQGLMNSNQLSNCRLDGATPAKQRDMLVNTFN 696

Query: 720 DPEGQEFIFLLSSKAGGCGINLIGANRLILMDPDWNPAADQQALARVWRDGQKKDCFIYR 779
           +     F FLLS+KAGG G+NLIGA+RL+L D DWNPA D QA++R+ R+GQK+ C+IYR
Sbjct: 697 N-NPNIFGFLLSAKAGGVGLNLIGASRLVLFDNDWNPAVDLQAMSRIHREGQKRPCYIYR 755

Query: 780 FISTGTIEEKIFQRQSMKMS-----LSSCVVDAKEDVERLFSSDNLRQLFQKNENTICET 834
            I+TG I+EKI QRQ MK +     LSS   D     + LF   +L+ LF  ++NT   T
Sbjct: 756 LITTGCIDEKILQRQLMKHNLTRKFLSSNTSDTGSANDDLFDKSDLKDLFTIHQNTKSNT 815

Query: 835 HETYHCKRCNAQGKQLK------RAPAMLYGDATTWNH 866
           H+   C RC+  G++        +APA L G    W++
Sbjct: 816 HDLI-C-RCDGLGEEFDDDEEVLKAPA-LDGSFEQWSN 850

>CAGL0I01694g complement(141422..144637) similar to sp|P40352
           Saccharomyces cerevisiae YJR035w RAD26 DNA repair and
           recombination protein, start by similarity
          Length = 1071

 Score =  270 bits (689), Expect = 3e-76,   Method: Compositional matrix adjust.
 Identities = 183/540 (33%), Positives = 264/540 (48%), Gaps = 82/540 (15%)

Query: 330 GCIMADEMGLGKTLQCIALMWTL----LRQGPQGKRLIDKCIIVCPSSLVNNWANELIKW 385
           G I+ DEMGLGKT+Q  A +  L    L  GP         +IVCP++++  W NE+ +W
Sbjct: 317 GGIIGDEMGLGKTIQVTAFLAALHHSNLLSGP--------VLIVCPATVMKQWCNEIHQW 368

Query: 386 LGPNTLTPLAVDGKKSSMGGG-----NTTVSQA-------------IHAWAQAQG----- 422
             P     L       S+G G     N T  +               H +  A       
Sbjct: 369 WPPFRAVIL------HSIGAGMNDKSNLTEDEIENMIIKSELENTDFHDYENASKLKSKV 422

Query: 423 ------RNIVKPV------LIISYETLRRNVDQLKNCNVGLMLADEGHRLKNGDSLTFTA 470
                 +N++  V      +I +Y  LR + D+L N N    + DEGH+++N DS     
Sbjct: 423 ETGMHMQNLISKVVADGHIIITTYVGLRIHSDKLLNVNWSYCVLDEGHKIRNPDSEISLT 482

Query: 471 LDSISCPRRVILSGTPIQNDLSEYFALLSFSNPGLLGSRAEFRKNFENPILRGRDADATD 530
              + C  R+ILSGTPIQN+L E ++L  F  PG LG+   F++ F  PI  G  A+AT+
Sbjct: 483 CKKLKCKNRIILSGTPIQNNLVELWSLFDFIYPGRLGTLPVFQQQFVQPINMGGYANATN 542

Query: 531 KEITKGEAQLQKLSTIVSKFIIRRTNDILAKYLPCKYEHVIFVNLKPLQNELYNKLIKSR 590
            ++  G      L  ++S +++RR    +AK LP K E V+F  L   Q   Y + + S 
Sbjct: 543 TQVQTGYRCAVALRDLISPYLLRRVKADVAKDLPKKKEMVLFCKLTEFQRRKYLEFLSSD 602

Query: 591 EXXXXXXXXXXSQPLRAIGILKKLCNHPXXXXXXXXXXXXXXXXXXXXYNMPGSKARDVQ 650
           E             L  I IL+K+CNHP                    Y  P        
Sbjct: 603 ELSQIKGGKR--HVLYGIDILRKICNHPDLLDRDYIKNTSG-------YGDP-------- 645

Query: 651 TKYSAKFSILERFLHKIKTESDDKIVLISNYTQTLDLIEKMCRYKH-----YSAVRLDGT 705
            K S K  ++++ L   K+E   K +L +   Q LD++E+  ++K         +R+DGT
Sbjct: 646 -KRSGKMQVVKQLLKLWKSEGH-KTLLFTQSRQMLDILEEFIKFKEPELSDIRYLRMDGT 703

Query: 706 MSINKRQKLVDRFNDPEGQEFIFLLSSKAGGCGINLIGANRLILMDPDWNPAADQQALAR 765
            SI  RQ LVDRFN+      +FLL+++ GG G+NL GANR+I+ DPDWNP+ D QA  R
Sbjct: 704 TSIQVRQTLVDRFNNESYD--VFLLTTRVGGLGVNLTGANRIIIYDPDWNPSTDLQARER 761

Query: 766 VWRDGQKKDCFIYRFISTGTIEEKIFQRQSMKMSLSSCVV-DAKEDVERLFSSDNLRQLF 824
            WR GQK++  IYR + +GTIEEKI+ RQ  K  L + V+ D K+  +R F +  L+ LF
Sbjct: 762 AWRIGQKREVSIYRLMISGTIEEKIYHRQIFKQFLMNKVLSDPKQ--KRFFKTKELQDLF 819

>Scas_549.4
          Length = 1079

 Score =  268 bits (686), Expect = 6e-76,   Method: Compositional matrix adjust.
 Identities = 180/537 (33%), Positives = 268/537 (49%), Gaps = 76/537 (14%)

Query: 330 GCIMADEMGLGKTLQCIALMWTLLRQGPQGKRLIDKCIIVCPSSLVNNWANELIKWLGPN 389
           G I+ DEMGLGKT+Q IA + +L   G     L    +IVCP++++  W NEL  W  P 
Sbjct: 324 GGIIGDEMGLGKTIQIIAFLASLHHSG----LLNGPVLIVCPATVMKQWCNELHHWWPP- 378

Query: 390 TLTPLAVDGKKSSMGGG-NTTVSQAIHAWAQA----------QGRNIVKP---------- 428
            L  + +    S M    N +  +   A   A          Q R+  K           
Sbjct: 379 -LRTIILHSTGSGMSTKKNFSEEELEQAMMNANPNELTCEDFQNRSKTKASLESTFNIQS 437

Query: 429 ----------VLIISYETLRRNVDQLKNCNVGLMLADEGHRLKNGDSLTFTALDSISCPR 478
                     ++I +Y  LR + +QL   N    + DEGH+++N DS        I  P 
Sbjct: 438 LIDKVINDGHIIITTYVGLRIHSEQLLKVNWAYAVLDEGHKIRNPDSDISLTCKKIKTPN 497

Query: 479 RVILSGTPIQNDLSEYFALLSFSNPGLLGSRAEFRKNFENPILRGRDADATDKEITKGEA 538
           R+ILSGTPIQN+L E ++L  F  PG LG+   F++ F  PI  G  A+AT+ ++  G  
Sbjct: 498 RIILSGTPIQNNLIELWSLFDFIYPGKLGTLPVFQQQFVMPINAGGYANATNIQVQTGVK 557

Query: 539 QLQKLSTIVSKFIIRRTNDILAKYLPCKYEHVIFVNLKPLQNELYNKLIKSREXXXXXXX 598
               L  ++S +++RR    +AK LP K E V+F  L   Q   Y + + S E       
Sbjct: 558 CATALRNLISPYLLRRVKSDVAKDLPEKKEMVLFCKLTQYQKNRYLEFLNSNELTQIRGG 617

Query: 599 XXXSQPLRAIGILKKLCNHPXXXXXXXXXXXXXXXXXXXXYNMPGSKARDVQTKY----- 653
                 L  I IL+K+CNHP                     ++   + R  +T Y     
Sbjct: 618 RR--HVLYGIDILRKICNHP---------------------DLLEREERQYETDYGNPKR 654

Query: 654 SAKFSILERFLHKIKTESDDKIVLISNYTQTLDLIEKMCRYKH-----YSAVRLDGTMSI 708
           S K  ++++ L     E   K +L +   Q LD++E+  ++K         +R+DGT +I
Sbjct: 655 SGKMQVVKQLLLLWHKEG-HKTLLFTQSRQMLDILEQFIQFKDSDLSVLKYLRMDGTSNI 713

Query: 709 NKRQKLVDRFNDPEGQEFIFLLSSKAGGCGINLIGANRLILMDPDWNPAADQQALARVWR 768
           +KRQ LVD+FN+ +    +FLL+++ GG G+NL GANR+I+ DPDWNP+ D QA  R WR
Sbjct: 714 SKRQGLVDQFNNEDYD--VFLLTTRVGGLGVNLTGANRIIIYDPDWNPSTDMQARERAWR 771

Query: 769 DGQKKDCFIYRFISTGTIEEKIFQRQSMKMSLSSCVV-DAKEDVERLFSSDNLRQLF 824
            GQK++  IYR + +G+IEEKI+ RQ  K  L++ ++ D K+  +R F  + LR LF
Sbjct: 772 IGQKREVSIYRLMVSGSIEEKIYHRQIFKQFLTNKILTDPKQ--KRFFKMNELRDLF 826

>KLLA0E22726g complement(2018248..2021349) similar to sp|P40352
           Saccharomyces cerevisiae YJR035w RAD26 DNA repair and
           recombination protein, start by similarity
          Length = 1033

 Score =  266 bits (679), Expect = 4e-75,   Method: Compositional matrix adjust.
 Identities = 178/544 (32%), Positives = 264/544 (48%), Gaps = 62/544 (11%)

Query: 330 GCIMADEMGLGKTLQCIALMWTLLRQGPQGKRLIDKCIIVCPSSLVNNWANELIKWLGPN 389
           G I+ DEMGLGKT+Q IA + TL       ++L    ++VCP++++  W NE   W  P 
Sbjct: 285 GGIIGDEMGLGKTIQIIAFLATL----HHSRKLNGPVLVVCPATVMKQWCNEFHTWWPPF 340

Query: 390 TLTPLAVDGKKSSMGGGNTTVSQAIHAW---------------------AQAQGRNIVKP 428
               L   G  + M  G     + +                           + R  VK 
Sbjct: 341 RAVILHSIG--AGMNKGTQIPEEELEKMLMTSNYGTFTYNDYEKKEKTRTSLESRKSVKK 398

Query: 429 VL----------IISYETLRRNVDQLKNCNVGLMLADEGHRLKNGDSLTFTALDSISCPR 478
           +L          I +Y  LR + + L N   G  + DEGH+++N DS        +    
Sbjct: 399 LLEKVITDGHIIITTYVGLRLHSEALLNVRWGYAILDEGHKIRNPDSDISLTCKQLKTQN 458

Query: 479 RVILSGTPIQNDLSEYFALLSFSNPGLLGSRAEFRKNFENPILRGRDADATDKEITKGEA 538
           R+ILSGTPIQN+L+E ++L  F  PG LG+   F++ F NPI  G  A+A++ ++  G  
Sbjct: 459 RIILSGTPIQNNLTELWSLFDFVYPGKLGTLPVFQQQFANPINMGGYANASNIQVKTGYK 518

Query: 539 QLQKLSTIVSKFIIRRTNDILAKYLPCKYEHVIFVNLKPLQNELYNKLIKSREXXXXXXX 598
               L  ++S +++RR    +AK LP K E V+F  L   Q   Y + + S E       
Sbjct: 519 CAVALRDLISPYLLRRVKSDVAKDLPKKNEMVLFCKLTQYQKSKYLEFLHSDELMKIRKG 578

Query: 599 XXXSQPLRAIGILKKLCNHPXXXXXXXXXXXXXXXXXXXXYNMPGSKARDVQTKYSAKFS 658
               Q L  I IL+K+CNHP                        G+ AR      S K  
Sbjct: 579 KR--QVLYGIDILRKICNHPDLLDLKRKKMNDYEDADY------GNPAR------SGKMQ 624

Query: 659 ILERFLHKIKTESDDKIVLISNYTQTLDLIEKMCRYK-----HYSAVRLDGTMSINKRQK 713
           ++++ L    ++   K +L +   Q LD++++   YK         +R+DGT +I  RQ 
Sbjct: 625 VVKQLLLLWHSQG-HKTLLFTQSRQMLDILQEFISYKDPELSDLKFLRMDGTTNIGSRQS 683

Query: 714 LVDRFNDPEGQEFIFLLSSKAGGCGINLIGANRLILMDPDWNPAADQQALARVWRDGQKK 773
           LVD+FN+      +FLL+++ GG GINL GANR+I+ DPDWNP+ D QA  R WR GQK+
Sbjct: 684 LVDKFNNEPYD--VFLLTTRVGGLGINLTGANRIIIFDPDWNPSTDMQARERAWRIGQKR 741

Query: 774 DCFIYRFISTGTIEEKIFQRQSMKMSLSSCVV-DAKEDVERLFSSDNLRQLFQKNENTIC 832
           +  IYR +  G+IEEKI+ RQ  K  LS+ ++ D K+  +R F  ++L  LF    +   
Sbjct: 742 EVTIYRLMIAGSIEEKIYHRQIFKQFLSNKILKDPKQ--KRFFKMNDLHDLFTLGGDNGY 799

Query: 833 ETHE 836
           ET E
Sbjct: 800 ETEE 803

>Sklu_2125.3 YJR035W, Contig c2125 6474-9632
          Length = 1052

 Score =  265 bits (676), Expect = 1e-74,   Method: Compositional matrix adjust.
 Identities = 175/531 (32%), Positives = 266/531 (50%), Gaps = 64/531 (12%)

Query: 330 GCIMADEMGLGKTLQCIALMWTLLRQGPQGKRLIDKCIIVCPSSLVNNWANELIKWLGP- 388
           G I+ DEMGLGKT+Q I+ + +L   G     L    +IVCP++++  W NE   W  P 
Sbjct: 305 GGIIGDEMGLGKTIQIISFLASLHHSG----MLDGPILIVCPATVMKQWCNEFHTWWPPF 360

Query: 389 --------------------NTLTPLAVDGKKSSMGGGNTTVSQAIHAWAQAQGRNIVK- 427
                               + L  + ++         + T S+   +  +++  N+ K 
Sbjct: 361 RAVILHSIGSGMSNKEKLSEDRLEEMLMNSNPEEFSYVDYTDSKKTKSTMESK-LNLTKL 419

Query: 428 --------PVLIISYETLRRNVDQLKNCNVGLMLADEGHRLKNGDSLTFTALDSISCPRR 479
                    VLI +Y  LR + D+L     G  + DEGH+++N DS        +    R
Sbjct: 420 VDKVVNDGHVLITTYVGLRLHADELLKVKWGYAVLDEGHKIRNPDSDISLTCKQLKTSNR 479

Query: 480 VILSGTPIQNDLSEYFALLSFSNPGLLGSRAEFRKNFENPILRGRDADATDKEITKGEAQ 539
           VILSGTPIQN+L+E ++L  F  PG LG+   F++ F  PI  G  A+AT+ ++  G   
Sbjct: 480 VILSGTPIQNNLTELWSLFDFIFPGRLGTLPVFQQQFAIPINMGGYANATNIQVQTGYKC 539

Query: 540 LQKLSTIVSKFIIRRTNDILAKYLPCKYEHVIFVNLKPLQNELYNKLIKSREXXXXXXXX 599
              L  ++S +++RR    +AK LP K E V+F  L   Q   Y + + S +        
Sbjct: 540 AVALRDLISPYLLRRVKTDVAKDLPKKNEMVLFCKLTQYQRNKYLQFLNSGD--LVKIKN 597

Query: 600 XXSQPLRAIGILKKLCNHPXXXXXXXXXXXXXXXXXXXXYNMPGSKARDVQTKYSAKFSI 659
              Q L  I IL+K+CNHP                     +M  S+      K S K  +
Sbjct: 598 GKRQVLYGIDILRKICNHPDILVR----------------DMRHSEESYGDPKRSGKMQV 641

Query: 660 LERFLHKIKTESDDKIVLISNYTQTLDLIEKMCRYK-----HYSAVRLDGTMSINKRQKL 714
           +++ L K+  E   K +L +   Q LD++EK   Y+       + +R+DGT +I  RQ L
Sbjct: 642 VKQLL-KLWKEQGHKTLLFTQSRQMLDILEKFISYRDPELSSLTYLRMDGTTNIAARQHL 700

Query: 715 VDRFNDPEGQEFIFLLSSKAGGCGINLIGANRLILMDPDWNPAADQQALARVWRDGQKKD 774
           VD+FN+      +FLL+++ GG G+NL GANR+I+ DPDWNP+ D QA  R WR GQK++
Sbjct: 701 VDKFNNELYD--VFLLTTRVGGLGVNLTGANRIIIFDPDWNPSTDLQARERAWRIGQKRE 758

Query: 775 CFIYRFISTGTIEEKIFQRQSMKMSLSSCVV-DAKEDVERLFSSDNLRQLF 824
             IYR +  G+IEEKI+ RQ  K  L++ ++ D K+  +R F  + L+ LF
Sbjct: 759 VTIYRLMIAGSIEEKIYHRQIFKQFLTNKILKDPKQ--KRFFKMNELQDLF 807

>AEL065C [2441] [Homologous to ScYJR035W (RAD26) - SH]
           (511520..514597) [3078 bp, 1025 aa]
          Length = 1025

 Score =  263 bits (671), Expect = 5e-74,   Method: Compositional matrix adjust.
 Identities = 177/567 (31%), Positives = 273/567 (48%), Gaps = 78/567 (13%)

Query: 330 GCIMADEMGLGKTLQCIALMWTLLRQGPQGKRLIDKCIIVCPSSLVNNWANELIKWLGPN 389
           G I+ DEMGLGKT+Q ++ + +L   G    +L    ++VCP++++  W +E   W  P 
Sbjct: 283 GGIVGDEMGLGKTIQIVSFLASLHHSG----KLKGPVLVVCPATVMKQWCSEFQTWWPPF 338

Query: 390 TLTPLAVDGKKSSMGGGNTTVSQ------------------AIHAWA-------QAQGRN 424
               L       S+G G  T  +                  +   +A       Q + R 
Sbjct: 339 RAVIL------HSIGAGMITRKKMTEEQLEELLMRDESNEFSYEQYANLGRTKKQLEARR 392

Query: 425 IVKP----------VLIISYETLRRNVDQLKNCNVGLMLADEGHRLKNGDSLTFTALDSI 474
            ++           +LI +Y  L+ + D L + N    + DEGH+++N D+        +
Sbjct: 393 GIESLVQKVVDDGHILITTYLGLQIHSDLLLHVNWDYAVLDEGHKIRNPDAGISLTCKRL 452

Query: 475 SCPRRVILSGTPIQNDLSEYFALLSFSNPGLLGSRAEFRKNFENPILRGRDADATDKEIT 534
             P R+ILSGTPIQN+L+E ++L  F  PG LG+   F++ F NPI  G  A+AT+ ++ 
Sbjct: 453 RTPHRIILSGTPIQNNLTELWSLFDFIFPGKLGTLPVFQQQFANPINAGGYANATNIQVQ 512

Query: 535 KGEAQLQKLSTIVSKFIIRRTNDILAKYLPCKYEHVIFVNLKPLQNELYNKLIKSREXXX 594
            G      L  ++S +++RR  + +AK LP K E V+F  +   Q E Y + + S +   
Sbjct: 513 TGYKCAVALRDLISPYLLRRVKNDVAKDLPKKNEFVLFCKMTQFQKEKYLQFLNSEDMIK 572

Query: 595 XXXXXXXSQPLRAIGILKKLCNHPXXXXXXXXXXXXXXXXXXXXYNMPGSKARDVQTKYS 654
                   Q L  I IL+K+CNHP                    +  P         + S
Sbjct: 573 IKNGRR--QVLYGIDILRKICNHPDLLERDFRKHEPS-------FGDP---------RRS 614

Query: 655 AKFSILERFLHKIKTESDDKIVLISNYTQTLDLIEKMCRYKH-----YSAVRLDGTMSIN 709
            K +++++ L   K +   K +L +   Q LD++E    +K         +R+DGT +I 
Sbjct: 615 GKMTVIKQLLLTWKKQGH-KALLFTQSRQMLDILEAYISHKDPELAGLQYLRMDGTTNIA 673

Query: 710 KRQKLVDRFNDPEGQEFIFLLSSKAGGCGINLIGANRLILMDPDWNPAADQQALARVWRD 769
            RQ LVDRFN+  G   +FLL+++ GG G+NL GANR+I+ DPDWNP+ D QA  R WR 
Sbjct: 674 HRQALVDRFNN--GPYHLFLLTTRVGGLGVNLTGANRIIIFDPDWNPSTDLQARERAWRI 731

Query: 770 GQKKDCFIYRFISTGTIEEKIFQRQSMKMSLSSCVV-DAKEDVERLFSSDNLRQLFQKNE 828
           GQK+D  IY  +  G+IEEKI+ RQ  K  L++ V+ D K+  +R F  + L  LF    
Sbjct: 732 GQKRDVTIYLLMVAGSIEEKIYHRQIFKQFLTNKVLSDPKQ--KRFFKMNELHDLFSFGP 789

Query: 829 NTICETHETYHCKRCNAQGKQLKRAPA 855
               ++           Q   L+R PA
Sbjct: 790 GAASDS----FASEIEQQTASLRRQPA 812

>YJR035W (RAD26) [2931] chr10 (497269..500526) Putative helicase
           involved in transcription-coupled repair in some strain
           backgrounds, may have a role in chromatin remodeling,
           homolog of Cockayne syndrome B gene ERCC-6 [3258 bp,
           1085 aa]
          Length = 1085

 Score =  251 bits (641), Expect = 6e-70,   Method: Compositional matrix adjust.
 Identities = 178/535 (33%), Positives = 258/535 (48%), Gaps = 70/535 (13%)

Query: 330 GCIMADEMGLGKTLQCIALMWTLLRQGPQGKRLIDKCIIVCPSSLVNNWANELIKWLGP- 388
           G I+ DEMGLGKT+Q IA +  L   G     L    +IVCP++++  W NE   W  P 
Sbjct: 317 GGIIGDEMGLGKTIQVIAFIAALHHSGL----LTGPVLIVCPATVMKQWCNEFQHWWPPL 372

Query: 389 ----------------------NTLTPLAVDGKKSSMG---GGNTTVSQAIHAWAQAQGR 423
                                 N L  L ++ K S        N+T ++     +    +
Sbjct: 373 RTVILHSMGSGMASDQKFKMDENDLENLIMNSKPSDFSYEDWKNSTRTKKALESSYHLDK 432

Query: 424 NIVKPV-----LIISYETLRRNVDQLKNCNVGLMLADEGHRLKNGDSLTFTALDSISCPR 478
            I K V     LI +Y  LR + D+L        + DEGH+++N DS        +    
Sbjct: 433 LIDKVVTDGHILITTYVGLRIHSDKLLKVKWQYAVLDEGHKIRNPDSEISLTCKKLKTHN 492

Query: 479 RVILSGTPIQNDLSEYFALLSFSNPGLLGSRAEFRKNFENPILRGRDADATDKEITKGEA 538
           R+ILSGTPIQN+L+E ++L  F  PG LG+   F++ F  PI  G  A+AT+ ++  G  
Sbjct: 493 RIILSGTPIQNNLTELWSLFDFIFPGKLGTLPVFQQQFVIPINIGGYANATNIQVQTGYK 552

Query: 539 QLQKLSTIVSKFIIRRTNDILAKYLPCKYEHVIFVNLKPLQNELYNKLIKSREXXXXXXX 598
               L  ++S +++RR    +AK LP K E V+F  L   Q   Y + + S +       
Sbjct: 553 CAVALRDLISPYLLRRVKADVAKDLPQKKEMVLFCKLTKYQRSKYLEFLHSSDLNQIQNG 612

Query: 599 XXXSQPLRAIGILKKLCNHPXXXXXXXXXXXXXXXXXXXXYNMPGSKARDVQTKYSAKFS 658
                 L  I IL+K+CNHP                    Y  P         K S K  
Sbjct: 613 KR--NVLFGIDILRKICNHPDLLDRDTKRHNPD-------YGDP---------KRSGKMQ 654

Query: 659 ILERFL---HKIKTESDDKIVLISNYTQTLDLIEKMCRYK-----HYSAVRLDGTMSINK 710
           ++++ L   HK       K +L +   Q LD++E+    K     H + +R+DGT +I  
Sbjct: 655 VVKQLLLLWHK----QGYKALLFTQSRQMLDILEEFISTKDPDLSHLNYLRMDGTTNIKG 710

Query: 711 RQKLVDRFNDPEGQEFIFLLSSKAGGCGINLIGANRLILMDPDWNPAADQQALARVWRDG 770
           RQ LVDRFN+      +FLL+++ GG G+NL GANR+I+ DPDWNP+ D QA  R WR G
Sbjct: 711 RQSLVDRFNNESFD--VFLLTTRVGGLGVNLTGANRIIIFDPDWNPSTDMQARERAWRIG 768

Query: 771 QKKDCFIYRFISTGTIEEKIFQRQSMKMSLSSCVV-DAKEDVERLFSSDNLRQLF 824
           QK++  IYR +  G+IEEKI+ RQ  K  L++ ++ D K+  +R F    L  LF
Sbjct: 769 QKREVSIYRLMVGGSIEEKIYHRQIFKQFLTNRILTDPKQ--KRFFKIHELHDLF 821

>Scas_652.17
          Length = 1025

 Score =  233 bits (593), Expect = 1e-63,   Method: Compositional matrix adjust.
 Identities = 155/492 (31%), Positives = 243/492 (49%), Gaps = 62/492 (12%)

Query: 325 NRGAYGCIMADEMGLGKTLQCIALMWTL-LRQGPQGKRLIDKCIIVCPSSLVNNWANELI 383
           ++     I+ADEMGLGKTLQ IA +  L   +G  G  L+     + P S +NNW  E+ 
Sbjct: 128 HKNGLAGILADEMGLGKTLQTIAFLGYLKYMEGINGPFLV-----IAPKSTLNNWLREIN 182

Query: 384 KWLGPNTLTPLAVDGKKSSMGGGNTTVSQAIHAWAQAQGRNIVKPVLIISYETLRRNVDQ 443
           KW      TP   D K   + G     +  I         +IV    + SYE + R    
Sbjct: 183 KW------TP---DVKAFVLQGDKQERASLIKEKLMTCDFDIV----VASYEIIIREKAA 229

Query: 444 LKNCNVGLMLADEGHRLKNGDSLTFTALDSISCPRRVILSGTPIQNDLSEYFALLSFSNP 503
            K  N   ++ DE HR+KN +SL    L   +   R++++GTP+QN+L E +ALL+F  P
Sbjct: 230 FKKFNWEYIIIDEAHRIKNEESLLSQVLREFTSRNRLLITGTPLQNNLHELWALLNFLLP 289

Query: 504 GLLGSRAEFRKNFENPILRGRDADATDKEITKGEAQLQKLSTIVSKFIIRRT-NDILAKY 562
            +  S  +F   F         ++ T+++  K   QL    T++  F++RR  ND+    
Sbjct: 290 DIFSSSQDFDDWFS--------SETTEEDQDKVVKQLH---TVLQPFLLRRIKNDVETSL 338

Query: 563 LPCKYEHVIFVNLKPLQNELYNKLIKSREXXXXXXXXXXSQPLRAIGI---LKKLCNHPX 619
           LP K E  ++V +  +Q + Y K+++                 R + I   L+K CNHP 
Sbjct: 339 LPKK-ELNLYVGMSNMQKKWYKKILEKDLDAVNGENSSKESKTRLLNIVMQLRKCCNHP- 396

Query: 620 XXXXXXXXXXXXXXXXXXXYNMPGSK-----ARDVQTKY-SAKFSILERFLHKIKTESDD 673
                              Y   G++       D    Y S K  +L++ L K+K E   
Sbjct: 397 -------------------YLFDGAEPGPPYTTDEHLVYNSKKLQVLDKLLKKMK-EDGS 436

Query: 674 KIVLISNYTQTLDLIEKMCRYKHYSAVRLDGTMSINKRQKLVDRFNDPEGQEFIFLLSSK 733
           ++++ S  ++ LD++E  C ++ Y   R+DG+     R K +D +N P+  +FIFLL+++
Sbjct: 437 RVLIFSQMSRVLDILEDYCFFRGYKYCRIDGSTDHEDRIKSIDDYNAPDSDKFIFLLTTR 496

Query: 734 AGGCGINLIGANRLILMDPDWNPAADQQALARVWRDGQKKDCFIYRFISTGTIEEKIFQR 793
           AGG GINL  A+ ++L D DWNP AD QA+ R  R GQKK   ++RF++  ++EEKI +R
Sbjct: 497 AGGLGINLTSADIVVLYDSDWNPQADLQAMDRAHRIGQKKQVKVFRFVTDNSVEEKILER 556

Query: 794 QSMKMSLSSCVV 805
            + K+ L   V+
Sbjct: 557 ATQKLRLDQLVI 568

>YOR304W (ISW2) [5088] chr15 (884510..887872) Protein required for
           Ume6p-dependent transcriptional repression of several
           meiotic genes, has chromatin remodeling activity, has
           strong similarity to Drosophila nucleosome remodeling
           factor ISWI (Imitator SWI) [3363 bp, 1120 aa]
          Length = 1120

 Score =  233 bits (593), Expect = 2e-63,   Method: Compositional matrix adjust.
 Identities = 152/491 (30%), Positives = 244/491 (49%), Gaps = 74/491 (15%)

Query: 332 IMADEMGLGKTLQCIALMWTLLR----QGPQGKRLIDKCIIVCPSSLVNNWANELIKWLG 387
           I+ADEMGLGKTLQ I+ +  L      +GP         +I+ P S ++NW  E +KW  
Sbjct: 206 ILADEMGLGKTLQTISFLGYLRYVKQIEGP--------FLIIVPKSTLDNWRREFLKW-T 256

Query: 388 PNTLTPLAVDGKKSSMGGGNTTVSQAIHAWAQAQGRNIVKP----VLIISYETLRRNVDQ 443
           PN +  L + G K +                    RNI+      VLI SYE + R  + 
Sbjct: 257 PN-VNVLVLHGDKDTRADI---------------VRNIILEARFDVLITSYEMVIREKNA 300

Query: 444 LKNCNVGLMLADEGHRLKNGDSLTFTALDSISCPRRVILSGTPIQNDLSEYFALLSFSNP 503
           LK      ++ DE HR+KN  S     +       R++++GTP+QN+L E +ALL+F  P
Sbjct: 301 LKRLAWQYIVIDEAHRIKNEQSALSQIIRLFYSKNRLLITGTPLQNNLHELWALLNFLLP 360

Query: 504 GLLGSRAEFRKNFENPILRGRDADATDKEITKGEAQLQKLSTIVSKFIIRRTNDILAKYL 563
            + G    F + FE      ++    D+EI      +Q+L ++++ F++RR    + K L
Sbjct: 361 DIFGDSELFDEWFE------QNNSEQDQEIV-----IQQLHSVLNPFLLRRVKADVEKSL 409

Query: 564 PCKYEHVIFVNLKPLQNELYNKLIKSREXXXXXXXXXXSQPLRAIGI---LKKLCNHPXX 620
             K E  ++V +  +Q + Y  L++                 R + I   L+K CNHP  
Sbjct: 410 LPKIETNVYVGMTDMQIQWYKSLLEKDIDAVNGAVGKREGKTRLLNIVMQLRKCCNHP-- 467

Query: 621 XXXXXXXXXXXXXXXXXXYNMPGSK-----ARDVQTKY-SAKFSILERFLHKIKTESDDK 674
                             Y   G++       D    + S K  IL++ L ++K E   +
Sbjct: 468 ------------------YLFEGAEPGPPYTTDEHLIFNSGKMIILDKLLKRLK-EKGSR 508

Query: 675 IVLISNYTQTLDLIEKMCRYKHYSAVRLDGTMSINKRQKLVDRFNDPEGQEFIFLLSSKA 734
           +++ S  ++ LD++E  C ++ +   R+DG+ S  +R + +D +N P  ++F+FLL+++A
Sbjct: 509 VLIFSQMSRLLDILEDYCYFRDFEYCRIDGSTSHEERIEAIDEYNKPNSEKFVFLLTTRA 568

Query: 735 GGCGINLIGANRLILMDPDWNPAADQQALARVWRDGQKKDCFIYRFISTGTIEEKIFQRQ 794
           GG GINL+ A+ +IL D DWNP AD QA+ R  R GQKK   +YRF++   IEEK+ +R 
Sbjct: 569 GGLGINLVTADTVILFDSDWNPQADLQAMDRAHRIGQKKQVHVYRFVTENAIEEKVIERA 628

Query: 795 SMKMSLSSCVV 805
           + K+ L   V+
Sbjct: 629 AQKLRLDQLVI 639

>CAGL0I09614g 917707..920826 highly similar to tr|Q08773
           Saccharomyces cerevisiae YOR304w ISW2 or sp|P38144
           Saccharomyces cerevisiae YBR245c ISW1, hypothetical
           start
          Length = 1039

 Score =  231 bits (590), Expect = 3e-63,   Method: Compositional matrix adjust.
 Identities = 168/574 (29%), Positives = 271/574 (47%), Gaps = 96/574 (16%)

Query: 332 IMADEMGLGKTLQCIALMWTLLRQGPQGKRLIDKCIIVCPSSLVNNWANELIKWLGPNTL 391
           I+ADEMGLGKTLQ I+ +  L       K++    +++ P S ++NW  E  KW  PN  
Sbjct: 155 ILADEMGLGKTLQTISFLGYL----RYVKKIEGPFLVIVPKSTLDNWRREFFKW-TPNV- 208

Query: 392 TPLAVDGKKSSMGGGNTTVSQAIHAWAQAQGRNIVKP----VLIISYETLRRNVDQLKNC 447
                          +TTV Q      Q   +NIV      VLI SYE + R    LK  
Sbjct: 209 ---------------STTVLQGTKEQRQDILQNIVLEARFDVLITSYEMVIREKGYLKRL 253

Query: 448 NVGLMLADEGHRLKNGDSLTFTALDSISCPRRVILSGTPIQNDLSEYFALLSFSNPGLLG 507
               ++ DE HR+KN  S     +       R++++GTP+QN+L E +ALL+F  P + G
Sbjct: 254 AWEYIVIDEAHRIKNEQSALSQIIRLFYSKNRLLITGTPLQNNLHELWALLNFLLPDVFG 313

Query: 508 SRAEFRKNFENPILRGRDADATDKEITKGEAQLQKLSTIVSKFIIRRTNDILAKYLPCKY 567
               F   F+      ++    D+E+      +Q+L  +++ F++RR    + K L  K 
Sbjct: 314 DSEVFDDWFQ------QNNSDQDQEVV-----VQQLHAVLNPFLLRRIKADVEKSLLPKI 362

Query: 568 EHVIFVNLKPLQNELYNKLIKSREXXXXXXXXXXSQPLRAIGI---LKKLCNHPXXXXXX 624
           E  ++V +  +Q + Y  L++                 R + I   L+K CNHP      
Sbjct: 363 ETNVYVGMTDMQVQWYKSLLEKDIDAVNGAVGKREGKTRLLNIVMQLRKCCNHP------ 416

Query: 625 XXXXXXXXXXXXXXYNMPGSK-----ARDVQTKYSA-KFSILERFLHKIKTESDDKIVLI 678
                         Y   G++       D    ++A K  +L++ L ++K E   ++++ 
Sbjct: 417 --------------YLFEGAEPGPPYTTDEHLIFNAGKMIVLDKLLKRLK-EKGSRVLIF 461

Query: 679 SNYTQTLDLIEKMCRYKHYSAVRLDGTMSINKRQKLVDRFNDPEGQEFIFLLSSKAGGCG 738
           S  ++ LD++E  C +++Y+  R+DG+ S  +R   +D +N P  ++F+FLL+++AGG G
Sbjct: 462 SQMSRLLDILEDYCYFRNYNYCRIDGSTSHEERIDAIDEYNKPNSEKFVFLLTTRAGGLG 521

Query: 739 INLIGANRLILMDPDWNPAADQQALARVWRDGQKKDCFIYRFISTGTIEEKIFQRQSMKM 798
           INL+ A+ ++L D DWNP AD QA+ R  R GQKK   +YRF++   IEEK+ +R + K+
Sbjct: 522 INLVTADTVVLFDSDWNPQADLQAMDRAHRIGQKKQVHVYRFVTENAIEEKVLERAAQKL 581

Query: 799 SLSSCVV------------DAKEDVERLFSSDNLRQLFQKNENTI--------------C 832
            L   V+            ++K+D+  +      + +F+KN  TI               
Sbjct: 582 RLDQLVIQQGSGKKTANLGNSKDDLIEMIQY-GAKNVFEKNGTTISVDADIDEILKKGEA 640

Query: 833 ETHETYHCKRCNAQG-KQLKRAPAMLYGDATTWN 865
           +THE     R  A G   L+R   M    A  WN
Sbjct: 641 KTHEL--NARYEALGLDDLQRFNGMENQSAYEWN 672

>CAGL0C01683g 178695..182042 highly similar to sp|P38144
           Saccharomyces cerevisiae YBR245c ISW1 or tr|Q08773
           Saccharomyces cerevisiae YOR304w ISW2, hypothetical
           start
          Length = 1115

 Score =  231 bits (590), Expect = 3e-63,   Method: Compositional matrix adjust.
 Identities = 147/488 (30%), Positives = 246/488 (50%), Gaps = 68/488 (13%)

Query: 332 IMADEMGLGKTLQCIALMWTLLRQGPQGKRLIDKC----IIVCPSSLVNNWANELIKWLG 387
           I+ADEMGLGKTLQ I+ +  L        R I K     +++ P S +NNW  E+ KW  
Sbjct: 197 ILADEMGLGKTLQTISFLGYL--------RYIKKIPGPFLVIAPKSTLNNWLREINKW-- 246

Query: 388 PNTLTPLAVDGKKSSMGGGNTTVSQAIHAWAQAQGRNIVKPVLIISYETLRRNVDQLKNC 447
               TP   +     + G     ++ I     A   ++V    I SYE + R     +  
Sbjct: 247 ----TP---EVNAFILQGDKEERARLIQDKFMACDFDVV----IASYEIIIREKAAFRKM 295

Query: 448 NVGLMLADEGHRLKNGDSLTFTALDSISCPRRVILSGTPIQNDLSEYFALLSFSNPGLLG 507
           N   ++ DE HR+KN +S+    L       R++++GTP+QN+L E +ALL+F  P +  
Sbjct: 296 NWEYIMIDEAHRIKNEESMLSQVLREFHSKNRLLITGTPLQNNLHELWALLNFLLPDIFS 355

Query: 508 SRAEFRKNFENPILRGRDADATDKEITKGEAQLQKLSTIVSKFIIRRT-NDILAKYLPCK 566
              +F + F       ++ D  D+E       +++L T++  F++RR  +D+    LP K
Sbjct: 356 DSQDFDEWF------SKETDEEDQEKI-----VKQLHTVLQPFLLRRIKSDVETSLLPKK 404

Query: 567 YEHVIFVNLKPLQNELYNKLIKSREXXXXXXXXXXSQPLRAIGI---LKKLCNHPXXXXX 623
            E  ++V + P+Q + Y ++++                 R + I   L+K CNHP     
Sbjct: 405 -ELNVYVGMSPMQKKWYRQILEKDIDAVNADSGSKESKTRLLNIVMQLRKCCNHP----- 458

Query: 624 XXXXXXXXXXXXXXXYNMPGSK-----ARDVQTKY-SAKFSILERFLHKIKTESDDKIVL 677
                          Y   G++       D    Y S K  +L++ L K+K E+  ++++
Sbjct: 459 ---------------YLFDGAEPGPPYTTDEHLVYNSEKLKVLDKLLRKLK-EAGSRVLI 502

Query: 678 ISNYTQTLDLIEKMCRYKHYSAVRLDGTMSINKRQKLVDRFNDPEGQEFIFLLSSKAGGC 737
            S  ++ LD++E  C ++ Y   R+DG+ +   R + +D +N P+ ++F+FLL+++AGG 
Sbjct: 503 FSQMSRVLDILEDYCYFREYEYCRIDGSTAHEDRIEAIDEYNAPDSKKFLFLLTTRAGGL 562

Query: 738 GINLIGANRLILMDPDWNPAADQQALARVWRDGQKKDCFIYRFISTGTIEEKIFQRQSMK 797
           GINL  A+ ++L D DWNP AD QA+ R  R GQKK   ++RF++  ++EEKI +R + K
Sbjct: 563 GINLTTADVVVLFDSDWNPQADLQAMDRAHRIGQKKQVRVFRFVTDNSVEEKILERATQK 622

Query: 798 MSLSSCVV 805
           + L   V+
Sbjct: 623 LRLDQLVI 630

>CAGL0M04807g complement(514847..520039) similar to sp|P22082
            Saccharomyces cerevisiae YOR290c SNF2 or sp|P32597
            Saccharomyces cerevisiae YIL126w STH1, hypothetical start
          Length = 1730

 Score =  224 bits (572), Expect = 2e-60,   Method: Compositional matrix adjust.
 Identities = 154/483 (31%), Positives = 234/483 (48%), Gaps = 40/483 (8%)

Query: 332  IMADEMGLGKTLQCIALMWTLLRQGPQGKRLIDKCIIVCPSSLVNNWANELIKWLGPNTL 391
            I+ADEMGLGKT+Q I+L+  L     + K +    +I+ P S + NW++E  KW  P   
Sbjct: 824  ILADEMGLGKTIQTISLLTYLY----EMKNIKGPFLIIVPLSTLPNWSSEFAKW-APKLR 878

Query: 392  TPLAVDGKKSSMGGGNTTVSQAIHAWAQAQGRNIVKPVLIISYETLRRNVDQLKNCNVGL 451
            T        S  G  N           QAQ ++     +I ++E + +    L       
Sbjct: 879  T-------ISYKGSPNE------RKMKQAQIKSGEFDAVITTFEYIIKERAILSKVKWVH 925

Query: 452  MLADEGHRLKNGDS-LTFTALDSISCPRRVILSGTPIQNDLSEYFALLSFSNPGLLGSRA 510
            M+ DEGHR+KN  S L+ T         R+IL+GTP+QN+L E +ALL+F  P +  S  
Sbjct: 926  MIIDEGHRMKNAQSKLSLTLNTFYHSDYRLILTGTPLQNNLPELWALLNFVLPKIFNSAK 985

Query: 511  EFRKNFENPILRGRDADATDKEITKGEAQL--QKLSTIVSKFIIRRTNDILAKYLPCKYE 568
             F + F  P       D    E+++ E  L  ++L  ++  F++RR    + K LP K E
Sbjct: 986  SFDEWFNTPFANTGGQDKI--ELSEEETLLIIRRLHKVLRPFLLRRLKKDVEKELPDKVE 1043

Query: 569  HVIFVNLKPLQNELYNKLIKSREXXXXXXXXXXSQPLRAIG----ILKKLCNHPXXXXXX 624
             VI   +  LQ+ +Y +++K ++             LR        LKK+CNHP      
Sbjct: 1044 KVIKCKMSALQHAMYQQMLKHKQLFIGDQKKNKLVGLRGFNNQLMQLKKICNHPFVFEEV 1103

Query: 625  XXXXXXXXXXXXXXYNMPGSKARDVQTKYSAKFSILERFLHKIKTESDDKIVLISNYTQT 684
                          + + G            KF +LER L K+K  S  ++++    TQ 
Sbjct: 1104 EDHINPTRDTNMNIWRVAG------------KFELLERILPKLKA-SRHRVLIFFQMTQI 1150

Query: 685  LDLIEKMCRYKHYSAVRLDGTMSINKRQKLVDRFNDPEGQEFIFLLSSKAGGCGINLIGA 744
            +D++E   RY     +RLDG    ++R +L+  FNDP  + F F+LS++AGG G+NL  A
Sbjct: 1151 MDIMEDFLRYIDIKYLRLDGHTRSDERGELLKLFNDPNSEYFCFILSTRAGGLGLNLQTA 1210

Query: 745  NRLILMDPDWNPAADQQALARVWRDGQKKDCFIYRFISTGTIEEKIFQRQSMKMSLSSCV 804
            + +I+ D DWNP  D QA  R  R GQK +  I R I+T ++EE I +R   K+ +   V
Sbjct: 1211 DTVIIFDTDWNPHQDLQAQDRAHRIGQKNEVRIIRLITTNSVEEVILERAYKKLDIDGKV 1270

Query: 805  VDA 807
            + A
Sbjct: 1271 IQA 1273

>KLLA0F24838g complement(2309842..2313030) similar to sgd|S0005831
           Saccharomyces cerevisiae YOR304w ISW2, hypothetical
           start
          Length = 1062

 Score =  223 bits (568), Expect = 2e-60,   Method: Compositional matrix adjust.
 Identities = 148/483 (30%), Positives = 239/483 (49%), Gaps = 58/483 (12%)

Query: 332 IMADEMGLGKTLQCIALMWTL-LRQGPQGKRLIDKCIIVCPSSLVNNWANELIKWLGPNT 390
           I+ADEMGLGKTLQ I+ +  L   +G +G       I++ P S ++NW  E  KW     
Sbjct: 158 ILADEMGLGKTLQSISFLGYLRYIKGIEGP-----YIVIVPKSTLDNWQREFAKW----- 207

Query: 391 LTPLAVDGKKSSMGGGNTTVSQAIHAWAQAQGRNIVKPVLIISYETLRRNVDQLKNCNVG 450
            TP      K+ +  G+    + +    + +       VLI SYE + +    LK     
Sbjct: 208 -TPEV----KTVILQGDKDFRKEL---IETKILTCNFDVLITSYEMVLKEKLTLKRFAWE 259

Query: 451 LMLADEGHRLKNGDSLTFTALDSISCPRRVILSGTPIQNDLSEYFALLSFSNPGLLGSRA 510
            +L DE HR+KN  S     +       R++++GTP+QN+L E +ALL+F  P + G   
Sbjct: 260 YILIDEAHRIKNEQSALSQVIRLFYSKNRLLITGTPLQNNLHELWALLNFLLPDVFGDSE 319

Query: 511 EFRKNFENPILRGRDADATDKEITKGEAQLQKLSTIVSKFIIRRTNDILAKYLPCKYEHV 570
            F + F+     G++ D         E  +Q+L +++  F++RR    + K L  K E  
Sbjct: 320 VFDEWFQQ---NGKEEDQ--------EVVVQQLHSVLQPFLLRRVKSEVEKSLLPKKEIN 368

Query: 571 IFVNLKPLQNELYNKLIKSREXXXXXXXXXXSQPLRAIGI---LKKLCNHPXXXXXXXXX 627
           ++V +  +Q E Y  L++                 R + I   L+K CNHP         
Sbjct: 369 LYVGMTDMQIEWYKSLLEKDIDAVNGAVGKREGKTRLLNIVMQLRKCCNHP--------- 419

Query: 628 XXXXXXXXXXXYNMPGSK-----ARDVQTKYSAKFSILERFLHKIKTESDDKIVLISNYT 682
                      Y   G++       D    +++   I+   L K K E   ++++ S  +
Sbjct: 420 -----------YLFEGAEPGPPYTTDEHLVFNSGKMIVLDKLLKKKKEQGSRVLIFSQMS 468

Query: 683 QTLDLIEKMCRYKHYSAVRLDGTMSINKRQKLVDRFNDPEGQEFIFLLSSKAGGCGINLI 742
           + LD++E  C ++ Y   R+DG+ S ++R + +D +N P  ++FIFLL+++AGG GINL+
Sbjct: 469 RLLDILEDYCYFRGYEYCRIDGSTSHDERVEAIDEYNKPNSEKFIFLLTTRAGGLGINLV 528

Query: 743 GANRLILMDPDWNPAADQQALARVWRDGQKKDCFIYRFISTGTIEEKIFQRQSMKMSLSS 802
            A+ ++L D DWNP AD QA+ R  R GQKK  F+YRF++   IEEK+ +R + K+ L  
Sbjct: 529 TADTVVLYDSDWNPQADLQAMDRAHRIGQKKQVFVYRFVTENAIEEKVIERAAQKLRLDQ 588

Query: 803 CVV 805
            V+
Sbjct: 589 LVI 591

>Scas_665.17
          Length = 1060

 Score =  222 bits (565), Expect = 6e-60,   Method: Compositional matrix adjust.
 Identities = 160/558 (28%), Positives = 262/558 (46%), Gaps = 62/558 (11%)

Query: 332 IMADEMGLGKTLQCIALMWTLLRQGPQGKRLIDKCIIVCPSSLVNNWANELIKWLGPNTL 391
           I+ADEMGLGKTLQ I+ +  L       K++    +IV P S ++NW  E  KW      
Sbjct: 159 ILADEMGLGKTLQTISFLGYL----RYVKKIDGPFLIVVPKSTLDNWRREFNKWTPEVNA 214

Query: 392 TPLAVDGKKSSMGGGNTTVSQAIHAWAQAQGRNIVKPVLIISYETLRRNVDQLKNCNVGL 451
             L  D ++      +  +                  VLI SYE + +  + LK      
Sbjct: 215 IVLHGDKEERHKILYDIVLEAKF-------------DVLITSYEMVIKEKNVLKKFAWQY 261

Query: 452 MLADEGHRLKNGDSLTFTALDSISCPRRVILSGTPIQNDLSEYFALLSFSNPGLLGSRAE 511
           ++ DE HR+KN  S     +       R++++GTP+QN+L E +ALL+F  P + G    
Sbjct: 262 IVIDEAHRIKNEQSQLSQIIRLFYSKNRLLITGTPLQNNLHELWALLNFLLPDVFGDSGI 321

Query: 512 FRKNFENPILRGRDADATDKEITKGEAQLQKLSTIVSKFIIRRTNDILAKYLPCKYEHVI 571
           F + FE      ++    D+EI      +Q+L T+++ F++RR    + K L  K E  +
Sbjct: 322 FDEWFE------QNNSEQDQEIV-----VQQLHTVLNPFLLRRIKADVEKSLLPKIETNV 370

Query: 572 FVNLKPLQNELYNKLIKSREXXXXXXXXXXSQPLRAIGI---LKKLCNHPXXXXXXXXXX 628
           +V +  +Q + Y  L++                 R + I   L+K CNHP          
Sbjct: 371 YVGMTEMQVKWYKSLLEKDIDAVNGAVGKREGKTRLLNIVMQLRKCCNHP---------- 420

Query: 629 XXXXXXXXXXYNMPGSK-----ARDVQTKYSA-KFSILERFLHKIKTESDDKIVLISNYT 682
                     Y   G++       D    ++A K  +L++ L ++K E   ++++ S  +
Sbjct: 421 ----------YLFEGAEPGPPYTTDEHLVFNAGKMIVLDKLLKRLK-EKGSRVLIFSQMS 469

Query: 683 QTLDLIEKMCRYKHYSAVRLDGTMSINKRQKLVDRFNDPEGQEFIFLLSSKAGGCGINLI 742
           + LD++E  C ++ Y   R+DG+ +   R + +D +N P   +F+FLL+++AGG GINL+
Sbjct: 470 RLLDILEDYCFFRGYEYCRIDGSTAHEDRIEAIDEYNKPNSDKFVFLLTTRAGGLGINLV 529

Query: 743 GANRLILMDPDWNPAADQQALARVWRDGQKKDCFIYRFISTGTIEEKIFQRQSMKMSLSS 802
            A+ +IL D DWNP AD QA+ R  R GQKK   +YRF++   IEEK+ +R + K+ L  
Sbjct: 530 TADTVILYDSDWNPQADLQAMDRAHRIGQKKQVTVYRFVTENAIEEKVIERAAQKLRLDQ 589

Query: 803 CVVD---AKEDVERLFSSDNLRQLFQKNENTICETHETYHCKRCNAQGKQLKRAPAMLYG 859
            V+     K+      + D+L ++ Q     + E  E    K  +   + LK+       
Sbjct: 590 LVIQQGTGKKTASLGSNKDDLLEMIQYGAKNMFENKEQQITKDADI-DEILKKGQLKTKE 648

Query: 860 DATTWNHLNHDALEKTND 877
               +  L  D L+K ND
Sbjct: 649 LNAKYQALGLDDLQKFND 666

>Kwal_34.15925
          Length = 1025

 Score =  221 bits (563), Expect = 8e-60,   Method: Compositional matrix adjust.
 Identities = 149/490 (30%), Positives = 235/490 (47%), Gaps = 72/490 (14%)

Query: 332 IMADEMGLGKTLQCIALMWTLLR----QGPQGKRLIDKCIIVCPSSLVNNWANELIKWLG 387
           I+ADEMGLGKTLQ IA +  L       GP         I++ P S +NNW  E  KW  
Sbjct: 151 ILADEMGLGKTLQTIAFLGYLRYLKDIDGPH--------IVIVPKSTLNNWKREFSKWTP 202

Query: 388 PNTLTPLAVDGKKSSMGGGNTTVSQAIHAWAQAQGRNIVKP----VLIISYETLRRNVDQ 443
                 L+ D ++                  Q   ++IV      VLI SYE + +    
Sbjct: 203 EVEAVVLSGDKEER-----------------QHLLKDIVLECKFDVLITSYEMVIKEKST 245

Query: 444 LKNCNVGLMLADEGHRLKNGDSLTFTALDSISCPRRVILSGTPIQNDLSEYFALLSFSNP 503
           LK      ++ DE HR+KN  S     +       R++++GTP+QN+L E +ALL+F  P
Sbjct: 246 LKRFMWQYIIVDEAHRIKNEQSTLSQIIRLFHSKSRLLITGTPLQNNLHELWALLNFLLP 305

Query: 504 GLLGSRAEFRKNFENPILRGRDADATDKEITKGEAQLQKLSTIVSKFIIRRTNDILAKYL 563
            + G    F + FE      +D D            +Q+L T++S F++RR    +   L
Sbjct: 306 DVFGDSDAFDRWFEQSDTE-KDQDVV----------VQQLHTVLSPFLLRRLKSEVETSL 354

Query: 564 PCKYEHVIFVNLKPLQNELYNKLIKSREXXXXXXXXXXSQPLRAIGI---LKKLCNHPXX 620
             K E  ++V +  +Q + Y  L++                 R + I   L+K CNHP  
Sbjct: 355 LPKIETNLYVGMTDMQVQWYKSLLEKDLDAVNGAIGKREGNTRLLNIVMQLRKCCNHP-- 412

Query: 621 XXXXXXXXXXXXXXXXXXYNMPGSK-----ARDVQTKYSAKFSILERFLHKIKTESDDKI 675
                             Y   G++       D    ++A   I+   L K K E+  ++
Sbjct: 413 ------------------YLFEGAEPGPPYTTDEHLIFNAGKMIVLDKLLKKKKEAGSRV 454

Query: 676 VLISNYTQTLDLIEKMCRYKHYSAVRLDGTMSINKRQKLVDRFNDPEGQEFIFLLSSKAG 735
           ++ S  ++ LD++E  C ++ Y   R+DG+ +  +R + +D+FN+P  ++FIFLL+++AG
Sbjct: 455 LIFSQMSRLLDILEDYCFFRDYDYCRIDGSTAHEERIEAIDQFNEPGSEKFIFLLTTRAG 514

Query: 736 GCGINLIGANRLILMDPDWNPAADQQALARVWRDGQKKDCFIYRFISTGTIEEKIFQRQS 795
           G GINL+ A+ +++ D DWNP AD QA+ R  R GQKK   +YRF++   IEEK+ +R +
Sbjct: 515 GLGINLVTADTVVIYDSDWNPQADLQAMDRAHRIGQKKQVHVYRFVTENAIEEKVIERAA 574

Query: 796 MKMSLSSCVV 805
            K+ L   V+
Sbjct: 575 QKLRLDQLVI 584

>YOR290C (SNF2) [5074] chr15 complement(855144..860255) Component of
            SWI-SNF global transcription activator complex, acts to
            assist gene-specific activators through chromatin
            remodeling, involved in sensitivity to UV irradiation
            [5112 bp, 1703 aa]
          Length = 1703

 Score =  222 bits (565), Expect = 1e-59,   Method: Compositional matrix adjust.
 Identities = 150/483 (31%), Positives = 238/483 (49%), Gaps = 40/483 (8%)

Query: 332  IMADEMGLGKTLQCIALMWTLLRQGPQGKRLIDKCIIVCPSSLVNNWANELIKWLGPNTL 391
            I+ADEMGLGKT+Q I+L+  L     + K +    +++ P S ++NW++E  KW  P TL
Sbjct: 789  ILADEMGLGKTIQTISLLTYLY----EMKNIRGPYLVIVPLSTLSNWSSEFAKW-AP-TL 842

Query: 392  TPLAVDGKKSSMGGGNTTVSQAIHAWAQAQGRNIVKPVLIISYETLRRNVDQLKNCNVGL 451
              ++  G  +                 QA+ R     V++ ++E + +    L       
Sbjct: 843  RTISFKGSPNERKA------------KQAKIRAGEFDVVLTTFEYIIKERALLSKVKWVH 890

Query: 452  MLADEGHRLKNGDS-LTFTALDSISCPRRVILSGTPIQNDLSEYFALLSFSNPGLLGSRA 510
            M+ DEGHR+KN  S L+ T         R+IL+GTP+QN+L E +ALL+F  P +  S  
Sbjct: 891  MIIDEGHRMKNAQSKLSLTLNTHYHADYRLILTGTPLQNNLPELWALLNFVLPKIFNSVK 950

Query: 511  EFRKNFENPILRGRDADATDKEITKGEAQL--QKLSTIVSKFIIRRTNDILAKYLPCKYE 568
             F + F  P       D    E+++ E  L  ++L  ++  F++RR    + K LP K E
Sbjct: 951  SFDEWFNTPFANTGGQDKI--ELSEEETLLVIRRLHKVLRPFLLRRLKKDVEKELPDKVE 1008

Query: 569  HVIFVNLKPLQNELYNKLIKSREXXXXXXXXXXSQPLRA----IGILKKLCNHPXXXXXX 624
             V+   +  LQ  +Y +++K R              LR     I  LKK+CNHP      
Sbjct: 1009 KVVKCKMSALQQIMYQQMLKYRRLFIGDQNNKKMVGLRGFNNQIMQLKKICNHPFVFEEV 1068

Query: 625  XXXXXXXXXXXXXXYNMPGSKARDVQTKYSAKFSILERFLHKIKTESDDKIVLISNYTQT 684
                             P  +  D   + + KF +L+R L K+K  +  ++++    TQ 
Sbjct: 1069 EDQIN------------PTRETNDDIWRVAGKFELLDRILPKLKA-TGHRVLIFFQMTQI 1115

Query: 685  LDLIEKMCRYKHYSAVRLDGTMSINKRQKLVDRFNDPEGQEFIFLLSSKAGGCGINLIGA 744
            +D++E   RY +   +RLDG    ++R +L+  FN P+ +   F+LS++AGG G+NL  A
Sbjct: 1116 MDIMEDFLRYINIKYLRLDGHTKSDERSELLRLFNAPDSEYLCFILSTRAGGLGLNLQTA 1175

Query: 745  NRLILMDPDWNPAADQQALARVWRDGQKKDCFIYRFISTGTIEEKIFQRQSMKMSLSSCV 804
            + +I+ D DWNP  D QA  R  R GQK +  I R I+T ++EE I +R   K+ +   V
Sbjct: 1176 DTVIIFDTDWNPHQDLQAQDRAHRIGQKNEVRILRLITTNSVEEVILERAYKKLDIDGKV 1235

Query: 805  VDA 807
            + A
Sbjct: 1236 IQA 1238

>Kwal_34.16082
          Length = 726

 Score =  216 bits (551), Expect = 1e-59,   Method: Compositional matrix adjust.
 Identities = 153/473 (32%), Positives = 225/473 (47%), Gaps = 71/473 (15%)

Query: 330 GCIMADEMGLGKTLQCIALMWTLLRQGPQGKRLIDKCIIVCPSSLVNNWANELIKWLGPN 389
           G I+ DEMGLGKT+Q IA + +L   G    +L    +IVCP++++  W  E   W  P 
Sbjct: 283 GGIIGDEMGLGKTIQIIAFLASLHHSG----KLDGPVLIVCPATVLRQWCKEFHTWWPPF 338

Query: 390 TLTPLAVDGKKSSMGGGNT---TVSQ---------------AIHAW------------AQ 419
               L       S+G G T   T+S+               +  A+              
Sbjct: 339 RTVIL------HSIGAGMTQKDTISEEKLEELFMNSNPEELSYDAYMDSKRTKSTLESGM 392

Query: 420 AQGRNIVKPV-----LIISYETLRRNVDQLKNCNVGLMLADEGHRLKNGDSLTFTALDSI 474
           A+ + I K V     LI +Y  LR + D L N      + DEGH+++N D+        +
Sbjct: 393 ARSKLINKVVSEGHILITTYVGLRIHADNLLNVRWSYAVLDEGHKIRNPDADISLTCKKL 452

Query: 475 SCPRRVILSGTPIQNDLSEYFALLSFSNPGLLGSRAEFRKNFENPILRGRDADATDKEIT 534
               R+ILSGTPIQN+L+E ++L  F  PG LG+   F++ F  PI  G  A+AT+ ++ 
Sbjct: 453 KTKNRIILSGTPIQNNLTELWSLFDFIYPGRLGTLPVFQQQFSIPINVGGYANATNIQVQ 512

Query: 535 KGEAQLQKLSTIVSKFIIRRTNDILAKYLPCKYEHVIFVNLKPLQNELYNKLIKSREXXX 594
            G      L  ++S +++RR    +AK LP K E V+F  L   Q   Y + + S +   
Sbjct: 513 TGYKCAIALRNLISPYLLRRIKADVAKDLPKKNEMVLFCKLTQFQRRKYLQFLNSEDLTK 572

Query: 595 XXXXXXXSQPLRAIGILKKLCNHPXXXXXXXXXXXXXXXXXXXXYNMPGSKARDVQTKYS 654
                   Q L  I IL+K+CNHP                    Y  P         K S
Sbjct: 573 IKNGKR--QVLFGIDILRKICNHP-------DLLEKDKRENESSYGDP---------KRS 614

Query: 655 AKFSILERFLHKIKTESDDKIVLISNYTQTLDLIEKMCRYK-----HYSAVRLDGTMSIN 709
            K  ++++ L ++      K +L +   Q LD++EK   YK       + +R+DGT +I 
Sbjct: 615 GKMQVVKQLL-RLWHSQGHKTLLFTQSRQMLDILEKFISYKDPELEDLTYLRMDGTTNIG 673

Query: 710 KRQKLVDRFNDPEGQEFIFLLSSKAGGCGINLIGANRLILMDPDWNPAADQQA 762
            RQ LVD FN+  G   +FLL+++ GG G+NL GANR+I+ DPDWNP+ D QA
Sbjct: 674 SRQALVDSFNN--GLYDVFLLTTRVGGLGVNLTGANRIIIFDPDWNPSTDMQA 724

>Kwal_14.1600
          Length = 1102

 Score =  220 bits (561), Expect = 2e-59,   Method: Compositional matrix adjust.
 Identities = 149/529 (28%), Positives = 256/529 (48%), Gaps = 66/529 (12%)

Query: 325 NRGAYGCIMADEMGLGKTLQCIALMWTLLRQGPQGKRLIDK----CIIVCPSSLVNNWAN 380
           +R     I+ADEMGLGKTLQ I+ +  L        R ++K     +++ P S +NNW  
Sbjct: 151 HRNNLAGILADEMGLGKTLQTISFLGYL--------RYVEKKPGPFVVIAPKSTLNNWLR 202

Query: 381 ELIKWLGPNTLTPLAVDGKKSSMGGGNTTVSQAIHAWAQAQGRNIVKPVLIISYETLRRN 440
           E+ +W      TP   D +   + G     ++ +     A   +IV    + SYE + + 
Sbjct: 203 EINRW------TP---DVRAFILQGDKEERAKLVANKLMACDFDIV----VASYEIIIKE 249

Query: 441 VDQLKNCNVGLMLADEGHRLKNGDSLTFTALDSISCPRRVILSGTPIQNDLSEYFALLSF 500
               K      ++ DE HR+KN +S+    L   +   R++++GTP+QN+L E +ALL+F
Sbjct: 250 KASFKKIAWEYIVIDEAHRIKNEESMLSQVLREFTSRNRLLITGTPLQNNLHELWALLNF 309

Query: 501 SNPGLLGSRAEFRKNFENPILRGRDADATDKEITKGEAQLQKLSTIVSKFIIRR-TNDIL 559
             P +      F   F           +   E  KG+  +++L T++  F++RR  N++ 
Sbjct: 310 LLPDVFSDSQAFDDWF----------SSESSEDDKGKI-VKQLHTVLQPFLLRRLKNEVE 358

Query: 560 AKYLPCKYEHVIFVNLKPLQNELYNKLIKSREXXXXXXXXXXSQPLRAIGI---LKKLCN 616
              LP K E  +++ +  +Q   Y ++++                 R + +   L+K CN
Sbjct: 359 TSLLPKK-ELNLYIGMSSMQKRWYKQILEKDIDAVNGANGNKESKTRLLNVMMQLRKCCN 417

Query: 617 HPXXXXXXXXXXXXXXXXXXXXYNMPGSK-ARDVQTKY-SAKFSILERFLHKIKTESDDK 674
           HP                       PG     D    Y SAK  +L++ L K K E   +
Sbjct: 418 HPYLFDGAE----------------PGPPYTTDEHLVYNSAKLKVLDKLLRKFKEEG-SR 460

Query: 675 IVLISNYTQTLDLIEKMCRYKHYSAVRLDGTMSINKRQKLVDRFNDPEGQEFIFLLSSKA 734
           +++ S  ++ LD++E  C ++ Y   R+DG+ +   R + +D +N P+ ++F+FLL+++A
Sbjct: 461 VLIFSQMSRVLDILEDYCFFRQYEYCRIDGSTAHEDRIEAIDEYNAPDSKKFVFLLTTRA 520

Query: 735 GGCGINLIGANRLILMDPDWNPAADQQALARVWRDGQKKDCFIYRFISTGTIEEKIFQRQ 794
           GG GINL  A+ ++L D DWNP AD QA+ R  R GQKK   ++R ++  ++EEKI +R 
Sbjct: 521 GGLGINLTTADIVVLYDSDWNPQADLQAMDRAHRIGQKKQVRVFRLVTDNSVEEKILERA 580

Query: 795 SMKMSLSSCVVDA------KEDVERLFSSDNLRQLFQKNENTICETHET 837
           + K+ L   V+        +++V++  S D L  + Q     +  T+ T
Sbjct: 581 TQKLRLDQLVIQQSRNGVNQKEVKKGDSKDALLSMIQHGAADVFSTNST 629

>KLLA0F06710g 645650..648940 similar to sp|P38144 Saccharomyces
           cerevisiae YBR245c ISW1, start by similarity
          Length = 1096

 Score =  217 bits (553), Expect = 2e-58,   Method: Compositional matrix adjust.
 Identities = 145/487 (29%), Positives = 238/487 (48%), Gaps = 66/487 (13%)

Query: 332 IMADEMGLGKTLQCIALMWTLLRQGPQGKRLIDK----CIIVCPSSLVNNWANELIKWLG 387
           I+ADEMGLGKTLQ IA +  L        R I+K     +++ P S +NNW  E+ +W  
Sbjct: 163 ILADEMGLGKTLQTIAFLGYL--------RYIEKKNGPFLVIAPKSTLNNWLREINRW-- 212

Query: 388 PNTLTPLAVDGKKSSMGGGNTTVSQAIHAWAQAQGRNIVKPVLIISYETLRRNVDQLKNC 447
               TP   +     + G     S+  H    A   +I     + SYE + R     K  
Sbjct: 213 ----TP---EVSAFILQGDKEERSKLCHDKLLACDFDIC----VASYEIIIREKASFKKI 261

Query: 448 NVGLMLADEGHRLKNGDSLTFTALDSISCPRRVILSGTPIQNDLSEYFALLSFSNPGLLG 507
           +   ++ DE HR+KN +S+    L   S   R++++GTP+QN+L E +ALL+F  P +  
Sbjct: 262 DWEYVVIDEAHRIKNEESMLSQVLREFSSRNRLLITGTPLQNNLHELWALLNFLLPDIFA 321

Query: 508 SRAEFRKNFENPILRGRDADATDKEITKGEAQLQKLSTIVSKFIIRRT-NDILAKYLPCK 566
             A F + F           +++      E  +++L T++S F++RR  ND+    LP K
Sbjct: 322 DSATFDEWF-----------SSESSEEDKEKVVKQLHTVLSPFLLRRIKNDVEGSLLPKK 370

Query: 567 YEHVIFVNLKPLQNELYNKLIKSREXXXXXXXXXXSQPLRAIGI---LKKLCNHPXXXXX 623
            E  ++V +  +Q + Y ++++                 R + I   L+K CNHP     
Sbjct: 371 -ELNVYVGMSSMQKKWYKQILEKDIDAVNGSNGQKESKTRLLNIVMQLRKCCNHP----- 424

Query: 624 XXXXXXXXXXXXXXXYNMPGSK-----ARDVQTKYSAKFSILERFLHKIKTESDDKIVLI 678
                          Y   G++       D    Y++    +   L K   E   ++++ 
Sbjct: 425 ---------------YLFDGAEPGPPYTTDEHLVYNSAKLKVLDKLLKKFKEQGSRVLIF 469

Query: 679 SNYTQTLDLIEKMCRYKHYSAVRLDGTMSINKRQKLVDRFNDPEGQEFIFLLSSKAGGCG 738
           S  ++ LD++E  C ++ Y   R+DG+ +   R   +D +N P+ ++FIFLL+++AGG G
Sbjct: 470 SQMSRVLDILEDYCYFREYEYCRIDGSTAHEDRINAIDDYNAPDSKKFIFLLTTRAGGLG 529

Query: 739 INLIGANRLILMDPDWNPAADQQALARVWRDGQKKDCFIYRFISTGTIEEKIFQRQSMKM 798
           INL  A+ ++L D DWNP AD QA+ R  R GQKK   ++RF++  ++EEKI +R + K+
Sbjct: 530 INLTTADIVVLYDSDWNPQADLQAMDRAHRIGQKKQVRVFRFVTDNSVEEKILERATQKL 589

Query: 799 SLSSCVV 805
            L   V+
Sbjct: 590 KLDQLVI 596

>YER164W (CHD1) [1592] chr5 (505387..509793) Protein involved in
           ATP-dependent nucleosome remodeling activity, member of
           the Chromodomain-Helicase-DNA-binding (CHD) family [4407
           bp, 1468 aa]
          Length = 1468

 Score =  218 bits (554), Expect = 3e-58,   Method: Compositional matrix adjust.
 Identities = 149/481 (30%), Positives = 236/481 (49%), Gaps = 41/481 (8%)

Query: 332 IMADEMGLGKTLQCIALM-WTLLRQGPQGKRLIDKCIIVCPSSLVNNWANELIKWLGPNT 390
           I+ADEMGLGKT+Q +A + W +  +   G       IIV P S +  W +   KW  P+ 
Sbjct: 398 ILADEMGLGKTVQTVAFISWLIFARRQNGPH-----IIVVPLSTMPAWLDTFEKW-APD- 450

Query: 391 LTPLAVDGKKSSMGGGNTTVSQAIHAWAQAQGRNIVK-PVLIISYETLRRNVDQLKNCNV 449
           L  +   G + S    +T      +   +A+G+  +K  VL+ +YE + ++  +L +   
Sbjct: 451 LNCICYMGNQKSR---DTIREYEFYTNPRAKGKKTMKFNVLLTTYEYILKDRAELGSIKW 507

Query: 450 GLMLADEGHRLKNGDSLTFTALDSISCPRRVILSGTPIQNDLSEYFALLSFSNPGLLGSR 509
             M  DE HRLKN +S  + +L+S     R++++GTP+QN++ E  AL++F  PG     
Sbjct: 508 QFMAVDEAHRLKNAESSLYESLNSFKVANRMLITGTPLQNNIKELAALVNFLMPGRFTID 567

Query: 510 AEFRKNFENPILRGRDADATDKEITKGEAQLQKLSTIVSKFIIRRTNDILAKYLPCKYEH 569
            E   +FEN           D+E    E  +  L   +  FI+RR    + K LP K E 
Sbjct: 568 QEI--DFEN----------QDEE---QEEYIHDLHRRIQPFILRRLKKDVEKSLPSKTER 612

Query: 570 VIFVNLKPLQNELY-NKLIKSREXXXXXXXXXXSQPLRAIGILKKLCNHPXXXXXXXXXX 628
           ++ V L  +Q E Y N L K+               L  +  LKK  NHP          
Sbjct: 613 ILRVELSDVQTEYYKNILTKNYSALTAGAKGGHFSLLNIMNELKKASNHPYLFDNAEERV 672

Query: 629 XXXXXXXXXXYNMPGSKARDVQTK----YSAKFSILERFLHKIKTESDDKIVLISNYTQT 684
                         G   R+   +     S K  +L++ L ++K +   ++++ S   + 
Sbjct: 673 LQKFGD--------GKMTRENVLRGLIMSSGKMVLLDQLLTRLKKDGH-RVLIFSQMVRM 723

Query: 685 LDLIEKMCRYKHYSAVRLDGTMSINKRQKLVDRFNDPEGQEFIFLLSSKAGGCGINLIGA 744
           LD++      K  +  RLDGT+   +R+  +D FN P+  +F+FLLS++AGG GINL+ A
Sbjct: 724 LDILGDYLSIKGINFQRLDGTVPSAQRRISIDHFNSPDSNDFVFLLSTRAGGLGINLMTA 783

Query: 745 NRLILMDPDWNPAADQQALARVWRDGQKKDCFIYRFISTGTIEEKIFQRQSMKMSLSSCV 804
           + +++ D DWNP AD QA+AR  R GQK    +YR +S  T+EE++ +R   KM L   +
Sbjct: 784 DTVVIFDSDWNPQADLQAMARAHRIGQKNHVMVYRLVSKDTVEEEVLERARKKMILEYAI 843

Query: 805 V 805
           +
Sbjct: 844 I 844

>Scas_662.7
          Length = 1342

 Score =  218 bits (554), Expect = 3e-58,   Method: Compositional matrix adjust.
 Identities = 149/486 (30%), Positives = 230/486 (47%), Gaps = 45/486 (9%)

Query: 332 IMADEMGLGKTLQCIALMWTLLRQ----GPQGKRLIDKCIIVCPSSLVNNWANELIKWLG 387
           I+ADEMGLGKT+Q I+L+  L  +    GP         +++ P S + NW  E  KW  
Sbjct: 483 ILADEMGLGKTIQSISLITYLFEEKKDPGP--------YLVIVPLSTITNWTLEFEKW-A 533

Query: 388 PNTLTPLAVDGKKSSMGGGNTTVSQAIHAWAQAQGRNIVKPVLIISYETLRRNVDQLKNC 447
           P +L  +   G          T +Q  +   Q +  N    VL+ +YE + ++   L   
Sbjct: 534 P-SLNTVIYKG----------TPNQRRNLQHQVRIGNF--DVLLTTYEYIIKDRALLAKH 580

Query: 448 NVGLMLADEGHRLKNGDS-LTFTALDSISCPRRVILSGTPIQNDLSEYFALLSFSNPGLL 506
               M+ DEGHR+KN  S L++T         R+IL+GTP+QN+L E +ALL+F  P + 
Sbjct: 581 EWTHMIIDEGHRMKNAQSKLSYTITHYYKTRHRLILTGTPLQNNLPELWALLNFVLPKIF 640

Query: 507 GSRAEFRKNFENPILRGRDADATDKEITKGEAQLQKLSTIVSKFIIRRTNDILAKYLPCK 566
            S   F   F  P       +  +    +    +++L  ++  F++RR    + K LP K
Sbjct: 641 NSAKTFEDWFNTPFANTGTGEKLELTEEETLLVIRRLHKVLRPFLLRRLKKEVEKDLPDK 700

Query: 567 YEHVIFVNLKPLQNELYNKLIKSR-----EXXXXXXXXXXSQPLRAIGILKKLCNHPXXX 621
            E V+   L  LQ +LY +++K       E                I  L+K+CNHP   
Sbjct: 701 VEKVVKCKLSGLQQQLYEQMLKHNALFLGEGTEGATKSGIKGLNNKIMQLRKICNHPFVF 760

Query: 622 XXXXXXXXXXXXXXXXXYNMPGSKARDVQTKYSAKFSILERFLHKIKTESDDKIVLISNY 681
                               P     ++  + S KF +L R L K K  +  ++++    
Sbjct: 761 DEVEGVIN------------PTRANSNLLYRVSGKFELLNRVLPKFKA-AGHRVLMFFQM 807

Query: 682 TQTLDLIEKMCRYKHYSAVRLDGTMSINKRQKLVDRFNDPEGQEFIFLLSSKAGGCGINL 741
           TQ +D++E   R K    +RLDG+   + R  +++ FN P+   F FLLS++AGG G+NL
Sbjct: 808 TQVMDIMEDFLRMKDLKYMRLDGSTKADDRTGMLNDFNAPDSDYFCFLLSTRAGGLGLNL 867

Query: 742 IGANRLILMDPDWNPAADQQALARVWRDGQKKDCFIYRFISTGTIEEKIFQRQSMKMSLS 801
             A+ +I+ D DWNP  D QA  R  R GQK +  I R I+T ++EE I +R   K+ + 
Sbjct: 868 QTADTVIIFDTDWNPHQDLQAQDRAHRIGQKNEVRILRLITTDSVEEVILERAMQKLDID 927

Query: 802 SCVVDA 807
             V+ A
Sbjct: 928 GKVIQA 933

>YBR245C (ISW1) [424] chr2 complement(708107..711496) Putative
           ATP-dependent chromatin remodeling factor, has strong
           similarity to Drosophila nucleosome remodeling factor
           ISWI [3390 bp, 1129 aa]
          Length = 1129

 Score =  217 bits (552), Expect = 3e-58,   Method: Compositional matrix adjust.
 Identities = 144/487 (29%), Positives = 243/487 (49%), Gaps = 66/487 (13%)

Query: 332 IMADEMGLGKTLQCIALMWTLLRQGPQGKRLIDKC----IIVCPSSLVNNWANELIKWLG 387
           I+ADEMGLGKTLQ I+ +  L        R I+K     +++ P S +NNW  E+ +W  
Sbjct: 218 ILADEMGLGKTLQTISFLGYL--------RYIEKIPGPFLVIAPKSTLNNWLREINRW-- 267

Query: 388 PNTLTPLAVDGKKSSMGGGNTTVSQAIHAWAQAQGRNIVKPVLIISYETLRRNVDQLKNC 447
               TP   D     + G     ++ I    Q +       V+I SYE + R    LK  
Sbjct: 268 ----TP---DVNAFILQGDKEERAELI----QKKLLGCDFDVVIASYEIIIREKSPLKKI 316

Query: 448 NVGLMLADEGHRLKNGDSLTFTALDSISCPRRVILSGTPIQNDLSEYFALLSFSNPGLLG 507
           N   ++ DE HR+KN +S+    L   +   R++++GTP+QN+L E +ALL+F  P +  
Sbjct: 317 NWEYIIIDEAHRIKNEESMLSQVLREFTSRNRLLITGTPLQNNLHELWALLNFLLPDIFS 376

Query: 508 SRAEFRKNFENPILRGRDADATDKEITKGEAQLQKLSTIVSKFIIRRT-NDILAKYLPCK 566
              +F   F         +++T+++  K    +++L T++  F++RR  +D+    LP K
Sbjct: 377 DAQDFDDWF--------SSESTEEDQDK---IVKQLHTVLQPFLLRRIKSDVETSLLPKK 425

Query: 567 YEHVIFVNLKPLQNELYNKLIKSREXXXXXXXXXXSQPLRAIGI---LKKLCNHPXXXXX 623
            E  ++V +  +Q + Y K+++                 R + I   L+K CNHP     
Sbjct: 426 -ELNLYVGMSSMQKKWYKKILEKDLDAVNGSNGSKESKTRLLNIMMQLRKCCNHP----- 479

Query: 624 XXXXXXXXXXXXXXXYNMPGSK-----ARDVQTKYSAKFSILERFLHKIKTESDDKIVLI 678
                          Y   G++       D    Y+A    +   L K   E   ++++ 
Sbjct: 480 ---------------YLFDGAEPGPPYTTDEHLVYNAAKLQVLDKLLKKLKEEGSRVLIF 524

Query: 679 SNYTQTLDLIEKMCRYKHYSAVRLDGTMSINKRQKLVDRFNDPEGQEFIFLLSSKAGGCG 738
           S  ++ LD++E  C +++Y   R+DG+ +   R + +D +N P+ ++F+FLL+++AGG G
Sbjct: 525 SQMSRLLDILEDYCYFRNYEYCRIDGSTAHEDRIQAIDDYNAPDSKKFVFLLTTRAGGLG 584

Query: 739 INLIGANRLILMDPDWNPAADQQALARVWRDGQKKDCFIYRFISTGTIEEKIFQRQSMKM 798
           INL  A+ ++L D DWNP AD QA+ R  R GQKK   ++R ++  ++EEKI +R + K+
Sbjct: 585 INLTSADVVVLYDSDWNPQADLQAMDRAHRIGQKKQVKVFRLVTDNSVEEKILERATQKL 644

Query: 799 SLSSCVV 805
            L   V+
Sbjct: 645 RLDQLVI 651

>Kwal_26.9164
          Length = 1454

 Score =  218 bits (554), Expect = 3e-58,   Method: Compositional matrix adjust.
 Identities = 152/483 (31%), Positives = 232/483 (48%), Gaps = 40/483 (8%)

Query: 332  IMADEMGLGKTLQCIALMWTLLRQGPQGKRLIDKCIIVCPSSLVNNWANELIKWLGPNTL 391
            I+ADEMGLGKT+Q I+L+  L     + K +    +++ P S + NW +E  KW      
Sbjct: 624  ILADEMGLGKTIQTISLLTYLY----EVKNVRGPSLVIVPLSTLTNWDSEFDKWA----- 674

Query: 392  TPLAVDGKKSSMGGGNTTVSQAIHAWAQAQGRNIVKPVLIISYETLRRNVDQLKNCNVGL 451
                V  K +  G  N   S+      Q   R+    V++ ++E + +    L       
Sbjct: 675  ---PVIRKVAYKGSPNERKSK------QGIIRSGQFDVVLTTFEYIIKERALLSKIKWVH 725

Query: 452  MLADEGHRLKNGDS-LTFTALDSISCPRRVILSGTPIQNDLSEYFALLSFSNPGLLGSRA 510
            M+ DEGHR+KN  S L+ T  +      R+IL+GTP+QN+L E +ALL+F  P +  S  
Sbjct: 726  MIIDEGHRMKNAQSKLSLTLNNYYHTDYRLILTGTPLQNNLPELWALLNFVLPKIFNSVK 785

Query: 511  EFRKNFENPILR--GRDADATDKEITKGEAQLQKLSTIVSKFIIRRTNDILAKYLPCKYE 568
             F + F  P     G+D  A  +E T     +++L  ++  F++RR    + K LP K E
Sbjct: 786  SFDEWFNTPFANTGGQDKIALSEEETL--LVIRRLHKVLRPFLLRRLKKDVEKELPDKVE 843

Query: 569  HVIFVNLKPLQNELYNKLIKSREXXXXXXXXXXSQPLRA----IGILKKLCNHPXXXXXX 624
             V+   +  LQ +LY +++K R           +  +R     I  LKK+CNHP      
Sbjct: 844  KVLKCKMSALQQKLYEQMLKHRRLFIGDLNSNKNVGMRGFNNQIMQLKKICNHPFVFEEV 903

Query: 625  XXXXXXXXXXXXXXYNMPGSKARDVQTKYSAKFSILERFLHKIKTESDDKIVLISNYTQT 684
                          + + G            KF +LER L K K  +  +I++    TQ 
Sbjct: 904  EDQINPTRETNANIWRVAG------------KFELLERILPKFKA-TGHRILIFFQMTQI 950

Query: 685  LDLIEKMCRYKHYSAVRLDGTMSINKRQKLVDRFNDPEGQEFIFLLSSKAGGCGINLIGA 744
            +D++E   R  +   +RLDG    + R  L++ FN P  + F FLLS++AGG G+NL  A
Sbjct: 951  MDIMEDFLRLSNMKYLRLDGHTKSDDRTLLLNLFNAPNSEYFCFLLSTRAGGLGLNLQSA 1010

Query: 745  NRLILMDPDWNPAADQQALARVWRDGQKKDCFIYRFISTGTIEEKIFQRQSMKMSLSSCV 804
            + +I+ D DWNP  D QA  R  R GQK +  I R I+  ++EE I  R   K+ +   V
Sbjct: 1011 DTVIIFDTDWNPHQDLQAQDRAHRIGQKNEVRILRLITENSVEEVILDRAHKKLDIDGKV 1070

Query: 805  VDA 807
            + A
Sbjct: 1071 IQA 1073

>Kwal_23.4777
          Length = 1301

 Score =  217 bits (552), Expect = 4e-58,   Method: Compositional matrix adjust.
 Identities = 150/489 (30%), Positives = 231/489 (47%), Gaps = 51/489 (10%)

Query: 332 IMADEMGLGKTLQCIALMWTLLRQ-----GPQGKRLIDKCIIVCPSSLVNNWANELIKWL 386
           I+ADEMGLGKT+Q I+L+ T LR+     GP         +++ P S + NW  E  KW 
Sbjct: 478 ILADEMGLGKTIQSISLI-TYLRETKNEPGP--------FLVIVPLSTITNWTLEFEKW- 527

Query: 387 GPN--TLTPLAVDGKKSSMGGGNTTVSQAIHAWAQAQGRNIVKPVLIISYETLRRNVDQL 444
            P+  T+       ++ SM               Q Q R     VL+ +YE + ++   L
Sbjct: 528 APSLATIVYKGTPNQRKSM---------------QHQIRIGNFEVLLTTYEYIIKDRSLL 572

Query: 445 KNCNVGLMLADEGHRLKNGDS-LTFTALDSISCPRRVILSGTPIQNDLSEYFALLSFSNP 503
              +   M+ DEGHR+KN  S L+FT         R+IL+GTP+QN+L E +ALL+F  P
Sbjct: 573 AKHDWSHMIIDEGHRMKNAQSKLSFTLTRYYRTRNRLILTGTPLQNNLPELWALLNFVLP 632

Query: 504 GLLGSRAEFRKNFENPILRGRDADATDKEITKGEAQLQKLSTIVSKFIIRRTNDILAKYL 563
            +  S   F + F  P       +  +    +    +++L  ++  F++RR    + K L
Sbjct: 633 KIFNSAKTFDEWFNTPFANTGGQEKLELTEEETLLVIRRLHKVLRPFLLRRLKKEVEKDL 692

Query: 564 PCKYEHVIFVNLKPLQNELYNKLIKSREXXXXXXXXXXSQPL-----RAIGILKKLCNHP 618
           P K E V+   L  LQ++LY +++K             ++         I  L+K+CNHP
Sbjct: 693 PDKVEKVVKCKLSGLQHQLYQQMLKHNALFFGAGTEGATKGGIKGLNNKIMQLRKICNHP 752

Query: 619 XXXXXXXXXXXXXXXXXXXXYNMPGSKARDVQTKYSAKFSILERFLHKIKTESDDKIVLI 678
                               Y + G            KF +L+R L K K  +  ++++ 
Sbjct: 753 FVFDEVEGIINPSRANSPLLYRVAG------------KFELLDRILLKFKV-TGHRVLMF 799

Query: 679 SNYTQTLDLIEKMCRYKHYSAVRLDGTMSINKRQKLVDRFNDPEGQEFIFLLSSKAGGCG 738
              TQ +D++E   R +    +RLDG      R  ++  FN P  + F FLLS++AGG G
Sbjct: 800 FQMTQVMDIMEDFLRMRGLKYLRLDGATKTEDRTGMLKLFNAPNSEYFCFLLSTRAGGLG 859

Query: 739 INLIGANRLILMDPDWNPAADQQALARVWRDGQKKDCFIYRFISTGTIEEKIFQRQSMKM 798
           +NL  A+ +I+ D DWNP  D QA  R  R GQK +  I R I+T ++EE I +R   K+
Sbjct: 860 LNLQTADTVIIFDTDWNPHQDLQAQDRAHRIGQKNEVRILRLITTDSVEEVILERALQKL 919

Query: 799 SLSSCVVDA 807
            +   V+ A
Sbjct: 920 DIDGKVIQA 928

>Scas_594.7
          Length = 1703

 Score =  217 bits (553), Expect = 4e-58,   Method: Compositional matrix adjust.
 Identities = 146/483 (30%), Positives = 235/483 (48%), Gaps = 40/483 (8%)

Query: 332  IMADEMGLGKTLQCIALMWTLLRQGPQGKRLIDKCIIVCPSSLVNNWANELIKWLGPNTL 391
            I+ADEMGLGKT+Q I+L+  L     + K +    +++ P S ++NW+NE  KW  P T+
Sbjct: 835  ILADEMGLGKTIQTISLLTYLY----ETKHIHGPYLVIVPLSTLSNWSNEFAKW-AP-TM 888

Query: 392  TPLAVDGKKSSMGGGNTTVSQAIHAWAQAQGRNIVKPVLIISYETLRRNVDQLKNCNVGL 451
              ++  G  +          ++ HA  ++   ++V    + ++E + +    L       
Sbjct: 889  RCISYKGSPNE--------RKSKHAIIKSGEFDVV----LTTFEYIIKERALLSKVKWIH 936

Query: 452  MLADEGHRLKNGDS-LTFTALDSISCPRRVILSGTPIQNDLSEYFALLSFSNPGLLGSRA 510
            M+ DEGHR+KN  S L+ T         R+IL+GTP+QN+L E +ALL+F+ P +  S  
Sbjct: 937  MIIDEGHRMKNAQSKLSLTLNTYYHSDYRLILTGTPLQNNLPELWALLNFALPKIFNSVK 996

Query: 511  EFRKNFENPILRGRDADATDKEITKGEAQL--QKLSTIVSKFIIRRTNDILAKYLPCKYE 568
             F + F  P       D    E+++ E  L  ++L  ++  F++RR    + K LP K E
Sbjct: 997  SFDEWFNTPFANTGGQDKI--ELSEEETLLVIRRLHKVLRPFLLRRLKKDVEKELPDKVE 1054

Query: 569  HVIFVNLKPLQNELYNKLIKSREXXXXXXXXXXSQPLRAIG----ILKKLCNHPXXXXXX 624
             VI   +  LQ  +Y +++K R              LR        LKK+CNHP      
Sbjct: 1055 KVIKCKMSALQQIMYQQMLKYRRLFIGDHTNKKMVGLRGFNNQLMQLKKICNHPFVFEEV 1114

Query: 625  XXXXXXXXXXXXXXYNMPGSKARDVQTKYSAKFSILERFLHKIKTESDDKIVLISNYTQT 684
                          + + G            KF +LE+ L K+K  +  ++++    TQ 
Sbjct: 1115 EDQINPTRETNANIWRVAG------------KFELLEKVLPKLKA-TGHRVLIFFQMTQI 1161

Query: 685  LDLIEKMCRYKHYSAVRLDGTMSINKRQKLVDRFNDPEGQEFIFLLSSKAGGCGINLIGA 744
            +D++E   R+     +RLDG    + R  L+  FN P+ +   F+LS++AGG G+NL  A
Sbjct: 1162 MDIVEDFLRFIDIKYLRLDGHTKSDDRSNLLKLFNAPDSEYLCFILSTRAGGLGLNLQTA 1221

Query: 745  NRLILMDPDWNPAADQQALARVWRDGQKKDCFIYRFISTGTIEEKIFQRQSMKMSLSSCV 804
            + +I+ D DWNP  D QA  R  R GQK +  I R I+  ++EE I +R   K+ +   V
Sbjct: 1222 DTVIIFDTDWNPHQDLQAQDRAHRIGQKNEVRILRLITEHSVEEAILERAHKKLDIDGKV 1281

Query: 805  VDA 807
            + A
Sbjct: 1282 IQA 1284

>KLLA0F04521g complement(435649..439683) similar to sp|P32597
           Saccharomyces cerevisiae YIL126w STH1 subunit of the RSC
           complex, start by similarity
          Length = 1344

 Score =  217 bits (552), Expect = 4e-58,   Method: Compositional matrix adjust.
 Identities = 148/488 (30%), Positives = 234/488 (47%), Gaps = 49/488 (10%)

Query: 332 IMADEMGLGKTLQCIALMWTLLRQGPQGKRLIDKCIIVCPSSLVNNWANELIKWLGPNTL 391
           I+ADEMGLGKT+Q I+L+  L     + K      +++ P S + NW  E  KW  P+  
Sbjct: 535 ILADEMGLGKTIQSISLISYLY----EIKNERQPFLVIVPLSTITNWTIEFEKW-APSL- 588

Query: 392 TPLAVDGKKSSMGGGNTTVSQAIHAWAQAQGRNIVKPVLIISYETLRRNVDQLKNCNVGL 451
                   ++ +  GN    +A+    +    ++V    + +YE + ++   L   +   
Sbjct: 589 --------RTIVYKGNPNQRKALQHTIKMGNFDVV----LTTYEYIIKDRPLLAKHDWAH 636

Query: 452 MLADEGHRLKNGDS-LTFTALDSISCPRRVILSGTPIQNDLSEYFALLSFSNPGLLGSRA 510
           M+ DEGHR+KN  S L++T         R+IL+GTP+QN+L E +ALL+F  P +  S  
Sbjct: 637 MIIDEGHRMKNAQSKLSYTLTHYYKTKNRLILTGTPLQNNLPELWALLNFVLPKIFNSSK 696

Query: 511 EFRKNFENPILRGRDADATDKEITKGEAQL--QKLSTIVSKFIIRRTNDILAKYLPCKYE 568
            F + F  P            E+T+ E  L  ++L  ++  F++RR    + K LP K E
Sbjct: 697 TFDEWFNTPF--ANTGTQEKLEMTEEETLLVIRRLHKVLRPFLLRRLKKEVEKDLPDKVE 754

Query: 569 HVIFVNLKPLQNELYNKLIKSREXXXXXXXXXXSQPLRAIGI---------LKKLCNHPX 619
            V+   L  LQ +LY +++K             ++     GI         L+K+CNHP 
Sbjct: 755 KVVKCKLSSLQQQLYEQMLKHNAFFIGAGTEGATKA----GIKGLNNKVMQLRKICNHPF 810

Query: 620 XXXXXXXXXXXXXXXXXXXYNMPGSKARDVQTKYSAKFSILERFLHKIKTESDDKIVLIS 679
                                 P  +   +  + S KF +L+R L K K  S  ++++  
Sbjct: 811 VFDEVENVIN------------PTRENSSILYRVSGKFELLDRVLPKFKA-SGHRVLMFF 857

Query: 680 NYTQTLDLIEKMCRYKHYSAVRLDGTMSINKRQKLVDRFNDPEGQEFIFLLSSKAGGCGI 739
             TQ +D++E   R +    +RLDG      R  ++  FN P+ + F FLLS++AGG G+
Sbjct: 858 QMTQVMDIMEDFLRMRDLKYMRLDGGTKAEDRTGMLKLFNAPDSEYFCFLLSTRAGGLGL 917

Query: 740 NLIGANRLILMDPDWNPAADQQALARVWRDGQKKDCFIYRFISTGTIEEKIFQRQSMKMS 799
           NL  A+ +I+ D DWNP  D QA  R  R GQK +  I R I+T ++EE I +R   K+ 
Sbjct: 918 NLQTADTVIIFDTDWNPHQDLQAQDRAHRIGQKNEVRILRLITTDSVEEVILERAMQKLD 977

Query: 800 LSSCVVDA 807
           +   V+ A
Sbjct: 978 IDGKVIQA 985

>CAGL0L11770g 1254125..1258555 highly similar to sp|P32657
           Saccharomyces cerevisiae YER164w CHD1 transcriptional
           regulator, start by similarity
          Length = 1476

 Score =  216 bits (550), Expect = 9e-58,   Method: Compositional matrix adjust.
 Identities = 145/477 (30%), Positives = 231/477 (48%), Gaps = 33/477 (6%)

Query: 332 IMADEMGLGKTLQCIALM-WTLLRQGPQGKRLIDKCIIVCPSSLVNNWANELIKWLGPNT 390
           I+ADEMGLGKT+Q +A + W +  +   G  L+     V P S +  W     KW  P+ 
Sbjct: 413 ILADEMGLGKTVQTVAFISWLIFARRQNGPHLV-----VVPLSTMPAWIETFEKW-APDI 466

Query: 391 LTPLAVDGKKSSMGGGNTTVSQAIHAWAQAQGRNIVK-PVLIISYETLRRNVDQLKNCNV 449
                +  +KS     +       ++  + +G+  +K  VL+ +YE + ++  +L +   
Sbjct: 467 DVICYMGNQKSR----DIEREYEFYSNPKGKGKKQIKFNVLMTTYEYILKDRAELGSIKW 522

Query: 450 GLMLADEGHRLKNGDSLTFTALDSISCPRRVILSGTPIQNDLSEYFALLSFSNPGLLGSR 509
             +  DE HRLKN +S  + +L+S     R++++GTP+QN++ E  AL++F  PG     
Sbjct: 523 QFLAVDEAHRLKNAESSLYESLNSFKVANRLLITGTPLQNNIKELAALVNFLMPGRFTID 582

Query: 510 AEFRKNFENPILRGRDADATDKEITKGEAQLQKLSTIVSKFIIRRTNDILAKYLPCKYEH 569
            E   +FEN           D+E    E  ++ L   +  FI+RR    + K LP K E 
Sbjct: 583 QEI--DFEN----------QDEE---QEQYIRDLHKRLQPFILRRLKKDVEKSLPSKTER 627

Query: 570 VIFVNLKPLQNELY-NKLIKSREXXXXXXXXXXSQPLRAIGILKKLCNHPXXXXXXXXXX 628
           ++ V L  +Q E Y N L K+               L  +  L K  NHP          
Sbjct: 628 ILRVELSDVQTEYYKNILTKNYSALTAGAKGGRFSMLNIMNTLMKASNHPYLFDSAEEKV 687

Query: 629 XXXXXXXXXXYNMPGSKARDVQTKYSAKFSILERFLHKIKTESDDKIVLISNYTQTLDLI 688
                      NM            S K  +L++ L ++K +   ++++ S   + LD++
Sbjct: 688 LEKFGAG----NMSRENILRGLIMSSGKMVLLDKLLTRLKKDGH-RVLIFSQMVRILDIL 742

Query: 689 EKMCRYKHYSAVRLDGTMSINKRQKLVDRFNDPEGQEFIFLLSSKAGGCGINLIGANRLI 748
                 K  +  RLDGT+  N+R+  +D FN P   +F+FLLS++AGG GINL+ A+ +I
Sbjct: 743 GDYLSIKGINFQRLDGTVPSNQRRIAIDHFNAPGSDDFVFLLSTRAGGLGINLMTADTVI 802

Query: 749 LMDPDWNPAADQQALARVWRDGQKKDCFIYRFISTGTIEEKIFQRQSMKMSLSSCVV 805
           + D DWNP AD QA+AR  R GQK    +YR +S  T+EE++ +R   KM L   ++
Sbjct: 803 IFDSDWNPQADLQAMARAHRIGQKNHVMVYRLVSKDTVEEEVLERARKKMILEYAII 859

>AER375C [2876] [Homologous to ScYIL126W (STH1) - SH]
           (1332505..1336371) [3867 bp, 1288 aa]
          Length = 1288

 Score =  216 bits (549), Expect = 9e-58,   Method: Compositional matrix adjust.
 Identities = 147/482 (30%), Positives = 230/482 (47%), Gaps = 37/482 (7%)

Query: 332 IMADEMGLGKTLQCIALMWTLLRQGPQGKRLIDKCIIVCPSSLVNNWANELIKWLGPNTL 391
           I+ADEMGLGKT+Q I+L+  L     + K+     +++ P S + NW  E  KW  P+  
Sbjct: 479 ILADEMGLGKTIQSISLITYLY----EVKKDSGPFLVIVPLSTITNWTLEFEKW-APSLT 533

Query: 392 TPLAVDGKKSSMGGGNTTVSQAIHAWAQAQGRNIVKPVLIISYETLRRNVDQLKNCNVGL 451
           T +         G  N   S       Q Q R     VL+ +YE + ++   L       
Sbjct: 534 TVIY-------KGTPNQRRS------LQHQVRIGDFDVLLTTYEYIIKDRSLLAKHEWSH 580

Query: 452 MLADEGHRLKNGDS-LTFTALDSISCPRRVILSGTPIQNDLSEYFALLSFSNPGLLGSRA 510
           M+ DEGHR+KN  S L++T         R+IL+GTP+QN+L E +ALL+F  P +  S  
Sbjct: 581 MIIDEGHRMKNAQSKLSYTLTHYYKTRHRLILTGTPLQNNLPELWALLNFVLPKIFNSSK 640

Query: 511 EFRKNFENPILRGRDADATDKEITKGEAQLQKLSTIVSKFIIRRTNDILAKYLPCKYEHV 570
            F + F  P       +  +    +    +++L  ++  F++RR    + K LP K E V
Sbjct: 641 TFDEWFNTPFSNTGGQEKLELTEEEALLVIRRLHKVLRPFLLRRLKKEVEKDLPDKVEKV 700

Query: 571 IFVNLKPLQNELYNKLIKSREXXXXXXXXXXSQPL-----RAIGILKKLCNHPXXXXXXX 625
           +   L  LQ++LY +++K             ++         I  L+K+CNHP       
Sbjct: 701 VKCKLSGLQHQLYQQMLKHNALFVGAGTEGATKGGIKGLNNKIMQLRKICNHPFVFDEVE 760

Query: 626 XXXXXXXXXXXXXYNMPGSKARDVQTKYSAKFSILERFLHKIKTESDDKIVLISNYTQTL 685
                        Y + G            KF +L+R L K K  +  ++++    TQ +
Sbjct: 761 GVVNPTRTNSSLLYRVSG------------KFELLDRVLPKFKA-TGHRVLMFFQMTQVM 807

Query: 686 DLIEKMCRYKHYSAVRLDGTMSINKRQKLVDRFNDPEGQEFIFLLSSKAGGCGINLIGAN 745
           D++E   + K+   +RLDG     +R  +++ FN P+   F FLLS++AGG G+NL  A+
Sbjct: 808 DIMEDFLQMKNLKYMRLDGATKAEERTGMLNAFNAPDSDYFCFLLSTRAGGLGLNLQTAD 867

Query: 746 RLILMDPDWNPAADQQALARVWRDGQKKDCFIYRFISTGTIEEKIFQRQSMKMSLSSCVV 805
            +I+ D DWNP  D QA  R  R GQK +  I R I+T ++EE I +R   K+ +   V+
Sbjct: 868 TVIIFDTDWNPHQDLQAQDRAHRIGQKNEVRILRLITTDSVEEVILERAMQKLDIDGKVI 927

Query: 806 DA 807
            A
Sbjct: 928 QA 929

>Scas_597.8
          Length = 1065

 Score =  215 bits (547), Expect = 1e-57,   Method: Compositional matrix adjust.
 Identities = 141/494 (28%), Positives = 241/494 (48%), Gaps = 66/494 (13%)

Query: 325 NRGAYGCIMADEMGLGKTLQCIALMWTLLRQGPQGKRLIDKC----IIVCPSSLVNNWAN 380
           ++     I+ADEMGLGKTLQ I+ +  L        R ++K     +++ P S +NNW  
Sbjct: 147 HKSKLAGILADEMGLGKTLQTISFLGYL--------RYVEKIPGPFLVIAPKSTLNNWLR 198

Query: 381 ELIKWLGPNTLTPLAVDGKKSSMGGGNTTVSQAIHAWAQAQGRNIVKPVLIISYETLRRN 440
           E+ KW      TP   +     + G     +Q +     A   +IV    + SYE + R 
Sbjct: 199 EINKW------TP---EVNAFILQGDKEERAQLVKDKLLACDFDIV----VASYEIIIRE 245

Query: 441 VDQLKNCNVGLMLADEGHRLKNGDSLTFTALDSISCPRRVILSGTPIQNDLSEYFALLSF 500
               +  +   ++ DE HR+KN +SL    L   +   R++++GTP+QN+L E +ALL+F
Sbjct: 246 KSAFRKIDWQYIIIDEAHRIKNEESLLSQVLREFTSSNRLLITGTPLQNNLHELWALLNF 305

Query: 501 SNPGLLGSRAEFRKNFENPILRGRDADATDKEITKGEAQLQKLSTIVSKFIIRR-TNDIL 559
             P +     +F   F         ++ T+++    E  +++L T++  F++RR  ND+ 
Sbjct: 306 LLPDIFSDSQDFDDWF--------SSETTEED---QEKVVKQLHTVLQPFLLRRLKNDVE 354

Query: 560 AKYLPCKYEHVIFVNLKPLQNELYNKLIKSREXXXXXXXXXXSQPLRAIGI---LKKLCN 616
              LP K E  ++V +  +Q + Y ++++                 R + I   L+K CN
Sbjct: 355 TSLLP-KQELNLYVGMSNMQKKWYKQILEKDIDAVNGSNVNKESKTRLLNIVMQLRKCCN 413

Query: 617 HPXXXXXXXXXXXXXXXXXXXXYNMPGSK-----ARDVQTKYSAKFSILERFLHKIKTES 671
           HP                    Y   G++       D    Y++    +   L K   E 
Sbjct: 414 HP--------------------YLFDGAEPGPPYTTDEHLVYNSAKLKVLDKLLKKMKEE 453

Query: 672 DDKIVLISNYTQTLDLIEKMCRYKHYSAVRLDGTMSINKRQKLVDRFNDPEGQEFIFLLS 731
             ++++ S  ++ LD++E  C ++ Y   R+DG+     R + +D +N+P  ++FIFLL+
Sbjct: 454 GSRVLIFSQMSRVLDILEDYCFFRGYEYCRIDGSTDHEDRIRAIDEYNEPGSKKFIFLLT 513

Query: 732 SKAGGCGINLIGANRLILMDPDWNPAADQQALARVWRDGQKKDCFIYRFISTGTIEEKIF 791
           ++AGG GINL  AN ++L D DWNP AD QA+ R  R GQK+   ++R ++  ++EEKI 
Sbjct: 514 TRAGGLGINLTSANIVVLFDSDWNPQADLQAMDRAHRIGQKRQVKVFRLVTDNSVEEKIL 573

Query: 792 QRQSMKMSLSSCVV 805
           +R + K+ L   V+
Sbjct: 574 ERATQKLRLDQLVI 587

>AFR562C [3754] [Homologous to ScYOR290C (SNF2) - SH]
            (1439983..1444257,1444339..1444398) [4335 bp, 1444 aa]
          Length = 1444

 Score =  214 bits (546), Expect = 3e-57,   Method: Compositional matrix adjust.
 Identities = 152/484 (31%), Positives = 232/484 (47%), Gaps = 41/484 (8%)

Query: 332  IMADEMGLGKTLQCIALMWTLLRQGPQGKRLIDKCIIVCPSSLVNNWANELIKWLGPNTL 391
            I+ADEMGLGKT+Q I+L+  L     + K +    +++ P S + NW  E  KW  P TL
Sbjct: 583  ILADEMGLGKTIQTISLLTYLY----EFKGIHGPFLVIVPLSTLTNWNAEFDKW-AP-TL 636

Query: 392  TPLAVDGKKSSMGGGNTTVSQAIHAWAQAQGRNIVKPVLIISYETLRRNVDQLKNCNVGL 451
              LA  G  S          +A+    ++   ++V    + ++E + +    L       
Sbjct: 637  RKLAFKGPPSE--------RKALSGIIKSGNFDVV----LTTFEYIIKERPLLSKVKWVH 684

Query: 452  MLADEGHRLKNGDS-LTFTALDSISCPRRVILSGTPIQNDLSEYFALLSFSNPGLLGSRA 510
            M+ DEGHR+KN  S L+ T         R+IL+GTP+QN+L E +ALL+F  P +  S  
Sbjct: 685  MIIDEGHRMKNAQSKLSLTLNQYYHTDYRLILTGTPLQNNLPELWALLNFVLPKIFNSVK 744

Query: 511  EFRKNFENPILRGRDADATDKEITKGEAQL--QKLSTIVSKFIIRRTNDILAKYLPCKYE 568
             F + F  P       D    E+++ E  L  ++L  ++  F++RR    + K LP K E
Sbjct: 745  SFDEWFNTPFANTGGQDKI--ELSEEETLLVIRRLHKVLRPFLLRRLKKDVEKELPDKVE 802

Query: 569  HVIFVNLKPLQNELYNKLIKSREXXXXXXXXXXSQ-PLRA----IGILKKLCNHPXXXXX 623
             V+   +  LQ +LY +++K R               LR     I  LKK+CNHP     
Sbjct: 803  KVLKCRMSALQQKLYEQMLKHRRLFVVDDPSSKKMVGLRGFNNQIMQLKKICNHPFVFEE 862

Query: 624  XXXXXXXXXXXXXXXYNMPGSKARDVQTKYSAKFSILERFLHKIKTESDDKIVLISNYTQ 683
                           + + G            KF +LE+ L K K  S  ++++    TQ
Sbjct: 863  VEDQINPNRETNANIWRVAG------------KFELLEKILPKFKA-SGHRVLIFFQMTQ 909

Query: 684  TLDLIEKMCRYKHYSAVRLDGTMSINKRQKLVDRFNDPEGQEFIFLLSSKAGGCGINLIG 743
             +D++E   R+     +RLDG    + R  L+++FN P    F FLLS++AGG G+NL  
Sbjct: 910  IMDIMEDFLRFCDMKYLRLDGHTKSDDRTALLNKFNAPGSDYFCFLLSTRAGGLGLNLQT 969

Query: 744  ANRLILMDPDWNPAADQQALARVWRDGQKKDCFIYRFISTGTIEEKIFQRQSMKMSLSSC 803
            A+ +I+ D DWNP  D QA  R  R GQK +  I R I+  ++EE I +R   K+ +   
Sbjct: 970  ADTVIIFDTDWNPHQDLQAQDRAHRIGQKNEVRILRLITDNSVEEVILERAHRKLDIDGK 1029

Query: 804  VVDA 807
            V+ A
Sbjct: 1030 VIQA 1033

>KLLA0E23804g 2108059..2113680 similar to sp|P32333 Saccharomyces
            cerevisiae YPL082c MOT1 transcriptional accessory
            protein, start by similarity
          Length = 1873

 Score =  214 bits (545), Expect = 4e-57,   Method: Compositional matrix adjust.
 Identities = 161/542 (29%), Positives = 247/542 (45%), Gaps = 71/542 (13%)

Query: 325  NRGAYGCIMADEMGLGKTLQCIALMWT--LLRQGPQGKRLIDKC-----IIVCPSSLVNN 377
            N+     I+ D+MGLGKTLQ I ++ +   LR     K   +K      +I+CP SL  +
Sbjct: 1302 NKYHLHGILCDDMGLGKTLQTICIIASDQYLRSEDYKKTQSEKTRPLPSLIICPPSLTGH 1361

Query: 378  WANELIKWLGPNTLTPLAVDGKKSSMGGGNTTVSQAIHAWAQAQGRNIVKPVLIISYETL 437
            W  E  ++  P TL  L   G  S                   QG+     +++ SY+  
Sbjct: 1362 WEQEFQQY-SP-TLNVLVYAGGPS--------------VRYPLQGQVPTADIVVTSYDVA 1405

Query: 438  RRNVDQLKNCNVGLMLADEGHRLKNGDSLTFTALDSISCPRRVILSGTPIQNDLSEYFAL 497
            R +VD LK  +    + DEGH +KN  S    A+  I+   R++L+GTPIQN++ E ++L
Sbjct: 1406 RNDVDFLKKYDYNYCVLDEGHIIKNSQSKLAKAVKLINSNHRLVLTGTPIQNNVVELWSL 1465

Query: 498  LSFSNPGLLGSRAEFRKNFENPILRGRDADATDKEITKGEAQLQKLSTIVSKFIIRRTND 557
              F  PG LG+   F++ F  PI   R++  + KE   G   L+ L   V  F++RR  +
Sbjct: 1466 FDFLMPGFLGTEKMFQERFAKPIASSRNSKTSSKEQEAGALALEALHKQVLPFMLRRLKE 1525

Query: 558  ILAKYLPCKYEHVIFVNLKPLQNELYNKLIKSREXXXXXXXXXXSQP------LRAIGIL 611
             +   LP K     +  L  LQ +LYN  +K ++          ++        +A+  +
Sbjct: 1526 EVLSDLPPKIIQDYYCELSDLQKQLYNDFVKKQKNVVEKDIENTAEVENKQHIFQALQYM 1585

Query: 612  KKLCNHPXXXXXXXXXXXXXXXXXXXXYNMP--------------------GSKARDVQT 651
            +KLCNHP                      M                     G   +DV+ 
Sbjct: 1586 RKLCNHPSLVLNSSHPQFQQVQSYLSQTGMDLHDIGHAPKLEALKTLLLECGIGIQDVEK 1645

Query: 652  KYSAKFSILERFLHKIKTESDDKIVLISNYTQTLDLIEKMCRYKHYSAV---RLDGTMSI 708
            K +   SI           S  ++++       LD++E     KH  +V   RLDG++  
Sbjct: 1646 KSNKNPSIDNVI-------SQHRVLIFCQLKDMLDMVENDLLKKHLPSVTFMRLDGSVDS 1698

Query: 709  NKRQKLVDRFN-DPEGQEFIFLLSSKAGGCGINLIGANRLILMDPDWNPAADQQALARVW 767
              RQK+V +FN DP       LL++K GG G+NL GA+ +I ++ DWNP  D QA+ R  
Sbjct: 1699 RDRQKVVRKFNEDPSID--CLLLTTKVGGLGLNLTGADTVIFVEHDWNPMNDLQAMDRAH 1756

Query: 768  RDGQKKDCFIYRFISTGTIEEKIFQRQSMKMSLSSCVVDAK---------EDVERLFSSD 818
            R GQKK   +YR I+ GT+EEKI   Q  KM+++S +V+ +           +  LF +D
Sbjct: 1757 RLGQKKVVNVYRIITKGTLEEKIMGLQKFKMNIASTIVNQQNAGLGSMNTHQLLDLFDAD 1816

Query: 819  NL 820
            N+
Sbjct: 1817 NI 1818

>KLLA0C17578g 1547890..1552467 similar to sp|P32657 Saccharomyces
           cerevisiae YER164w CHD1 transcriptional regulator, start
           by similarity
          Length = 1525

 Score =  214 bits (544), Expect = 5e-57,   Method: Compositional matrix adjust.
 Identities = 147/487 (30%), Positives = 234/487 (48%), Gaps = 53/487 (10%)

Query: 332 IMADEMGLGKTLQCIALM-WTLLRQGPQGKRLIDKCIIVCPSSLVNNWANELIKWL-GPN 389
           I+ADEMGLGKT+Q ++ + W +  +   G  L+     V P S +  W     KW  G N
Sbjct: 410 ILADEMGLGKTVQTVSFISWLIYARRQNGPHLV-----VVPLSTMPAWQETFDKWAPGLN 464

Query: 390 TLTPLAVDGKKSSMGGGNTTVSQAIHAWA-----QAQGRNIVK-PVLIISYETLRRNVDQ 443
            +  +           GN      I  +      QA+G+  +K  VL+ +YE + ++   
Sbjct: 465 CVYYM-----------GNQASRDLIQDYEFYTNPQAKGKKHLKFNVLLTTYEYILKDRST 513

Query: 444 LKNCNVGLMLADEGHRLKNGDSLTFTALDSISCPRRVILSGTPIQNDLSEYFALLSFSNP 503
           L +     +  DE HRLKN +S  + +L+S     R++++GTP+QN++ E  AL++F  P
Sbjct: 514 LGSIKWQFLAVDEAHRLKNAESSLYESLNSFKVANRLLITGTPLQNNIKELAALVNFLMP 573

Query: 504 GLLGSRAEFRKNFENPILRGRDADATDKEITKGEAQLQKLSTIVSKFIIRRTNDILAKYL 563
           G      E   +FEN             +  + E  ++ L   +  FI+RR    + K L
Sbjct: 574 GRFTIDQEI--DFEN-------------QDEQQEEYIRDLHKRLQPFILRRLKKDVEKSL 618

Query: 564 PCKYEHVIFVNLKPLQNELY-NKLIKSREXXXXXXXXXXSQPLRAIGILKKLCNHPXXXX 622
           P K E ++ V L  +Q E Y N L K+               L  +  LKK  NHP    
Sbjct: 619 PSKTERILRVELSDVQTEYYKNILTKNYSALTSGIKGGHVSLLNVMNELKKASNHPYLFD 678

Query: 623 XXXXXXXXXXXXXXXXYNMPGSKARDVQTK----YSAKFSILERFLHKIKTESDDKIVLI 678
                               G K+R+   +     S K  +L++ L ++K +   ++++ 
Sbjct: 679 NAEERVLSKFGD--------GHKSRENILRGLIMSSGKMVLLDKLLTRLKKDG-HRVLIF 729

Query: 679 SNYTQTLDLIEKMCRYKHYSAVRLDGTMSINKRQKLVDRFNDPEGQEFIFLLSSKAGGCG 738
           S   + LD++      K  +  RLDGT+   +R+  +D FN  +  +F+FLLS++AGG G
Sbjct: 730 SQMVRILDILGDYLSIKGINFQRLDGTVPSAQRRISIDHFNAEDSNDFVFLLSTRAGGLG 789

Query: 739 INLIGANRLILMDPDWNPAADQQALARVWRDGQKKDCFIYRFISTGTIEEKIFQRQSMKM 798
           INL+ A+ +I+ D DWNP AD QA+AR  R GQK    +YRF+S  T+EE++ +R   KM
Sbjct: 790 INLMTADTVIIFDSDWNPQADLQAMARAHRIGQKNHVMVYRFVSKDTVEEEVLERARKKM 849

Query: 799 SLSSCVV 805
            L   ++
Sbjct: 850 ILEYAII 856

>AFR537W [3729] [Homologous to ScYOR304W (ISW2) - SH]
           complement(1400495..1400512,1400676..1403735) [3078 bp,
           1025 aa]
          Length = 1025

 Score =  213 bits (541), Expect = 6e-57,   Method: Compositional matrix adjust.
 Identities = 147/486 (30%), Positives = 233/486 (47%), Gaps = 64/486 (13%)

Query: 332 IMADEMGLGKTLQCIALMWTLLRQGPQGKRLIDKC----IIVCPSSLVNNWANELIKWLG 387
           I+ADEMGLGKTLQ I+ +  L        R I       I+V P S ++NW  E  KW  
Sbjct: 150 ILADEMGLGKTLQTISFLGYL--------RFIKDIDGPFIVVVPKSTLDNWKREFAKW-T 200

Query: 388 PNTLTPLAVDGKKSSMGGGNTTVSQAIHAWAQAQGRNIVKPVLIISYETLRRNVDQLKNC 447
           P   T +        + G   T +Q I    + +       VLI SYE + +    LK  
Sbjct: 201 PEVNTIV--------LHGDRETRTQLI----EERILTCDFDVLITSYEMVIKEKAILKKF 248

Query: 448 NVGLMLADEGHRLKNGDSLTFTALDSISCPRRVILSGTPIQNDLSEYFALLSFSNPGLLG 507
               ++ DE HR+KN  S     +       R++++GTP+QN+L E +ALL+F  P + G
Sbjct: 249 AWQYIVIDEAHRIKNEQSTLSQIIRLFYSKSRLLITGTPLQNNLHELWALLNFLLPDVFG 308

Query: 508 SRAEFRKNFENPILRGRDADATDKEITKGEAQLQKLSTIVSKFIIRRTNDILAKYLPCKY 567
               F + F+      ++  A D+EI      +Q+L  ++  F++RR    + K L  K 
Sbjct: 309 ESEVFDEWFQ------QNEKAQDQEIV-----VQQLHAVLQPFLLRRVKADVEKSLLPKI 357

Query: 568 EHVIFVNLKPLQNELYNKLIKSREXXXXXXXXXXSQPLRAIGI---LKKLCNHPXXXXXX 624
           E  ++V +  +Q + Y  L++                 R + I   L+K CNHP      
Sbjct: 358 ETNVYVGMTAMQLQWYRSLLEKDIDAVNGAVGKREGKTRLLNIVMQLRKCCNHP------ 411

Query: 625 XXXXXXXXXXXXXXYNMPGSK-----ARDVQTKYSAKFSILERFLHKIKTESDDKIVLIS 679
                         Y   G++       D    Y++   I+   L K K +   ++++ S
Sbjct: 412 --------------YLFEGAEPGPPYTTDEHLIYNSGKMIVLDKLLKRKKKEGSRVLIFS 457

Query: 680 NYTQTLDLIEKMCRYKHYSAVRLDGTMSINKRQKLVDRFNDPEGQEFIFLLSSKAGGCGI 739
             ++ LD++E  C ++ +   R+DG  S  +R   +D FN  + ++FIFLL+++AGG GI
Sbjct: 458 QMSRLLDILEDYCYFRDFEYCRIDGATSHEERIAAIDEFNAHDSKKFIFLLTTRAGGLGI 517

Query: 740 NLIGANRLILMDPDWNPAADQQALARVWRDGQKKDCFIYRFISTGTIEEKIFQRQSMKMS 799
           NL+ A+ ++L D DWNP AD QA+ R  R GQKK   +YR ++   IEEK+ +R + K+ 
Sbjct: 518 NLVTADTVVLYDSDWNPQADLQAMDRAHRIGQKKQVHVYRLVTENAIEEKVIERAAQKLR 577

Query: 800 LSSCVV 805
           L   V+
Sbjct: 578 LDQLVI 583

>Kwal_56.23442
          Length = 1435

 Score =  213 bits (543), Expect = 6e-57,   Method: Compositional matrix adjust.
 Identities = 147/481 (30%), Positives = 234/481 (48%), Gaps = 41/481 (8%)

Query: 332 IMADEMGLGKTLQCIALM-WTLLRQGPQGKRLIDKCIIVCPSSLVNNWANELIKWLGPNT 390
           I+ADEMGLGKT+Q +A + W +  +   G  L+     V P S +  W     KW  P+ 
Sbjct: 379 ILADEMGLGKTVQTVAFISWLIYARRQNGPHLV-----VVPLSTMPAWQETFEKW-APDL 432

Query: 391 LTPLAVDGKKSSMGGGNTTVSQAIHAWAQAQGRNIVK-PVLIISYETLRRNVDQLKNCNV 449
                V  +KS     +           QA+ +   K  VL+ +YE + ++  +L     
Sbjct: 433 NCIYFVGNQKSR----DAIREGEFFTNPQAKTKKHAKFNVLLTTYEYILKDRAELGAIKW 488

Query: 450 GLMLADEGHRLKNGDSLTFTALDSISCPRRVILSGTPIQNDLSEYFALLSFSNPGLLGSR 509
             +  DE HRLKN +S  + +L+S     R++++GTP+QN++ E  AL++F  PG     
Sbjct: 489 QFLAVDEAHRLKNAESSLYESLNSFKVANRLLITGTPLQNNIKELAALVNFLMPGRFTID 548

Query: 510 AEFRKNFENPILRGRDADATDKEITKGEAQLQKLSTIVSKFIIRRTNDILAKYLPCKYEH 569
            E   +FEN     +DA+         E  ++ L + +  FI+RR    + K LP K E 
Sbjct: 549 QEI--DFEN-----QDAEQ--------ETYIRDLHSRLQPFILRRLKKDVEKSLPSKTER 593

Query: 570 VIFVNLKPLQNELY-NKLIKSREXXXXXXXXXXSQPLRAIGILKKLCNHPXXXXXXXXXX 628
           ++ V L  +Q + Y N L K+               L  +  LKK  NHP          
Sbjct: 594 ILRVELSDVQTDYYKNILTKNYSALSAGSKGAHFSLLNIMNELKKASNHPYLFDMAEDRV 653

Query: 629 XXXXXXXXXXYNMPGSKARDVQTK----YSAKFSILERFLHKIKTESDDKIVLISNYTQT 684
                         G  +R+   +     S K  +L++ L ++K +   ++++ S   + 
Sbjct: 654 LAKFGD--------GRMSRENILRGLIMSSGKMVLLDQLLTRLKKDGH-RVLIFSQMVRM 704

Query: 685 LDLIEKMCRYKHYSAVRLDGTMSINKRQKLVDRFNDPEGQEFIFLLSSKAGGCGINLIGA 744
           LD++      K  +  RLDGT+   +R+  +D FN P+  +F+FLLS++AGG GINL+ A
Sbjct: 705 LDILGDYLNIKGITYQRLDGTVPSAQRRISIDHFNAPDSNDFVFLLSTRAGGLGINLMTA 764

Query: 745 NRLILMDPDWNPAADQQALARVWRDGQKKDCFIYRFISTGTIEEKIFQRQSMKMSLSSCV 804
           + +I+ D DWNP AD QA+AR  R GQK    +YRF+S  T+EE++ +R   KM L   +
Sbjct: 765 DTVIIFDSDWNPQADLQAMARAHRIGQKNHVMVYRFVSKDTVEEEVLERARKKMILEYAI 824

Query: 805 V 805
           +
Sbjct: 825 I 825

>AFL040W [3153] [Homologous to ScYBR245C (ISW1) - SH]
           complement(363162..366422) [3261 bp, 1086 aa]
          Length = 1086

 Score =  212 bits (540), Expect = 8e-57,   Method: Compositional matrix adjust.
 Identities = 143/487 (29%), Positives = 238/487 (48%), Gaps = 66/487 (13%)

Query: 332 IMADEMGLGKTLQCIALMWTLLRQGPQGKRLIDK----CIIVCPSSLVNNWANELIKWLG 387
           I+ADEMGLGKTLQ I  +  L        R I+K     +++ P S +NNW  E+ +W  
Sbjct: 166 ILADEMGLGKTLQTITFLGYL--------RYIEKKRGPFLVIAPKSTLNNWQREINRW-- 215

Query: 388 PNTLTPLAVDGKKSSMGGGNTTVSQAIHAWAQAQGRNIVKPVLIISYETLRRNVDQLKNC 447
               TP   D     + G     ++       A   ++     I SYE + R     K  
Sbjct: 216 ----TP---DVDAFILQGDKEERARLCQERLLACNFDVA----IASYEIIIREKASFKKI 264

Query: 448 NVGLMLADEGHRLKNGDSLTFTALDSISCPRRVILSGTPIQNDLSEYFALLSFSNPGLLG 507
           +   ++ DE HR+KN +S+    L   S   R++++GTP+QN+L E +ALL+F  P +  
Sbjct: 265 DWEYIVIDEAHRIKNEESMLSQVLREFSSRNRLLITGTPLQNNLHELWALLNFLLPDIFS 324

Query: 508 SRAEFRKNFENPILRGRDADATDKEITKGEAQLQKLSTIVSKFIIRRT-NDILAKYLPCK 566
             A F + F         ++A+D +  K    +++L TI+  F++RR  +D+    LP K
Sbjct: 325 DSAAFDEWF--------SSEASDDDKDK---IVKQLHTILQPFLLRRIKSDVETSLLPKK 373

Query: 567 YEHVIFVNLKPLQNELYNKLIKSREXXXXXXXXXXSQPLRAIGI---LKKLCNHPXXXXX 623
            E  ++V +  +Q + Y ++++                 R + I   L+K CNHP     
Sbjct: 374 -ELNLYVGMSSMQRKWYKQILEKDLDAVNGSNGSKESKTRLLNIMMQLRKCCNHP----- 427

Query: 624 XXXXXXXXXXXXXXXYNMPGSK-----ARDVQTKYSAKFSILERFLHKIKTESDDKIVLI 678
                          Y   G++       D    Y++    +   L K   E   ++++ 
Sbjct: 428 ---------------YLFDGAEPGPPYTTDEHLVYNSAKLKVLDKLLKKLKEDGSRVLIF 472

Query: 679 SNYTQTLDLIEKMCRYKHYSAVRLDGTMSINKRQKLVDRFNDPEGQEFIFLLSSKAGGCG 738
           S  ++ LD++E  C ++ Y   R+DG+ +   R + +D +N P+ ++FIFLL+++AGG G
Sbjct: 473 SQMSRLLDILEDYCYFRGYEYCRIDGSTAHEDRIEAIDEYNAPDSRKFIFLLTTRAGGLG 532

Query: 739 INLIGANRLILMDPDWNPAADQQALARVWRDGQKKDCFIYRFISTGTIEEKIFQRQSMKM 798
           INL  A+ ++L D DWNP AD QA+ R  R GQKK   ++R ++  ++EEKI +R + K+
Sbjct: 533 INLTTADVVVLYDSDWNPQADLQAMDRAHRIGQKKQVKVFRLVTDNSVEEKILERATQKL 592

Query: 799 SLSSCVV 805
            L   V+
Sbjct: 593 RLDQLVI 599

>YIL126W (STH1) [2550] chr9 (117992..122071) Component of abundant
           chromatin remodeling complex (RSC), involved in the
           response to DNA damage, DNA helicase of the Snf2p
           family, has a bromodomain [4080 bp, 1359 aa]
          Length = 1359

 Score =  211 bits (538), Expect = 3e-56,   Method: Compositional matrix adjust.
 Identities = 150/483 (31%), Positives = 233/483 (48%), Gaps = 39/483 (8%)

Query: 332 IMADEMGLGKTLQCIALMWTLLRQGPQGKRLIDKCIIVCPSSLVNNWANELIKWL-GPNT 390
           I+ADEMGLGKT+Q I+L+  L     + K+ I   +++ P S + NW  E  KW    NT
Sbjct: 492 ILADEMGLGKTIQSISLITYLY----EVKKDIGPFLVIVPLSTITNWTLEFEKWAPSLNT 547

Query: 391 LTPLAVDGKKSSMGGGNTTVSQAIHAWAQAQGRNIVKPVLIISYETLRRNVDQLKNCNVG 450
           +       ++ S+               Q Q R     VL+ +YE + ++   L   +  
Sbjct: 548 IIYKGTPNQRHSL---------------QHQIRVGNFDVLLTTYEYIIKDKSLLSKHDWA 592

Query: 451 LMLADEGHRLKNGDS-LTFTALDSISCPRRVILSGTPIQNDLSEYFALLSFSNPGLLGSR 509
            M+ DEGHR+KN  S L+FT         R+IL+GTP+QN+L E +ALL+F  P +  S 
Sbjct: 593 HMIIDEGHRMKNAQSKLSFTISHYYRTRNRLILTGTPLQNNLPELWALLNFVLPKIFNSA 652

Query: 510 AEFRKNFENPILRGRDADATDKEITKGEAQLQKLSTIVSKFIIRRTNDILAKYLPCKYEH 569
             F   F  P       +  +    +    +++L  ++  F++RR    + K LP K E 
Sbjct: 653 KTFEDWFNTPFANTGTQEKLELTEEETLLIIRRLHKVLRPFLLRRLKKEVEKDLPDKVEK 712

Query: 570 VIFVNLKPLQNELYNKLIKSREXXXXXXXXXXSQPL-----RAIGILKKLCNHPXXXXXX 624
           VI   L  LQ +LY +++K             ++         I  L+K+CNHP      
Sbjct: 713 VIKCKLSGLQQQLYQQMLKHNALFVGAGTEGATKGGIKGLNNKIMQLRKICNHPFVFDEV 772

Query: 625 XXXXXXXXXXXXXXYNMPGSKARDVQTKYSAKFSILERFLHKIKTESDDKIVLISNYTQT 684
                            P     D+  + + KF +L+R L K K  S  ++++    TQ 
Sbjct: 773 EGVVN------------PSRGNSDLLFRVAGKFELLDRVLPKFKA-SGHRVLMFFQMTQV 819

Query: 685 LDLIEKMCRYKHYSAVRLDGTMSINKRQKLVDRFNDPEGQEFIFLLSSKAGGCGINLIGA 744
           +D++E   R K    +RLDG+    +R ++++ FN P+   F FLLS++AGG G+NL  A
Sbjct: 820 MDIMEDFLRMKDLKYMRLDGSTKTEERTEMLNAFNAPDSDYFCFLLSTRAGGLGLNLQTA 879

Query: 745 NRLILMDPDWNPAADQQALARVWRDGQKKDCFIYRFISTGTIEEKIFQRQSMKMSLSSCV 804
           + +I+ D DWNP  D QA  R  R GQK +  I R I+T ++EE I +R   K+ +   V
Sbjct: 880 DTVIIFDTDWNPHQDLQAQDRAHRIGQKNEVRILRLITTDSVEEVILERAMQKLDIDGKV 939

Query: 805 VDA 807
           + A
Sbjct: 940 IQA 942

>KLLA0B08327g 742205..746809 similar to sp|P22082 Saccharomyces
            cerevisiae YOR290c SNF2 component of SWI/SNF global
            transcription activator complex, hypothetical start
          Length = 1534

 Score =  211 bits (537), Expect = 4e-56,   Method: Compositional matrix adjust.
 Identities = 150/484 (30%), Positives = 229/484 (47%), Gaps = 41/484 (8%)

Query: 332  IMADEMGLGKTLQCIALMWTLLRQGPQGKRLIDKCIIVCPSSLVNNWANELIKWLGPNTL 391
            I+ADEMGLGKT+Q I+L+  L     + K +    +++ P S + NW  E  KW  P  L
Sbjct: 706  ILADEMGLGKTIQTISLLTYLY----EAKGVHGPFLVIVPLSTLTNWNAEFDKW-APK-L 759

Query: 392  TPLAVDGKKSSMGGGNTTVSQAIHAWAQAQGRNIVKPVLIISYETLRRNVDQLKNCNVGL 451
              +A  G                    QA  +N    V++ ++E + +    L       
Sbjct: 760  RKIAFKGPPMERKP------------KQALIKNREFDVVLTTFEYIIKERPLLSKIKWVH 807

Query: 452  MLADEGHRLKNGDS-LTFTALDSISCPRRVILSGTPIQNDLSEYFALLSFSNPGLLGSRA 510
             + DEGHR+KN  S L+ T         R+IL+GTP+QN+L E +ALL+F  P +  S  
Sbjct: 808  TIIDEGHRMKNAQSKLSLTLNTYYHSDYRLILTGTPLQNNLPELWALLNFVLPKIFNSVK 867

Query: 511  EFRKNFENPILR--GRDADATDKEITKGEAQLQKLSTIVSKFIIRRTNDILAKYLPCKYE 568
             F + F  P     G+D  A  +E T     +++L  ++  F++RR    + K LP K E
Sbjct: 868  SFDEWFNTPFANTGGQDKIALSEEETL--LVIRRLHKVLRPFLLRRLKKDVEKDLPDKVE 925

Query: 569  HVIFVNLKPLQNELYNKLIKSREX----XXXXXXXXXSQPLR-AIGILKKLCNHPXXXXX 623
             V+   +  LQ++LY +++K R               S+     I  L+K+CNHP     
Sbjct: 926  KVLKCKMSALQHKLYQQMLKHRRLFIFDDSSNQKFSSSRGFNNQIMQLRKICNHPFVFEE 985

Query: 624  XXXXXXXXXXXXXXXYNMPGSKARDVQTKYSAKFSILERFLHKIKTESDDKIVLISNYTQ 683
                              P  +  D   + + KF +LER L K K  +  ++++    TQ
Sbjct: 986  VEDQIN------------PARETNDTIWRSAGKFELLERILPKFKA-TGHRVLIFFQMTQ 1032

Query: 684  TLDLIEKMCRYKHYSAVRLDGTMSINKRQKLVDRFNDPEGQEFIFLLSSKAGGCGINLIG 743
             +D++E   RY     +RLDG    + R  L++ FN P    F FLLS++AGG G+NL  
Sbjct: 1033 VMDIMEDFLRYLDMKYLRLDGHTKSDDRTALLNTFNAPNSDYFCFLLSTRAGGLGLNLQT 1092

Query: 744  ANRLILMDPDWNPAADQQALARVWRDGQKKDCFIYRFISTGTIEEKIFQRQSMKMSLSSC 803
            A+ +I+ D DWNP  D QA  R  R GQK +  I R I+  ++EE I  +   K+ +   
Sbjct: 1093 ADTVIIFDTDWNPHQDLQAQDRAHRIGQKNEVRILRLITDNSVEEAILDKAHAKLDIDGK 1152

Query: 804  VVDA 807
            V+ A
Sbjct: 1153 VIQA 1156

>Scas_576.6
          Length = 1457

 Score =  211 bits (536), Expect = 5e-56,   Method: Compositional matrix adjust.
 Identities = 148/481 (30%), Positives = 235/481 (48%), Gaps = 41/481 (8%)

Query: 332 IMADEMGLGKTLQCIALM-WTLLRQGPQGKRLIDKCIIVCPSSLVNNWANELIKWLGPNT 390
           I+ADEMGLGKT+Q +A + W +  +   G       I+V P S +  W     KW  P+ 
Sbjct: 404 ILADEMGLGKTVQTVAFISWLIYARRQNGPH-----IVVVPLSTMPAWQETFDKW-APD- 456

Query: 391 LTPLAVDGKKSSMGGGNTTVSQAIHAWAQAQGR-NIVKPVLIISYETLRRNVDQLKNCNV 449
           L  +   G + S    +       +    A+G+ NI   VL+ +YE + ++  +L +   
Sbjct: 457 LNVICYMGNQRSR---DAIREFEFYTNPYAKGKKNIKFNVLLTTYEYILKDRSELGSIKW 513

Query: 450 GLMLADEGHRLKNGDSLTFTALDSISCPRRVILSGTPIQNDLSEYFALLSFSNPGLLGSR 509
             +  DE HRLKN +S  + +L+S     R++++GTP+QN++ E  AL++F  PG     
Sbjct: 514 QFLAVDEAHRLKNAESSLYESLNSFKVNNRLLITGTPLQNNIKELAALINFLMPGRFTID 573

Query: 510 AEFRKNFENPILRGRDADATDKEITKGEAQLQKLSTIVSKFIIRRTNDILAKYLPCKYEH 569
            E   +FEN           D+E    E  ++ L   +  FI+RR    + K LP K E 
Sbjct: 574 QEI--DFEN----------QDEE---QEEYIRDLHKRLQPFILRRLKKDVEKSLPSKTER 618

Query: 570 VIFVNLKPLQNELY-NKLIKSREXXXXXXXXXXSQPLRAIGILKKLCNHPXXXXXXXXXX 628
           ++ V L  +Q E Y N L K+               L  +  LKK  NHP          
Sbjct: 619 ILRVELSDVQTEYYKNILTKNYSALTAGSKGGHFSLLNIMSELKKASNHPYLFDNAEERV 678

Query: 629 XXXXXXXXXXYNMPGSKARDVQTK----YSAKFSILERFLHKIKTESDDKIVLISNYTQT 684
                         G  +R+   +     S K  +L++ L+K+K +   ++++ S   + 
Sbjct: 679 LKKFGD--------GQMSRENVLRGLIMSSGKMVLLDQLLNKLKKDGH-RVLIFSQMVRM 729

Query: 685 LDLIEKMCRYKHYSAVRLDGTMSINKRQKLVDRFNDPEGQEFIFLLSSKAGGCGINLIGA 744
           LD++      K  +  RLDGT+   +R+  +D FN P+  + +FLLS++AGG GINL+ A
Sbjct: 730 LDILGDYLSIKGITFQRLDGTVPSAQRRISIDHFNAPDSTDDVFLLSTRAGGLGINLMTA 789

Query: 745 NRLILMDPDWNPAADQQALARVWRDGQKKDCFIYRFISTGTIEEKIFQRQSMKMSLSSCV 804
           + +I+ D DWNP AD QA+AR  R GQK    +YR +S  T+EE++ +R   KM L   +
Sbjct: 790 DTVIIFDSDWNPQADLQAMARAHRIGQKNHVMVYRLVSKDTVEEEVLERARKKMILEYAI 849

Query: 805 V 805
           +
Sbjct: 850 I 850

>CAGL0H05533g 538045..543759 highly similar to sp|P32333 Saccharomyces
            cerevisiae YPL082c MOT1, start by similarity
          Length = 1904

 Score =  207 bits (527), Expect = 7e-55,   Method: Compositional matrix adjust.
 Identities = 158/534 (29%), Positives = 245/534 (45%), Gaps = 68/534 (12%)

Query: 332  IMADEMGLGKTLQCIALMWT--LLRQGPQGKRLIDKC-----IIVCPSSLVNNWANELIK 384
            I+ D+MGLGKTLQ I ++ +   LRQ         +C     +IVCP SL  +W NE  +
Sbjct: 1335 ILCDDMGLGKTLQTICIIASDQYLRQEEYKLSGNIECRPLPSLIVCPPSLTGHWENEFEQ 1394

Query: 385  WLGPNTLTPLAVDGKKSSMGGGNTTVSQAIHAWAQAQGRNIVKPVLIISYETLRRNVDQL 444
            +      +P      K  +  G  +V Q +     +        ++I SY+  R ++D +
Sbjct: 1395 Y------SPFL----KIVVYAGGPSVRQPLRKQLSSAD------IIITSYDVARNDLDTI 1438

Query: 445  KNCNVGLMLADEGHRLKNGDSLTFTALDSISCPRRVILSGTPIQNDLSEYFALLSFSNPG 504
             + +    + DEGH +KN  S    A+  I    R+IL+GTPIQN++ E ++L  F  PG
Sbjct: 1439 SSYDYNYCVLDEGHLIKNAQSKLAKAVKLIKANHRLILTGTPIQNNVVELWSLFDFLMPG 1498

Query: 505  LLGSRAEFRKNFENPILRGRDADATDKEITKGEAQLQKLSTIVSKFIIRRTNDILAKYLP 564
             LG+   F++ F  PI   R++  + KE   G   L+ L   V  F++RR  + +   LP
Sbjct: 1499 FLGTEKSFQERFAKPIAASRNSKTSSKEQEAGALALEALHKQVLPFMLRRLKEDVLSDLP 1558

Query: 565  CKYEHVIFVNLKPLQNELYNKLIK------SREXXXXXXXXXXSQPLRAIGILKKLCNHP 618
             K     +  L  LQ +LY    K       ++              +A+  ++KLCNHP
Sbjct: 1559 PKIIQDYYCELSDLQKQLYEDFAKKQKNVVEKDIQNTADVDSKQHIFQALQYMRKLCNHP 1618

Query: 619  XXXXXXXXXXXXXXXXXXXXYNMPGSKARDVQTKYSAKFSILERFLH-----------KI 667
                                    G    D++   + K + L   L            K+
Sbjct: 1619 ---ALVLSNDHPQLKQIQNYLKQTGCDLHDIRN--APKLTALRTLLFECGIGEADMDKKV 1673

Query: 668  KTE--------SDDKIVLISNYTQTLDLIEKMCRYKHY----SAVRLDGTMSINKRQKLV 715
              E        S  + ++       LD+IE    +K Y    S +RLDG++    RQK+V
Sbjct: 1674 TGEQLLTGSVISQHRALIFCQLKDMLDMIENDL-FKRYMPSVSYMRLDGSVDPRDRQKVV 1732

Query: 716  DRFNDPEGQEFIFLLSSKAGGCGINLIGANRLILMDPDWNPAADQQALARVWRDGQKKDC 775
             +FN+    +   LL++K GG G+NL GA+ +I ++ DWNP  D QA+ R  R GQKK  
Sbjct: 1733 RKFNEDPSID-CLLLTTKVGGLGLNLTGADTVIFVEHDWNPMNDLQAMDRAHRLGQKKVV 1791

Query: 776  FIYRFISTGTIEEKIFQRQSMKMSLSSCVVD------AKEDVER---LFSSDNL 820
             +YR ++ GT+EEKI   Q  KM+++S VV+      A  D  +   LF +DN+
Sbjct: 1792 NVYRIVTKGTLEEKIMGLQKFKMNIASTVVNQQNSGLASMDTHQLLDLFDTDNV 1845

>AEL256C [2250] [Homologous to ScYPL082C (MOT1) - SH] (156109..161709)
            [5601 bp, 1866 aa]
          Length = 1866

 Score =  206 bits (523), Expect = 2e-54,   Method: Compositional matrix adjust.
 Identities = 162/562 (28%), Positives = 257/562 (45%), Gaps = 88/562 (15%)

Query: 332  IMADEMGLGKTLQCIALMWT---LLRQGPQGKRLIDK----CIIVCPSSLVNNWANELIK 384
            I+ D+MGLGKTLQ I ++ +   L ++  +  + ++      +IVCP SL  +W  E  +
Sbjct: 1301 ILCDDMGLGKTLQTICIIASDQYLRQEDYKTTKSVETRPLPSLIVCPPSLTGHWEQEFEQ 1360

Query: 385  WL----------GPNTLTPLAVDGKKSSMGGGNTTVSQAIHAWAQAQGRNIVKPVLIISY 434
            +           GP+T  PL     +  +G  +                     +++ SY
Sbjct: 1361 YAPFLTVLVYAGGPSTRYPL-----RGKLGDAD---------------------IVVTSY 1394

Query: 435  ETLRRNVDQLKNCNVGLMLADEGHRLKNGDSLTFTALDSISCPRRVILSGTPIQNDLSEY 494
            +  R ++D +   +    + DEGH +KN  S    A+ SI    R+IL+GTPIQN++ E 
Sbjct: 1395 DVARNDIDIISKHDYNYCVLDEGHIIKNSQSKLAKAVKSIRANHRLILTGTPIQNNVVEL 1454

Query: 495  FALLSFSNPGLLGSRAEFRKNFENPILRGRDADATDKEITKGEAQLQKLSTIVSKFIIRR 554
            ++L  F  PG LGS   F++ F  PI   R++  + KE   G   L+ L   V  F++RR
Sbjct: 1455 WSLFDFLMPGFLGSEKAFQERFAKPIAASRNSKTSSKEQEAGALALEALHKQVLPFMLRR 1514

Query: 555  TNDILAKYLPCKYEHVIFVNLKPLQNELY------NKLIKSREXXXXXXXXXXSQPLRAI 608
              + +   LP K     +  L  LQ +LY       K I  R+          +   +A+
Sbjct: 1515 LKEDVLSDLPPKIIQDYYCELSDLQRQLYKDFAKKQKNIVERDIENTMELESKNHIFQAL 1574

Query: 609  GILKKLCNHPXXXXXXXXXXXXXXXXXXXXYNMPGSKARDVQTKYSAKFSILERFL---- 664
              ++KLCNHP                     +  G    D+   ++ K   L   L    
Sbjct: 1575 QYMRKLCNHP---SLVLSKDHPQYNQVQDYLSQTGMDIHDI--AHAPKLGALRNLLLECG 1629

Query: 665  --------HKIKTESDDKIV------LISNYTQTLDLIEKMCRYKHYSAV---RLDGTMS 707
                    + I   S + ++      +       LD+IE     K+  +V   RLDG++ 
Sbjct: 1630 IGVQDVDQNSISLPSSENVISQHRALIFCQLKDMLDMIENDLFKKYLPSVTYMRLDGSVE 1689

Query: 708  INKRQKLVDRFNDPEGQEFIFLLSSKAGGCGINLIGANRLILMDPDWNPAADQQALARVW 767
               RQK+V +FN+    +   LL++K GG G+NL GA+ +I ++ DWNP  D QA+ R  
Sbjct: 1690 SRDRQKVVRKFNEDPSID-CLLLTTKVGGLGLNLTGADTVIFIEHDWNPMNDLQAMDRAH 1748

Query: 768  RDGQKKDCFIYRFISTGTIEEKIFQRQSMKMSLSSCVVD------AKEDVER---LFSSD 818
            R GQKK   +YR I+ G++EEKI   Q  KM+++S VV+      A  D  +   LF +D
Sbjct: 1749 RLGQKKVVNVYRIITKGSLEEKIMGLQKFKMNIASTVVNQQNAGLASMDTHQLLDLFDTD 1808

Query: 819  N-LRQLFQKNENTICE--THET 837
            N L Q+ ++    I +  T+ET
Sbjct: 1809 NSLAQVKEEKAGAISDDVTNET 1830

>AGR123C [4434] [Homologous to ScYER164W (CHD1) - SH]
           (980963..985231) [4269 bp, 1422 aa]
          Length = 1422

 Score =  204 bits (519), Expect = 6e-54,   Method: Compositional matrix adjust.
 Identities = 144/481 (29%), Positives = 233/481 (48%), Gaps = 41/481 (8%)

Query: 332 IMADEMGLGKTLQCIALM-WTLLRQGPQGKRLIDKCIIVCPSSLVNNWANELIKWLGPNT 390
           I+ADEMGLGKT+Q ++ + W +  +   G  L+     V P S +  W     KW  P  
Sbjct: 378 ILADEMGLGKTVQTVSFISWLIFARRQNGPHLV-----VVPLSTMPAWQETFEKW-APEL 431

Query: 391 LTPLAVDGKKSSMGGGNTTVSQAIHAWAQAQGR-NIVKPVLIISYETLRRNVDQLKNCNV 449
                +  +KS     +       +     +G+ NI   VL+ +YE + ++  +L     
Sbjct: 432 NCVYYMGNQKSR----DVIREYEFYTNPHTKGKKNIKFNVLLTTYEYILKDRLELGAIKW 487

Query: 450 GLMLADEGHRLKNGDSLTFTALDSISCPRRVILSGTPIQNDLSEYFALLSFSNPGLLGSR 509
             +  DE HRLKN +S  + +L S     R++++GTP+QN++ E  AL++F  PG     
Sbjct: 488 QFLAVDEAHRLKNAESSLYESLSSFKVANRMLITGTPLQNNIKELAALVNFLMPGKFTID 547

Query: 510 AEFRKNFENPILRGRDADATDKEITKGEAQLQKLSTIVSKFIIRRTNDILAKYLPCKYEH 569
            E   +FEN             +  K E  ++ L   +  +I+RR    + K LP K E 
Sbjct: 548 QEI--DFEN-------------QDEKQENYIRDLHKRLQPYILRRLKKDVEKSLPSKTER 592

Query: 570 VIFVNLKPLQNELY-NKLIKSREXXXXXXXXXXSQPLRAIGILKKLCNHPXXXXXXXXXX 628
           ++ V L  +Q E Y N L K+               L  +  LKK  NHP          
Sbjct: 593 ILRVELSDVQTEYYKNILTKNYNALTAGTKGTHFSLLNIMNELKKASNHPYLFGNAENRV 652

Query: 629 XXXXXXXXXXYNMPGSKARDVQTK----YSAKFSILERFLHKIKTESDDKIVLISNYTQT 684
                         G+++R+   +     S K  +L++ L ++K +   ++++ S   + 
Sbjct: 653 LAKFGD--------GNRSRENILRGLIMSSGKMVLLDKLLTRLKKDGH-RVLIFSQMVRM 703

Query: 685 LDLIEKMCRYKHYSAVRLDGTMSINKRQKLVDRFNDPEGQEFIFLLSSKAGGCGINLIGA 744
           LD++      K  +  RLDGT+  ++R+  +D FN P+  +F+FLLS++AGG GINL+ A
Sbjct: 704 LDILGDYLSIKGINFQRLDGTVPSSQRRISIDHFNAPDSNDFVFLLSTRAGGLGINLMTA 763

Query: 745 NRLILMDPDWNPAADQQALARVWRDGQKKDCFIYRFISTGTIEEKIFQRQSMKMSLSSCV 804
           + +I+ D DWNP AD QA+AR  R GQK    +YRF+S  T+EE++ +R   KM L   +
Sbjct: 764 DTVIIFDSDWNPQADLQAMARAHRIGQKNHVMVYRFVSKDTVEEEVLERARKKMILEYAI 823

Query: 805 V 805
           +
Sbjct: 824 I 824

>CAGL0G08756g complement(829778..833842) highly similar to sp|P32597
           Saccharomyces cerevisiae YIL126w STH1 subunit of the RSC
           complex, hypothetical start
          Length = 1354

 Score =  203 bits (516), Expect = 1e-53,   Method: Compositional matrix adjust.
 Identities = 148/484 (30%), Positives = 232/484 (47%), Gaps = 41/484 (8%)

Query: 332 IMADEMGLGKTLQCIALMWTL--LRQGPQGKRLIDKCIIVCPSSLVNNWANELIKWLGPN 389
           I+ADEMGLGKT+Q I+L+  L  ++Q P         +++ P S + NW  E  KW  P 
Sbjct: 475 ILADEMGLGKTIQSISLITYLYEVKQEP------GPYLVIVPLSTITNWTLEFEKW-AP- 526

Query: 390 TLTPLAVDGKKSSMGGGNTTVSQAIHAWAQAQGRNIVKPVLIISYETLRRNVDQLKNCNV 449
           +LT +   G  +             HA  Q + R+    VL+ +YE + ++   L     
Sbjct: 527 SLTTIIYKGTPNQR-----------HAL-QHKIRSGNFDVLLTTYEYIIKDKALLSKHEW 574

Query: 450 GLMLADEGHRLKNGDS-LTFTALDSISCPRRVILSGTPIQNDLSEYFALLSFSNPGLLGS 508
             M+ DEGHR+KN +S L+FT         R+IL+GTP+QN+L E +ALL+F  P +  S
Sbjct: 575 SHMIIDEGHRMKNANSKLSFTITKYYRTRNRLILTGTPLQNNLPELWALLNFVLPKIFNS 634

Query: 509 RAEFRKNFENPILRGRDADATDKEITKGEAQLQKLSTIVSKFIIRRTNDILAKYLPCKYE 568
              F   F  P       +  +    +    +++L  ++  F++RR    + K LP K E
Sbjct: 635 AKTFEDWFNTPFANTGTQEKLELTEEETLLVIRRLHKVLRPFLLRRLKKEVEKDLPDKVE 694

Query: 569 HVIFVNLKPLQNELYNKLIKSREXXXXXXXXXXSQP-----LRAIGILKKLCNHPXXXXX 623
            V+   L  LQ +LY +++K             ++         I  L+K+CNHP     
Sbjct: 695 KVVKCKLSGLQQQLYQQMLKHNALFVGAGTEGATKGGIKGLNNKIMQLRKICNHPFVFDE 754

Query: 624 XXXXXXXXXXXXXXXYNMPGSKARDVQTKYSAKFSILERFLHKIKTESDDKIVLISNYTQ 683
                             P     D+  + + KF +L+R L K K  +  ++++    TQ
Sbjct: 755 VEAVVN------------PSRGNSDLLYRVAGKFELLDRILPKFKA-TGHRVLIFFQMTQ 801

Query: 684 TLDLIEKMCRYKHYSAVRLDGTMSINKRQKLVDRFNDPEGQEFIFLLSSKAGGCGINLIG 743
            +D++E   R +    +RLDG+     R  ++  FN    + F FLLS++AGG G+NL  
Sbjct: 802 VMDIMEDFLRMRDLKYMRLDGSTKAEDRNDMLKEFNVENSEYFCFLLSTRAGGLGLNLQS 861

Query: 744 ANRLILMDPDWNPAADQQALARVWRDGQKKDCFIYRFISTGTIEEKIFQRQSMKMSLSSC 803
           A+ +I+ D DWNP  D QA  R  R GQK +  I R I+T ++EE I +R   K+ +   
Sbjct: 862 ADTVIIFDTDWNPHQDLQAQDRAHRIGQKNEVRILRLITTDSVEEVILERAMQKLDIDGK 921

Query: 804 VVDA 807
           V+ A
Sbjct: 922 VIQA 925

>YPL082C (MOT1) [5362] chr16 complement(398475..404078)
            Transcriptional Accessory Protein (TAF) involved in RNA
            polymerase II transcriptional repression through
            interaction with TATA-binding protein (TBP), member of
            the Snf2p family of DNA helicases [5604 bp, 1867 aa]
          Length = 1867

 Score =  199 bits (505), Expect = 4e-52,   Method: Compositional matrix adjust.
 Identities = 159/561 (28%), Positives = 249/561 (44%), Gaps = 58/561 (10%)

Query: 325  NRGAYGCIMADEMGLGKTLQCIALMWT---LLRQGPQGKRLIDK----CIIVCPSSLVNN 377
            N+     I+ D+MGLGKTLQ I ++ +   L ++  +  R ++      +I+CP SL  +
Sbjct: 1287 NKYHLHGILCDDMGLGKTLQTICIIASDQYLRKEDYEKTRSVESRALPSLIICPPSLTGH 1346

Query: 378  WANELIKWLGPNTLTPLAVDGKKSSMGGGNTTVSQAIHAWAQAQGRNIVKPVLIISYETL 437
            W NE  ++       P      K  +  G  TV   +    Q    +I+    + SY+  
Sbjct: 1347 WENEFDQY------APFL----KVVVYAGGPTVRLTLRP--QLSDADII----VTSYDVA 1390

Query: 438  RRNVDQLKNCNVGLMLADEGHRLKNGDSLTFTALDSISCPRRVILSGTPIQNDLSEYFAL 497
            R ++  L        + DEGH +KN  S    A+  I+   R+IL+GTPIQN++ E ++L
Sbjct: 1391 RNDLAVLNKTEYNYCVLDEGHIIKNSQSKLAKAVKEITANHRLILTGTPIQNNVLELWSL 1450

Query: 498  LSFSNPGLLGSRAEFRKNFENPILRGRDADATDKEITKGEAQLQKLSTIVSKFIIRRTND 557
              F  PG LG+   F++ F  PI   R++  + KE   G   L+ L   V  F++RR  +
Sbjct: 1451 FDFLMPGFLGTEKMFQERFAKPIAASRNSKTSSKEQEAGVLALEALHKQVLPFMLRRLKE 1510

Query: 558  ILAKYLPCKYEHVIFVNLKPLQNELYNKLIK------SREXXXXXXXXXXSQPLRAIGIL 611
             +   LP K     +  L  LQ +LY    K       ++              +A+  +
Sbjct: 1511 DVLSDLPPKIIQDYYCELGDLQKQLYMDFTKKQKNVVEKDIENSEIADGKQHIFQALQYM 1570

Query: 612  KKLCNHPXXXXXXXXXXXXXXXXXXXXYNMPGSKARDVQTKYSAKFSILERFLHK--IKT 669
            +KLCNHP                        G    D+    + K S L   L +  I  
Sbjct: 1571 RKLCNHP---ALVLSPNHPQLAQVQDYLKQTGLDLHDIIN--APKLSALRTLLFECGIGE 1625

Query: 670  ESDDK------------------IVLISNYTQTLDLIEKMCRYKHYSAV---RLDGTMSI 708
            E  DK                   ++       LD++E     K+  +V   RLDG++  
Sbjct: 1626 EDIDKKASQDQNFPIQNVISQHRALIFCQLKDMLDMVENDLFKKYMPSVTYMRLDGSIDP 1685

Query: 709  NKRQKLVDRFNDPEGQEFIFLLSSKAGGCGINLIGANRLILMDPDWNPAADQQALARVWR 768
              RQK+V +FN+    +   LL++K GG G+NL GA+ +I ++ DWNP  D QA+ R  R
Sbjct: 1686 RDRQKVVRKFNEDPSID-CLLLTTKVGGLGLNLTGADTVIFVEHDWNPMNDLQAMDRAHR 1744

Query: 769  DGQKKDCFIYRFISTGTIEEKIFQRQSMKMSLSSCVVDAKEDVERLFSSDNLRQLFQKNE 828
             GQKK   +YR I+ GT+EEKI   Q  KM+++S VV+ +        +  L  LF  + 
Sbjct: 1745 IGQKKVVNVYRIITKGTLEEKIMGLQKFKMNIASTVVNQQNSGLASMDTHQLLDLFDPDN 1804

Query: 829  NTICETHETYHCKRCNAQGKQ 849
             T  +  E  +     A+G +
Sbjct: 1805 VTSQDNEEKNNGDSQAAKGME 1825

>Scas_664.9
          Length = 1859

 Score =  197 bits (502), Expect = 1e-51,   Method: Compositional matrix adjust.
 Identities = 153/541 (28%), Positives = 241/541 (44%), Gaps = 74/541 (13%)

Query: 332  IMADEMGLGKTLQCIALMWT--LLR-------QGPQGKRLIDKCIIVCPSSLVNNWANEL 382
            I+ D+MGLGKTLQ I ++ +   LR          + ++L    +IVCP SL  +W NE 
Sbjct: 1289 ILCDDMGLGKTLQTICIIASDQYLRAEDYKKTNSVETRKL--PSLIVCPPSLTGHWENEF 1346

Query: 383  IKWL----------GPNTLTPLAVDGKKSSMGGGNTTVSQAIHAWAQAQGRNIVKPVLII 432
             ++           GP+   PL     +  +G  +                     ++I 
Sbjct: 1347 EQYAPFLKIIVYAGGPSMRIPL-----RDELGSAD---------------------IVIT 1380

Query: 433  SYETLRRNVDQLKNCNVGLMLADEGHRLKNGDSLTFTALDSISCPRRVILSGTPIQNDLS 492
            SY+  R ++  +   +    + DEGH +KN  S    A+  IS   R+IL+GTPIQN++ 
Sbjct: 1381 SYDVARNDLSIITKYDFNYCVLDEGHIIKNAQSKLAKAVKQISANHRLILTGTPIQNNVV 1440

Query: 493  EYFALLSFSNPGLLGSRAEFRKNFENPILRGRDADATDKEITKGEAQLQKLSTIVSKFII 552
            E ++L  F  PG LG+   F++ F  PI   R++  + KE   G   L+ L   V  F++
Sbjct: 1441 ELWSLFDFLMPGFLGTEKMFQEKFAKPIAASRNSKTSSKEQEAGVLALEALHKQVLPFML 1500

Query: 553  RRTNDILAKYLPCKYEHVIFVNLKPLQNELYNKLIK------SREXXXXXXXXXXSQPLR 606
            RR  + +   LP K     +  L  LQ +LY    K       ++              +
Sbjct: 1501 RRLKEDVLSDLPPKIIQDYYCELSDLQKQLYQDFAKKQKNVVEKDIENTTDTDNSQHIFQ 1560

Query: 607  AIGILKKLCNHPXXX--------XXXXXXXXXXXXXXXXXYNMPGSKA-RDVQTKYSAKF 657
            A+  ++KLCNHP                             N P   A R +  +     
Sbjct: 1561 ALQYMRKLCNHPALVLSPNHPQLAQVQDYLKQTGIDLHDVINAPKLNALRTLLFECGIGE 1620

Query: 658  SILER------FLHKIKTESDDKIVLISNYTQTLDLIEKMCRYKHY----SAVRLDGTMS 707
              +ER      +L      S  + ++       LD++E    +K Y    + +RLDG++ 
Sbjct: 1621 EDMERKSNPNQYLTGQNVISQHRALIFCQLKDMLDMVENDL-FKRYMPSVTYMRLDGSVD 1679

Query: 708  INKRQKLVDRFNDPEGQEFIFLLSSKAGGCGINLIGANRLILMDPDWNPAADQQALARVW 767
               RQK+V +FN+    +   LL++K GG G+NL GA+ +I ++ DWNP  D QA+ R  
Sbjct: 1680 PRDRQKVVRKFNEDPSID-CLLLTTKVGGLGLNLTGADTVIFVEHDWNPMNDLQAMDRAH 1738

Query: 768  RDGQKKDCFIYRFISTGTIEEKIFQRQSMKMSLSSCVVDAKEDVERLFSSDNLRQLFQKN 827
            R GQKK   +YR I+ GT+EEKI   Q  KM+++S VV+ +        +  L  LF  +
Sbjct: 1739 RLGQKKVVNVYRIITKGTLEEKIMGLQKFKMNIASTVVNQQNSGLASMDTHQLLDLFDTD 1798

Query: 828  E 828
            +
Sbjct: 1799 D 1799

>ADL098C [1643] [Homologous to ScYFR038W (MEI4) - SH]
           (508448..510862) [2415 bp, 804 aa]
          Length = 804

 Score =  192 bits (489), Expect = 6e-51,   Method: Compositional matrix adjust.
 Identities = 152/519 (29%), Positives = 239/519 (46%), Gaps = 62/519 (11%)

Query: 332 IMADEMGLGKTLQCIALMWTLLRQGPQGKRLIDKCIIVCPSSLVNNWANELIKWLGPNTL 391
           I+ADEMGLGKT+Q IAL+  +     +G  L+       P S+V+NW  E  K+  P+  
Sbjct: 209 ILADEMGLGKTIQSIALLAFIYEMDTRGPFLV-----TAPLSVVDNWITEFEKF-APS-- 260

Query: 392 TPLAVDGKKSSMGGGNTTVSQAIHAWAQAQGR-NIVKPVLIISYETLRRNVDQLKNCNVG 450
             + V    S+ G G        HA  +   R N  + V++ SYE + R+++ + +    
Sbjct: 261 --IPVLKYYSADGPGKR------HAILKEFFRKNSGEGVVVTSYEIVMRDMNVILSHQWK 312

Query: 451 LMLADEGHRLKNGDSLTFTALDSISCPRRVILSGTPIQNDLSEYFALLSFSNPGLLGSRA 510
            ++ DEGHRLKN +      L  I+   R++L+GTP+QN+L+E ++LL+F  P +     
Sbjct: 313 FLIVDEGHRLKNINCKLIRELKRINTFNRLLLTGTPLQNNLAELWSLLNFILPDVFADFE 372

Query: 511 EFRKNFENPILRGRDADATDKEITKGEAQ---LQKLSTIVSKFIIRRTNDI-LAKYLPCK 566
            F K F+   L  + +     +I   E +   +  L TI+  F++RR   + LA  LP K
Sbjct: 373 IFSKWFDFSDLDLKTSSQRWDKIIGEELEKNLVTNLHTILKPFLLRRLKRVVLADALPPK 432

Query: 567 YEHVIFVNLKP-------------LQNELYNKLIKS-----------------REXXXXX 596
            E++I   L P             L+  ++ + IK                  RE     
Sbjct: 433 REYIINCPLTPLQTRFYKMALAGKLKRTVFTQAIKEFFTLNREHIGSVSNKTIREFIDYK 492

Query: 597 XXXXXSQPLRAIGILKKLCNHPXXXX------XXXXXXXXXXXXXXXXYNMPGSKARDVQ 650
                 Q  + I  ++KL                              +  P  KA D+Q
Sbjct: 493 TSDEEIQASKVITDMEKLYEQHIHKELRNKRLQNLMMQLRQIVDSTFLFYFPYLKAEDLQ 552

Query: 651 T----KYSAKFSILERFLHKIKTESDDKIVLISNYTQTLDLIEKMCRYKHYSAVRLDGTM 706
                + S K  IL++ L ++   +  K+++ S +   LDLIE  C   +YSA R+DG+M
Sbjct: 553 LPVLLQTSGKLQILQQLLPRL-LAAKHKVLIFSQFVSMLDLIEDWCELNNYSACRIDGSM 611

Query: 707 SINKRQKLVDRFNDPEGQEFIFLLSSKAGGCGINLIGANRLILMDPDWNPAADQQALARV 766
               R++ ++ F++      +FLLS++AGG GINL  A+ +IL D DWNP  D QA+ R 
Sbjct: 612 DNETRREQINSFSEKGSPHSLFLLSTRAGGLGINLTAADSVILFDNDWNPQVDLQAMDRS 671

Query: 767 WRDGQKKDCFIYRFISTGTIEEKIFQRQSMKMSLSSCVV 805
            R GQ+    +YR     T+E  I  R + K  L   V+
Sbjct: 672 HRIGQQHPVIVYRLYCDKTVESVILARATNKRKLEQLVI 710

>ACR286C [1333] [Homologous to ScYAL019W (FUN30) - SH]
           (877337..880396) [3060 bp, 1019 aa]
          Length = 1019

 Score =  121 bits (304), Expect = 7e-28,   Method: Compositional matrix adjust.
 Identities = 85/269 (31%), Positives = 130/269 (48%), Gaps = 37/269 (13%)

Query: 331 CIMADEMGLGKTLQCIALMWTLLRQGPQGKRLIDKCIIVCPSSLVNNWANELIKWLGPNT 390
           CI+ADEMGLGKT Q I+ +  L  Q   G  L+     V PSS + NW  E  K+     
Sbjct: 492 CILADEMGLGKTCQVISFLAYLKEQNHTGPHLV-----VVPSSTLENWLREFKKFCPQLK 546

Query: 391 LTPLAVDGKKSSMGGGNTTVSQAIHAWAQAQGRNIVKP------VLIISYETLRRN---V 441
           + P     ++                  +A+ R+I++        ++ +Y     N   V
Sbjct: 547 IEPYYGSQQE------------------RAELRDILEENDGQYDAIVTTYNLASGNKADV 588

Query: 442 DQLKNCNVGLMLADEGHRLKNGDSLTFTALDSISCPRRVILSGTPIQNDLSEYFALLSFS 501
             LKN    +++ DEGH LKN  S  FT L  I    R++L+GTP+QN+L E  +LL F 
Sbjct: 589 SFLKNRQFNVVIYDEGHMLKNSMSERFTKLMKIHANFRLLLTGTPLQNNLRELMSLLEFI 648

Query: 502 NPGLLGSRA-EFRKNFENPILRGRDADAT-DKEITKGEAQLQKLSTIVSKFIIRRTNDIL 559
            P L  S+  E    F+    R R +D+  D      +  + +  TI+  FI+RR  D +
Sbjct: 649 MPSLFVSKKDELAAVFKQ---RARTSDSNKDYNPLLAQEAIDRAKTIMKPFILRRRKDQV 705

Query: 560 AKYLPCKYEHVIFVNLKPLQNELYNKLIK 588
            K+LP K+ H+ + ++ P Q  +YN+ I+
Sbjct: 706 LKHLPAKHHHIEYCDMTPEQQAIYNREIR 734

 Score =  108 bits (270), Expect = 7e-24,   Method: Compositional matrix adjust.
 Identities = 56/138 (40%), Positives = 85/138 (61%), Gaps = 1/138 (0%)

Query: 673  DKIVLISNYTQTLDLIEKMCRYKHYSAVRLDGTMSINKRQKLVDRFNDPEGQEFIFLLSS 732
            +K ++ S +TQ LD++E +      + +RLDG+  +N RQ L+DRF+  +    +FLLS+
Sbjct: 864  EKTLVFSLFTQVLDILELVLSSLGIAFLRLDGSTPVNDRQALIDRFH-TDTDVPVFLLST 922

Query: 733  KAGGCGINLIGANRLILMDPDWNPAADQQALARVWRDGQKKDCFIYRFISTGTIEEKIFQ 792
            KAGG GINL+ AN +I+ D  +NP  D+QA  R  R GQ ++  +   +S  T+EEKI Q
Sbjct: 923  KAGGFGINLVCANHVIIFDQSFNPHDDRQAADRAHRVGQTREVAVTTLVSRATVEEKILQ 982

Query: 793  RQSMKMSLSSCVVDAKED 810
                K++L S V D + D
Sbjct: 983  LARHKLALDSSVSDRRAD 1000

>CAGL0M01188g complement(132330..136682) similar to sp|Q05471
            Saccharomyces cerevisiae YDR334w, start by similarity
          Length = 1450

 Score =  120 bits (301), Expect = 2e-27,   Method: Compositional matrix adjust.
 Identities = 61/152 (40%), Positives = 89/152 (58%), Gaps = 3/152 (1%)

Query: 674  KIVLISNYTQTLDLIEKMCRYKHYSAVRLDGTMSINKRQKLVDRFN-DPEGQEFIFLLSS 732
            + ++ +  T+ LD++E+   Y  Y  +RLDG   I  RQ L +RFN DP+    +F+LSS
Sbjct: 1196 RALIFTQMTKVLDILEQFLNYHGYLYMRLDGATKIEDRQILTERFNSDPKIT--VFILSS 1253

Query: 733  KAGGCGINLIGANRLILMDPDWNPAADQQALARVWRDGQKKDCFIYRFISTGTIEEKIFQ 792
            ++GG GINL GA+ +I  D DWNPA D+Q   R  R GQ +D  IYRF+S  TIE  I +
Sbjct: 1254 RSGGLGINLTGADTVIFYDSDWNPAMDKQCQDRCHRIGQTRDVHIYRFVSEHTIESNILK 1313

Query: 793  RQSMKMSLSSCVVDAKEDVERLFSSDNLRQLF 824
            + + K  L   ++   E     FS  +++ LF
Sbjct: 1314 KANQKRQLDDVIIQKGEFTTDYFSKLSVKDLF 1345

 Score =  113 bits (282), Expect = 3e-25,   Method: Compositional matrix adjust.
 Identities = 80/301 (26%), Positives = 144/301 (47%), Gaps = 36/301 (11%)

Query: 332 IMADEMGLGKTLQCIALMWTLLRQ----GPQGKRLIDKCIIVCPSSLVNNWANELIKWL- 386
           I+ADEMGLGKT+Q I+L+  L  +    GP         +IV P+S++ NW  E  ++  
Sbjct: 650 ILADEMGLGKTIQTISLLSYLACEKHNWGPH--------LIVVPTSVLLNWEMEFKRFAP 701

Query: 387 GPNTLTPLAVDGKKSSMGGGNTTVSQAIHAWAQAQGRNIVKPVLIISYETLRRNVDQLKN 446
           G   LT      ++     G          W +    +    V I+SY+ + ++    K 
Sbjct: 702 GFKVLTYYGNPQQRKEKRKG----------WNKPDAFH----VCIVSYQLIVQDQHSFKR 747

Query: 447 CNVGLMLADEGHRLKNGDSLTFTALDSISCPRRVILSGTPIQNDLSEYFALLSFSNPGLL 506
                M+ DE H +KN  S  + AL + +  RR++L+GTP+QN+++E ++LL F  P  +
Sbjct: 748 KKWQYMVLDEAHNIKNFRSTRWQALLNFNTQRRILLTGTPLQNNIAELWSLLYFLMPQTV 807

Query: 507 --GSRAE-------FRKNFENPILRGRDADATDKEITKGEAQLQKLSTIVSKFIIRRTND 557
             G +         F++ F  P+ +  +   T ++  + +  ++KL  ++  +++RR   
Sbjct: 808 IDGQKVSGFADLDAFQQWFGRPVDKLIETGGTYEQDNETKRTVEKLHQVLRPYLLRRLKA 867

Query: 558 ILAKYLPCKYEHVIFVNLKPLQNELYNKLIKSREXXXXXXXXXXSQPLRAIGILKKLCNH 617
            + K +P KYEH+++  L   Q  LY+  +   +             +  +  L+K+CNH
Sbjct: 868 DVEKQIPGKYEHIVYCKLSKRQRFLYDDFMSRAQTKATLASGNFMSIVNCLMQLRKVCNH 927

Query: 618 P 618
           P
Sbjct: 928 P 928

>Sklu_1582.2 , Contig c1582 197-1048
          Length = 283

 Score =  113 bits (282), Expect = 2e-27,   Method: Compositional matrix adjust.
 Identities = 61/171 (35%), Positives = 90/171 (52%), Gaps = 6/171 (3%)

Query: 639 YNMPGSKARDVQTKYSAKFSILERFLHKIKTESDDKIVLISNYTQTLDLIEKMCRYKHYS 698
           Y  P   + DV  + S K  IL++ + K+  E   K+++ S +   LDLIE  C    + 
Sbjct: 18  YIQPEELSLDVLLQTSGKLQILQQLVPKLINEGH-KVLIFSQFVNMLDLIEDWCELNDFQ 76

Query: 699 AVRLDGTMSINKRQKLVDRFN----DPEGQEFIFLLSSKAGGCGINLIGANRLILMDPDW 754
           A R+DG+M    RQ+ + +FN    D    + +FLLS++AGG GINL  A+ +++ D DW
Sbjct: 77  ACRIDGSMDNEVRQEQIGKFNSKTTDSHAND-VFLLSTRAGGLGINLTAADSVVIFDSDW 135

Query: 755 NPAADQQALARVWRDGQKKDCFIYRFISTGTIEEKIFQRQSMKMSLSSCVV 805
           NP  D QA+ R  R GQ +   +YR     T+E  I  R   K  L   V+
Sbjct: 136 NPQVDLQAMDRTHRIGQDRPVIVYRLCCDNTVEHVILTRAVSKRKLEKLVI 186

>ADR309W [2050] [Homologous to ScYDR334W (SWR1) - SH]
            complement(1244005..1248465) [4461 bp, 1486 aa]
          Length = 1486

 Score =  119 bits (298), Expect = 4e-27,   Method: Compositional matrix adjust.
 Identities = 67/175 (38%), Positives = 96/175 (54%), Gaps = 4/175 (2%)

Query: 655  AKFSILERFLHKIKTESDDKIVLISNYTQTLDLIEKMCRYKHYSAVRLDGTMSINKRQKL 714
             K   L   L ++K E   + ++ +  T+ LD++E+   Y  Y  +RLDG   I  RQ L
Sbjct: 1217 GKLQSLAVLLRRLKEEGH-RALIFTQMTKVLDILEQFLNYHGYLYMRLDGATKIEDRQIL 1275

Query: 715  VDRFN-DPEGQEFIFLLSSKAGGCGINLIGANRLILMDPDWNPAADQQALARVWRDGQKK 773
             +RFN DP     +F+LSS++GG GINL GA+ +I  D DWNPA D+Q   R  R GQ +
Sbjct: 1276 TERFNTDPRIT--VFILSSRSGGLGINLTGADTVIFYDSDWNPAMDKQCQDRCHRIGQTR 1333

Query: 774  DCFIYRFISTGTIEEKIFQRQSMKMSLSSCVVDAKEDVERLFSSDNLRQLFQKNE 828
            D  IYRF S  TIE  I ++ + K  L + V+   E     FS  +++ L   +E
Sbjct: 1334 DVHIYRFASEHTIESNILKKANQKRQLDNIVIQKGEFTTDYFSRLSVKDLLGSDE 1388

 Score =  112 bits (281), Expect = 5e-25,   Method: Compositional matrix adjust.
 Identities = 101/403 (25%), Positives = 171/403 (42%), Gaps = 80/403 (19%)

Query: 232 NGVRNKPLRELLGDSENSAENKKKFASVPVVIDPKLAKILRPHQVEGVRFLYRCVTGLVM 291
           + V N  +  L    ++ + N +K + V V + P L   LR +Q +G+ +L         
Sbjct: 632 DAVSNMEIDSLEMQDKDESTNLEKLSVVDVPVPPLLRGTLRTYQKQGLNWL--------- 682

Query: 292 KDYLEAEAFNTSSEDPLKSDEKALTESQKTEQNNRGAYGCIMADEMGLGKTLQCIALMWT 351
                A  +N                      N  G    I+ADEMGLGKT+Q IAL+  
Sbjct: 683 -----ASLYNN---------------------NTNG----ILADEMGLGKTIQTIALLAY 712

Query: 352 LLRQ----GPQGKRLIDKCIIVCPSSLVNNWANELIKWLGPNTLTPLAVDGKKSSMGGGN 407
           L  +    GP         +I+ P+S++ NW  E  ++         A   K  S  G  
Sbjct: 713 LACEKENWGPH--------LIIVPTSVLLNWEMEFKRF---------APGFKVLSYYGSP 755

Query: 408 TTVSQAIHAWAQAQGRNIVKPVLIISYETLRRNVDQLKNCNVGLMLADEGHRLKNGDSLT 467
               +    W +    +    V I SY+ +  +    K      M+ DE H +KN  S  
Sbjct: 756 QQRKEKRRGWNKLDAFH----VCITSYQLVVHDQHSFKRKKWQYMILDEAHNIKNFKSTR 811

Query: 468 FTALDSISCPRRVILSGTPIQNDLSEYFALLSFSNP------GLLGSRAE---FRKNFEN 518
           + AL + +  RR++L+GTP+QN+++E ++LL F  P      G +   A+   F++ F  
Sbjct: 812 WQALLNFNTRRRLLLTGTPLQNNIAELWSLLYFLMPQTALENGKISGFADLDAFQQWFGK 871

Query: 519 P---ILRGRDADATDKEITKGEAQLQKLSTIVSKFIIRRTNDILAKYLPCKYEHVIFVNL 575
           P   I+   D++  D    +    + KL  ++  +++RR    + K +P KYEH+++  L
Sbjct: 872 PVDKIIAANDSEHDD----ETRRTVSKLHQVLRPYLLRRLKADVEKQMPAKYEHILYCRL 927

Query: 576 KPLQNELYNKLIKSREXXXXXXXXXXSQPLRAIGILKKLCNHP 618
              Q  LY+  +   +             +  +  L+K+CNHP
Sbjct: 928 SKRQRFLYDDFMSRAQTKATLASGNFMSIINCLMQLRKVCNHP 970

>Scas_520.5
          Length = 863

 Score =  118 bits (295), Expect = 6e-27,   Method: Compositional matrix adjust.
 Identities = 84/258 (32%), Positives = 130/258 (50%), Gaps = 19/258 (7%)

Query: 332 IMADEMGLGKTLQCIALMWTLLRQGPQGKRLIDKCIIVCPSSLVNNWANELIKWLGPNTL 391
           I+AD+MGLGKT+Q IAL+  +     +G  LI       P S V+NW NE  K+  P+  
Sbjct: 293 ILADDMGLGKTIQSIALLAFIYEMDTKGPFLI-----AAPLSTVDNWMNEFEKF-APDL- 345

Query: 392 TPLAVDGKKSSMGGGNTTVSQAIHAWAQAQGRNIVKPVLIISYETLRRNVDQLKNCNVGL 451
            P+    K    GG N       + + +  G  IV    + SYE + R+ D + +     
Sbjct: 346 -PVL---KYYHPGGKNERNKLMRNFFKKTNGTGIV----VTSYEIIIRDADYIMSKQWKF 397

Query: 452 MLADEGHRLKNGDSLTFTALDSISCPRRVILSGTPIQNDLSEYFALLSFSNPGLLGSRAE 511
           ++ DEGHRLKN +      L  I+   R++L+GTP+QN+L+E ++LL+F  P +      
Sbjct: 398 LIVDEGHRLKNVNCRLIQELKRINTSNRLLLTGTPLQNNLAELWSLLNFIMPDIFTDFEI 457

Query: 512 FRKNFENPILRGRDADATDKEITKGEAQ---LQKLSTIVSKFIIRRTND-ILAKYLPCKY 567
           F K F+   L      +   ++   E Q   +  L TI+  F++RR    +LA  LP K 
Sbjct: 458 FNKWFDFKDLEMESNSSKLNKVINEELQKNLISNLHTILKPFLLRRLKKTVLANILPPKR 517

Query: 568 EHVIFVNLKPLQNELYNK 585
           E+V+   L P+Q + Y +
Sbjct: 518 EYVVNCPLTPIQKKFYKR 535

 Score =  115 bits (287), Expect = 5e-26,   Method: Compositional matrix adjust.
 Identities = 56/152 (36%), Positives = 86/152 (56%), Gaps = 1/152 (0%)

Query: 654 SAKFSILERFLHKIKTESDDKIVLISNYTQTLDLIEKMCRYKHYSAVRLDGTMSINKRQK 713
           S K   L+R +  +  +   KI++ S +   LDL+E  C     +A R+DGT+    R++
Sbjct: 650 SGKLKTLQRLVIPLIAKGH-KILIFSQFVNMLDLLEDWCDLNSLAAFRIDGTIDNESRKE 708

Query: 714 LVDRFNDPEGQEFIFLLSSKAGGCGINLIGANRLILMDPDWNPAADQQALARVWRDGQKK 773
            + +FND + +  +FLLS++A G G+NL+GA+ ++L D DWNP  D QA+ R  R GQ K
Sbjct: 709 QLSKFNDKKNKHMVFLLSTRAAGLGVNLVGADTVVLFDSDWNPQVDLQAMDRCHRIGQTK 768

Query: 774 DCFIYRFISTGTIEEKIFQRQSMKMSLSSCVV 805
              +YRF    T+E  I  R + K  L   V+
Sbjct: 769 PVIVYRFCCDNTLEHVILTRAANKRKLERLVI 800

>KLLA0F07513g 707516..710662 similar to sp|P31380 Saccharomyces
           cerevisiae YAL019w FUN30, start by similarity
          Length = 1048

 Score =  118 bits (296), Expect = 6e-27,   Method: Compositional matrix adjust.
 Identities = 81/262 (30%), Positives = 126/262 (48%), Gaps = 21/262 (8%)

Query: 330 GCIMADEMGLGKTLQCIALMWTLLRQGPQGKRLIDKCIIVCPSSLVNNWANELIKWLGPN 389
            CI+ADEMGLGKT Q I+ +  L +    G  L+     V PSS + NW  E  K+    
Sbjct: 522 SCILADEMGLGKTCQVISFLAYLKQTHHNGPHLV-----VVPSSTLENWLREFNKFCPHL 576

Query: 390 TLTPLAVDGKKSSMGGGNTTVSQAIHAWAQAQGRNIVKPVLIISYET---LRRNVDQLKN 446
            + P           G     ++      + +G+     V++ +Y      + +V  L+N
Sbjct: 577 KVEPYY---------GSQQERAELRDILEENEGQ---YDVIVTTYNLAAGTKYDVSFLRN 624

Query: 447 CNVGLMLADEGHRLKNGDSLTFTALDSISCPRRVILSGTPIQNDLSEYFALLSFSNPGLL 506
            N  +++ DEGH LKN  S  F  L  I+   R++L+GTP+QN+L E  +LL F  P L 
Sbjct: 625 RNFDVVVYDEGHMLKNSMSERFNKLMKINAHFRLLLTGTPLQNNLKELMSLLEFIMPNLF 684

Query: 507 GSRAEFRKNFENPILRGRDADATDKEITKGEAQLQKLSTIVSKFIIRRTNDILAKYLPCK 566
            S+ +          R  DAD     +   E  +++  T++  FI+RR  D + K+LP K
Sbjct: 685 VSKKDDLATVFKQKTRTSDADKGYNPLL-AEHAIERAKTMMKPFILRRKKDQVLKHLPRK 743

Query: 567 YEHVIFVNLKPLQNELYNKLIK 588
           + H++   +  LQ  LY + IK
Sbjct: 744 HNHILHCEMTELQKTLYQQEIK 765

 Score =  110 bits (276), Expect = 2e-24,   Method: Compositional matrix adjust.
 Identities = 61/151 (40%), Positives = 89/151 (58%), Gaps = 1/151 (0%)

Query: 654  SAKFSILERFLHKIKTESDDKIVLISNYTQTLDLIEKMCRYKHYSAVRLDGTMSINKRQK 713
            S K   L+  LHKI     +K+++ S +TQ LD++E +    +   +RLDG   +N RQ 
Sbjct: 871  SGKVEQLKSVLHKIIDIQHEKVLVFSLFTQVLDILEFVLSTLNIKFLRLDGQTQVNDRQS 930

Query: 714  LVDRFNDPEGQEFIFLLSSKAGGCGINLIGANRLILMDPDWNPAADQQALARVWRDGQKK 773
            L+DRF + +    +FLLS+KAGG GINL+ AN +I+ D  +NP  D+QA  R  R GQ K
Sbjct: 931  LIDRFYEDDTIP-VFLLSTKAGGFGINLVCANNVIIFDQSFNPHDDRQAADRAHRVGQTK 989

Query: 774  DCFIYRFISTGTIEEKIFQRQSMKMSLSSCV 804
            +  +   IS  TIEEKI      K++L + +
Sbjct: 990  EVQVTTLISRDTIEEKILHLAKNKLALDTHI 1020

>CAGL0H06193g 604422..607802 similar to sp|P31380 Saccharomyces
            cerevisiae YAL019w FUN30, hypothetical start
          Length = 1126

 Score =  118 bits (295), Expect = 9e-27,   Method: Compositional matrix adjust.
 Identities = 60/156 (38%), Positives = 97/156 (62%), Gaps = 1/156 (0%)

Query: 654  SAKFSILERFLHKIKTESDDKIVLISNYTQTLDLIEKMCRYKHYSAVRLDGTMSINKRQK 713
            S K   L++ L  I  +  +K+++ + +TQ LD++EK+    +Y  +RLDG+  +N RQ 
Sbjct: 948  SGKVDALKKLLDDIINKKREKVLIFTLFTQVLDILEKVLSTLNYKFLRLDGSTQVNDRQT 1007

Query: 714  LVDRFNDPEGQEFIFLLSSKAGGCGINLIGANRLILMDPDWNPAADQQALARVWRDGQKK 773
            ++D+F D +    IF+LS++AGG GINL+ AN +I+ D  +NP  D+QA  R  R GQ K
Sbjct: 1008 MIDKFYD-DNTIPIFMLSTRAGGFGINLVCANHVIIFDQSFNPHDDRQAADRAHRVGQTK 1066

Query: 774  DCFIYRFISTGTIEEKIFQRQSMKMSLSSCVVDAKE 809
            +  +   I+  +IEEKIFQ    K++L S V  +++
Sbjct: 1067 EVTVTTLITKDSIEEKIFQLAKTKLALDSQVSSSED 1102

 Score =  105 bits (261), Expect = 9e-23,   Method: Compositional matrix adjust.
 Identities = 79/263 (30%), Positives = 120/263 (45%), Gaps = 23/263 (8%)

Query: 330 GCIMADEMGLGKTLQCIALMWTLLRQGPQGKRLIDKCIIVCPSSLVNNWANELIKWLGPN 389
            CI+AD+MGLGKT Q I+ +  L + G     LI     V PSS + NW  E  K+    
Sbjct: 592 SCILADDMGLGKTCQVISFLAYLKQIGQPSPHLI-----VVPSSTLENWLREFQKFCPSL 646

Query: 390 TLTPLAVDGKKSSMGGGNTTVSQAIHAWAQAQGRNIVKPVLIISYETL----RRNVDQLK 445
            + P                  Q      +   RN  K  +I++   L    + +V  LK
Sbjct: 647 KIEPYY-------------GTQQERADLREILERNDGKYDVIVTTYNLAAGNKYDVSFLK 693

Query: 446 NCNVGLMLADEGHRLKNGDSLTFTALDSISCPRRVILSGTPIQNDLSEYFALLSFSNPGL 505
             N  +++ DEGH LKN  S  F  L  I    R++L+GTP+QN+L E  +LL F  P L
Sbjct: 694 TRNFNVVVYDEGHMLKNSMSERFNKLMRIHANFRLLLTGTPLQNNLKELMSLLEFIMPNL 753

Query: 506 LGSRAEFRKNFENPILRGRDADATDKEITKGEAQLQKLSTIVSKFIIRRTNDILAKYLPC 565
             S+ E          +  D +     +   +A + +  T++  FI+RR  D + K+LP 
Sbjct: 754 FVSKKESLAAVFKQRAKTSDDNKGHNPLLAQQA-ITRAKTMMKPFILRRRKDQVLKHLPA 812

Query: 566 KYEHVIFVNLKPLQNELYNKLIK 588
           K+    +  +   Q E+YN+ +K
Sbjct: 813 KHVRTSYCAMNDTQREIYNREVK 835

>YDR334W (SWR1) [1163] chr4 (1135923..1140467) Member of the Snf2p DNA
            helicase ATPase family [4545 bp, 1514 aa]
          Length = 1514

 Score =  118 bits (295), Expect = 1e-26,   Method: Compositional matrix adjust.
 Identities = 59/151 (39%), Positives = 88/151 (58%), Gaps = 1/151 (0%)

Query: 674  KIVLISNYTQTLDLIEKMCRYKHYSAVRLDGTMSINKRQKLVDRFNDPEGQEFIFLLSSK 733
            + ++ +  T+ LD++E+   Y  Y  +RLDG   I  RQ L +RFN  + +  +F+LSS+
Sbjct: 1264 RALIFTQMTKVLDVLEQFLNYHGYLYMRLDGATKIEDRQILTERFN-TDSRITVFILSSR 1322

Query: 734  AGGCGINLIGANRLILMDPDWNPAADQQALARVWRDGQKKDCFIYRFISTGTIEEKIFQR 793
            +GG GINL GA+ +I  D DWNPA D+Q   R  R GQ +D  IYRF+S  TIE  I ++
Sbjct: 1323 SGGLGINLTGADTVIFYDSDWNPAMDKQCQDRCHRIGQTRDVHIYRFVSEHTIESNILKK 1382

Query: 794  QSMKMSLSSCVVDAKEDVERLFSSDNLRQLF 824
             + K  L + V+   +     FS  ++R L 
Sbjct: 1383 ANQKRQLDNVVIQEGDFTTDYFSKLSVRDLL 1413

 Score =  112 bits (281), Expect = 5e-25,   Method: Compositional matrix adjust.
 Identities = 89/305 (29%), Positives = 141/305 (46%), Gaps = 44/305 (14%)

Query: 332 IMADEMGLGKTLQCIALMWTLLRQ----GPQGKRLIDKCIIVCPSSLVNNWANELIKWL- 386
           I+ADEMGLGKT+Q I+L+  L  +    GP         +IV P+S++ NW  E  ++  
Sbjct: 718 ILADEMGLGKTIQTISLLAYLACEKENWGPH--------LIVVPTSVLLNWEMEFKRFAP 769

Query: 387 GPNTLTPLAV-DGKKSSMGGGNTTVSQAIHAWAQAQGRNIVKPVLIISYETLRRNVDQLK 445
           G   LT       +K    G N     A H             V I+SY+ + ++    K
Sbjct: 770 GFKVLTYYGSPQQRKEKRKGWNK--PDAFH-------------VCIVSYQLVVQDQHSFK 814

Query: 446 NCNVGLMLADEGHRLKNGDSLTFTALDSISCPRRVILSGTPIQNDLSEYFALLSFSNPGL 505
                 M+ DE H +KN  S  + AL + +  RR++L+GTP+QN+L+E ++LL F  P  
Sbjct: 815 RKRWQYMVLDEAHNIKNFRSTRWQALLNFNTQRRLLLTGTPLQNNLAELWSLLYFLMPQT 874

Query: 506 L--GSRAE-------FRKNFENP---ILRGRDADATDKEITKGEAQLQKLSTIVSKFIIR 553
           +  G +         F++ F  P   I+        DKE  K  A   KL  ++  +++R
Sbjct: 875 VIDGKKVSGFADLDAFQQWFGRPVDKIIETGQNFGQDKETKKTVA---KLHQVLRPYLLR 931

Query: 554 RTNDILAKYLPCKYEHVIFVNLKPLQNELYNKLIKSREXXXXXXXXXXSQPLRAIGILKK 613
           R    + K +P KYEH+++  L   Q  LY+  +   +             +  +  L+K
Sbjct: 932 RLKADVEKQMPAKYEHIVYCKLSKRQRFLYDDFMSRAQTKATLASGNFMSIVNCLMQLRK 991

Query: 614 LCNHP 618
           +CNHP
Sbjct: 992 VCNHP 996

>Scas_548.4
          Length = 1054

 Score =  117 bits (293), Expect = 2e-26,   Method: Compositional matrix adjust.
 Identities = 63/151 (41%), Positives = 93/151 (61%), Gaps = 1/151 (0%)

Query: 654  SAKFSILERFLHKIKTESDDKIVLISNYTQTLDLIEKMCRYKHYSAVRLDGTMSINKRQK 713
            S K   L R L +I  E  +K+++ S +TQ LD++E +    +Y  +RLDG+  +N RQ 
Sbjct: 872  SGKVDTLCRLLKEIIFERKEKVLIFSLFTQVLDILELVLSELNYKFLRLDGSTQVNDRQS 931

Query: 714  LVDRFNDPEGQEFIFLLSSKAGGCGINLIGANRLILMDPDWNPAADQQALARVWRDGQKK 773
            L+D+F + +    IF+LS+KAGG GINL+ AN +I+ D  +NP  D+QA  R  R GQ K
Sbjct: 932  LIDKFYEDDTIP-IFILSTKAGGFGINLVCANNVIIFDQSFNPHDDRQAADRAHRVGQTK 990

Query: 774  DCFIYRFISTGTIEEKIFQRQSMKMSLSSCV 804
            +  I   I+  +IEEKIFQ    K++L S +
Sbjct: 991  EVNITTLITKDSIEEKIFQLAKNKLALDSHI 1021

 Score =  104 bits (260), Expect = 1e-22,   Method: Compositional matrix adjust.
 Identities = 77/263 (29%), Positives = 123/263 (46%), Gaps = 21/263 (7%)

Query: 330 GCIMADEMGLGKTLQCIALMWTLLRQGPQGKRLIDKCIIVCPSSLVNNWANELIKWLGPN 389
            CI+AD+MGLGKT Q I+    L +    G  L+     V PSS + NW  E  K+    
Sbjct: 516 SCILADDMGLGKTCQVISFFAYLKQINEPGPHLV-----VVPSSTLENWLREFQKFCPTL 570

Query: 390 TLTPLAVDGKKSSMGGGNTTVSQAIHAWAQAQGRNIVKPVLIISYETLRRN---VDQLKN 446
            + P           G     +       +  G+     V++ +Y     N   V  L+N
Sbjct: 571 KIEPYY---------GSQNERADLREILERTAGQ---YDVIVTTYNLAAGNKYDVSFLRN 618

Query: 447 CNVGLMLADEGHRLKNGDSLTFTALDSISCPRRVILSGTPIQNDLSEYFALLSFSNPGLL 506
               +++ DEGH LKN  S  F  L  I    R++L+GTP+QN+L E  +LL F  P L 
Sbjct: 619 RQFNVVVYDEGHMLKNSMSERFNKLMRIQGNFRLLLTGTPLQNNLRELMSLLEFIMPALF 678

Query: 507 GSRAEFRKNFENPILRGRDADATDKEITKGEAQLQKLSTIVSKFIIRRTNDILAKYLPCK 566
            S+ E   +      +  D +     +   EA +++  T++  FI+RR  D + K+LP K
Sbjct: 679 ISKKESLASVFKQRAKTTDDNKGHNPLLVQEA-IERAKTMMKPFILRRRKDQVLKHLPAK 737

Query: 567 YEHVIFVNLKPLQNELYNKLIKS 589
           +  + +  ++ LQ ++Y+  IK+
Sbjct: 738 HHKIEYCIMQDLQRKIYDSEIKT 760

>Scas_646.3*
          Length = 1456

 Score =  117 bits (293), Expect = 2e-26,   Method: Compositional matrix adjust.
 Identities = 60/152 (39%), Positives = 89/152 (58%), Gaps = 4/152 (2%)

Query: 655  AKFSILERFLHKIKTESDDKIVLISNYTQTLDLIEKMCRYKHYSAVRLDGTMSINKRQKL 714
             K   L + L  +K ++  + ++ +  T+ LD++E+   Y  Y  +RLDG   +  RQ L
Sbjct: 1189 GKLQKLAKLLQDLK-DNGHRALIFTQMTKVLDVLERFLNYHGYIYMRLDGATKVEDRQIL 1247

Query: 715  VDRFN-DPEGQEFIFLLSSKAGGCGINLIGANRLILMDPDWNPAADQQALARVWRDGQKK 773
             +RFN DP     +F+LSS++GG GINL GA+ +I  D DWNPA D+Q   R  R GQ +
Sbjct: 1248 TERFNNDPRVT--VFILSSRSGGLGINLTGADTVIFYDSDWNPAMDKQCQDRCHRIGQTR 1305

Query: 774  DCFIYRFISTGTIEEKIFQRQSMKMSLSSCVV 805
            D  IYRF+S  TIE  I ++ + K  L + V+
Sbjct: 1306 DVHIYRFVSEHTIESNILKKANQKRQLDNVVI 1337

 Score =  112 bits (280), Expect = 6e-25,   Method: Compositional matrix adjust.
 Identities = 80/301 (26%), Positives = 143/301 (47%), Gaps = 36/301 (11%)

Query: 332 IMADEMGLGKTLQCIALMWTLLRQ----GPQGKRLIDKCIIVCPSSLVNNWANELIKWL- 386
           I+ADEMGLGKT+Q I+L+  L  +    GP         +IV P+S++ NW  E  ++  
Sbjct: 666 ILADEMGLGKTIQTISLLAYLACEKQNWGPH--------LIVVPTSVLLNWEMEFKRFCP 717

Query: 387 GPNTLTPLAVDGKKSSMGGGNTTVSQAIHAWAQAQGRNIVKPVLIISYETLRRNVDQLKN 446
           G   LT      ++     G          W +    +    V I+SY+ + ++    K 
Sbjct: 718 GLKVLTYYGSPQQRKEKRKG----------WNKPDAFH----VCIVSYQLVVQDQHSFKR 763

Query: 447 CNVGLMLADEGHRLKNGDSLTFTALDSISCPRRVILSGTPIQNDLSEYFALLSFSNPGLL 506
                M+ DE H +KN  S  + AL + +  RR++++GTP+QN+L+E ++LL F  P  +
Sbjct: 764 KKWQYMVLDEAHNIKNFRSTRWQALLNFNTRRRLLVTGTPLQNNLAELWSLLYFLMPQTV 823

Query: 507 --GSRAE-------FRKNFENPILRGRDADATDKEITKGEAQLQKLSTIVSKFIIRRTND 557
             G +         F++ F  P+ +  +  A  ++  + +  + KL  ++  +++RR   
Sbjct: 824 IDGKKVSGFADLDAFQQWFGRPVDKLIETGAGYQQDAETKKTVSKLHQVLRPYLLRRLKA 883

Query: 558 ILAKYLPCKYEHVIFVNLKPLQNELYNKLIKSREXXXXXXXXXXSQPLRAIGILKKLCNH 617
            + K +P KYEH+++  L   Q  LY+  +   +             +  +  L+K+CNH
Sbjct: 884 DVEKQMPAKYEHIVYCRLSKRQRFLYDDFMSRSQTKATLASGNFMSIVNCLMQLRKVCNH 943

Query: 618 P 618
           P
Sbjct: 944 P 944

>CAGL0E05038g 488549..493003 similar to sp|P53115 Saccharomyces
            cerevisiae YGL150c INO80, hypothetical start
          Length = 1484

 Score =  117 bits (292), Expect = 2e-26,   Method: Compositional matrix adjust.
 Identities = 62/156 (39%), Positives = 94/156 (60%), Gaps = 4/156 (2%)

Query: 654  SAKFSILERFLHKIKTESDDKIVLISNYTQTLDLIEKMCRYKHYSAVRLDGTMSINKRQK 713
            SAK   L+  L ++K ++D ++++    T+ +DL+E+   Y+ Y+ +RLDG+  +  R+ 
Sbjct: 1294 SAKLKKLDELLVELK-KNDHRVLIYFQMTKMMDLMEEYLTYRQYNHIRLDGSSKLEDRRD 1352

Query: 714  LV-DRFNDPEGQEFIFLLSSKAGGCGINLIGANRLILMDPDWNPAADQQALARVWRDGQK 772
            LV D   +PE   FIFLLS++AGG GINL  A+ +I  D DWNP  D QA+ R  R GQ 
Sbjct: 1353 LVHDWQTNPEI--FIFLLSTRAGGLGINLTAADTVIFYDSDWNPTIDSQAMDRAHRLGQT 1410

Query: 773  KDCFIYRFISTGTIEEKIFQRQSMKMSLSSCVVDAK 808
            K   +YR +  GTIEE++  R   K  +   V++ K
Sbjct: 1411 KQVTVYRLLVRGTIEERMRDRAKQKEQVQQVVMEGK 1446

 Score =  106 bits (265), Expect = 4e-23,   Method: Compositional matrix adjust.
 Identities = 84/328 (25%), Positives = 142/328 (43%), Gaps = 71/328 (21%)

Query: 325  NRGAYGCIMADEMGLGKTLQCIALMWTLLRQ----GPQGKRLIDKCIIVCPSSLVNNWAN 380
            ++G  G I+ADEMGLGKT+Q I+++  L       GP         ++V P+S ++NW N
Sbjct: 738  DQGING-ILADEMGLGKTVQSISVLAHLAEHHNIWGP--------FLVVTPASTLHNWVN 788

Query: 381  ELIKWLGPNTLTPLAVDGKKSSMGGGNTTVSQAIHAWAQAQGRNIVKP------------ 428
            E+ K++    + P                       W  A  R +++             
Sbjct: 789  EISKFVPQFKILPY----------------------WGSANDRKVLRKFWDRKNLRYSEK 826

Query: 429  ----VLIISYETLRRNVDQLKNCNVGLMLADEGHRLKNGDSLTFTALDSISCPRRVILSG 484
                V+I SY+ +  +   L+      M+ DE   +K+  S  +  L S  C  R++L+G
Sbjct: 827  SPFHVMITSYQMVVADASYLQKMKWQYMILDEAQAIKSSQSSRWKNLLSFHCRNRLLLTG 886

Query: 485  TPIQNDLSEYFALLSFSNPGLLGSRAEFRKNFENPILRGRDADATDKEITKGEAQLQKLS 544
            TPIQN++ E +ALL F  P L  S  EF + F   I    + ++     +  + QL++L 
Sbjct: 887  TPIQNNMQELWALLHFIMPSLFDSHDEFNEWFSRDIESHAEGNS-----SLNQQQLRRLH 941

Query: 545  TIVSKFIIRRTNDILAKYLPCKYEHVIFVNLKPLQNELYNKLIKSREXXXXXXXXXXSQP 604
             I+  F++RR    +   L  K E  +  +L   Q +LY +++KS+           +  
Sbjct: 942  MILKPFMLRRIKKNVQSELGDKIEIDVMCDLTQRQTKLY-QVLKSQMSSNYDAIENAAAE 1000

Query: 605  --------------LRAIGILKKLCNHP 618
                          + A+   +K+CNHP
Sbjct: 1001 GSDIAGGGNSDQSIINAVMQFRKVCNHP 1028

>KLLA0E08965g complement(797861..802330) similar to sp|P53115
            Saccharomyces cerevisiae YGL150c INO80, hypothetical
            start
          Length = 1489

 Score =  117 bits (292), Expect = 2e-26,   Method: Compositional matrix adjust.
 Identities = 62/156 (39%), Positives = 93/156 (59%), Gaps = 4/156 (2%)

Query: 654  SAKFSILERFLHKIKTESDDKIVLISNYTQTLDLIEKMCRYKHYSAVRLDGTMSINKRQK 713
            SAK   L+  L K+K E D ++++    T+ +DL+E+   Y+ Y+ +RLDG+  ++ R+ 
Sbjct: 1318 SAKLKKLDELLVKLK-EEDHRVLIYFQMTKMMDLMEEYLTYRQYTHIRLDGSSKLDDRRD 1376

Query: 714  LV-DRFNDPEGQEFIFLLSSKAGGCGINLIGANRLILMDPDWNPAADQQALARVWRDGQK 772
            LV D    P+   FIFLLS++AGG GINL  A+ +I  D DWNP  D QA+ R  R GQ 
Sbjct: 1377 LVHDWQTKPDI--FIFLLSTRAGGLGINLTAADTVIFYDSDWNPTIDSQAMDRAHRLGQT 1434

Query: 773  KDCFIYRFISTGTIEEKIFQRQSMKMSLSSCVVDAK 808
            +   +YR +  GTIEE++  R   K  +   V++ K
Sbjct: 1435 RQVTVYRLLIRGTIEERMRDRAKQKEHVQQVVMEGK 1470

 Score =  108 bits (270), Expect = 1e-23,   Method: Compositional matrix adjust.
 Identities = 84/304 (27%), Positives = 141/304 (46%), Gaps = 41/304 (13%)

Query: 332  IMADEMGLGKTLQCIALMWTLLRQ----GPQGKRLIDKCIIVCPSSLVNNWANELIKWLG 387
            I+ADEMGLGKT+Q I+++  L  +    GP         I+V P+S ++NW NE+ +++ 
Sbjct: 768  ILADEMGLGKTVQSISVLAHLADRYNIWGP--------FIVVTPASTLHNWVNEISRFVP 819

Query: 388  PNTLTPLAVDGKKSSMGGGNTTVSQAIHA-WAQAQ---GRNIVKPVLIISYETLRRNVDQ 443
               + P            GN    + +   W +     GR+    V++ SY+ +  +   
Sbjct: 820  QFKILPY----------WGNANDRKTLRKFWDRKHLRYGRDAPFHVMVTSYQMVVSDASY 869

Query: 444  LKNCNVGLMLADEGHRLKNGDSLTFTALDSISCPRRVILSGTPIQNDLSEYFALLSFSNP 503
            L+      M+ DE   +K+  S  +  L S  C  R++L+GTPIQN++ E +ALL F  P
Sbjct: 870  LQKMKWQYMILDEAQAIKSSQSSRWKTLLSFHCRNRLLLTGTPIQNNMQELWALLHFIMP 929

Query: 504  GLLGSRAEFRKNFENPILRGRDADATDKEITKGEAQLQKLSTIVSKFIIRRTNDILAKYL 563
             L  S  EF   F   I    +++         + QL++L  ++  F++RR    +   L
Sbjct: 930  SLFDSHDEFSDWFSKDIESHAESNT-----ELNQEQLRRLHMVLKPFMLRRIKKNVQSEL 984

Query: 564  PCKYEHVIFVNLKPLQNELYNKLIKSR--------EXXXXXXXXXXSQPLRAIGI-LKKL 614
              K E  +  +L   Q +LY +++KS+        E           Q L  + +  +K+
Sbjct: 985  GDKIEIDVLCDLTFRQAKLY-QVLKSQVSGGYDAIENAAGNDDVTSDQKLVNLVMEFRKV 1043

Query: 615  CNHP 618
            CNHP
Sbjct: 1044 CNHP 1047

>YFR038W (YFR038W) [1720] chr6 (229367..231928) Member of the
           Snf2/Rad54 subfamily of NTP-dependent DNA helicases
           [2562 bp, 853 aa]
          Length = 853

 Score =  116 bits (290), Expect = 3e-26,   Method: Compositional matrix adjust.
 Identities = 87/261 (33%), Positives = 134/261 (51%), Gaps = 27/261 (10%)

Query: 332 IMADEMGLGKTLQCIALMWTLLRQGPQGKRLIDKCIIVCPSSLVNNWANELIKWLGPNTL 391
           I+ADEMGLGKT+Q IAL+  +     +G  L+       P S ++NW NE  K+  P+  
Sbjct: 244 ILADEMGLGKTVQSIALLAFIYEMDTKGPFLV-----TAPLSTLDNWMNEFAKF-APDL- 296

Query: 392 TPLAVDGKKSSMGGGNTTVSQAIHAWAQAQGRNIVKPVLIISYETLRRNVDQLKNCNVGL 451
            P+    K     G     ++  + + Q  G  IV    I SYE + R+ D + + N   
Sbjct: 297 -PVL---KYYGTNGYKERSAKLKNFFKQHGGTGIV----ITSYEIILRDTDLIMSQNWKF 348

Query: 452 MLADEGHRLKNGDSLTFTALDSISCPRRVILSGTPIQNDLSEYFALLSFSNPGLLGSRAE 511
           ++ DEGHRLKN +      L  I+   R++L+GTP+QN+L+E ++LL+F  P +      
Sbjct: 349 LIVDEGHRLKNINCRLIKELKKINTSNRLLLTGTPLQNNLAELWSLLNFIMPDIFADFEI 408

Query: 512 FRKNFENPILR---GRDADATDKEITKGEAQLQK-----LSTIVSKFIIRRTND-ILAKY 562
           F K F+   L    G +++A +K I     +LQK     L TI+  F++RR    +LA  
Sbjct: 409 FNKWFDFDSLNLGSGSNSEALNKLIND---ELQKNLISNLHTILKPFLLRRLKKVVLANI 465

Query: 563 LPCKYEHVIFVNLKPLQNELY 583
           LP K E++I   +   Q + Y
Sbjct: 466 LPPKREYIINCPMTSAQEKFY 486

 Score =  114 bits (285), Expect = 1e-25,   Method: Compositional matrix adjust.
 Identities = 58/167 (34%), Positives = 92/167 (55%), Gaps = 1/167 (0%)

Query: 639 YNMPGSKARDVQTKYSAKFSILERFLHKIKTESDDKIVLISNYTQTLDLIEKMCRYKHYS 698
           Y  P     +   K S K  IL++ +  + +E   K+++ S +   LDLIE  C    ++
Sbjct: 587 YLHPEDLTLETLLKTSGKLQILQKLIPPLISEGH-KVLIYSQFVNMLDLIEDWCDLNSFA 645

Query: 699 AVRLDGTMSINKRQKLVDRFNDPEGQEFIFLLSSKAGGCGINLIGANRLILMDPDWNPAA 758
             R+DG+++   R+  +++FN  + +  IFLLS++A G GINL+GA+ ++L D DWNP  
Sbjct: 646 TFRIDGSVNNETRKDQLEKFNSSKDKHNIFLLSTRAAGLGINLVGADTVVLFDSDWNPQV 705

Query: 759 DQQALARVWRDGQKKDCFIYRFISTGTIEEKIFQRQSMKMSLSSCVV 805
           D QA+ R  R GQ+    +YR     TIE  I  R + K +L   V+
Sbjct: 706 DLQAMDRCHRIGQESPVIVYRLCCDNTIEHVILTRAANKRNLERMVI 752

>KLLA0E04048g 375999..378479 similar to sp|P43610 Saccharomyces
           cerevisiae YFR038w, start by similarity
          Length = 826

 Score =  115 bits (288), Expect = 4e-26,   Method: Compositional matrix adjust.
 Identities = 84/262 (32%), Positives = 133/262 (50%), Gaps = 21/262 (8%)

Query: 332 IMADEMGLGKTLQCIALMWTLLRQGPQGKRLIDKCIIVCPSSLVNNWANELIKWLGPNTL 391
           I+ADEMGLGKT+Q IAL+  +     +G  LI       P S V NW NE  ++  P+  
Sbjct: 219 ILADEMGLGKTIQSIALLAFIYEMDTKGPFLI-----AAPLSTVENWMNEFARF-APDI- 271

Query: 392 TPLAVDGKKSSMGGGNTTVSQAIHAW-AQAQGRNIVKPVLIISYETLRRNVDQLKNCNVG 450
            P+        +   N+    A HA   +    N  + V+I SYE + R+++ + +    
Sbjct: 272 -PV--------LKYYNSEGQAARHAMMGKFFKNNKGEGVIITSYEIIIRDIELILSYQWK 322

Query: 451 LMLADEGHRLKNGDSLTFTALDSISCPRRVILSGTPIQNDLSEYFALLSFSNPGLLGSRA 510
            ++ DEGHRLKN +      L  I+   R++L+GTP+QN+L E ++LL+F  P +     
Sbjct: 323 FLIVDEGHRLKNINCKLIRELKRINTSNRLLLTGTPLQNNLGELWSLLNFILPNIFSDFE 382

Query: 511 EFRKNFENPILRGRDADATDKEITKGEAQ---LQKLSTIVSKFIIRRT-NDILAKYLPCK 566
            F K F+   L    +     +I   E +   +  L TI+  F++RR   ++LA  LP K
Sbjct: 383 IFNKWFDFSDLNLESSSEKLTKIINDELEKNLISNLHTILKPFLLRRLKKNVLAGSLPPK 442

Query: 567 YEHVIFVNLKPLQNELYNKLIK 588
            E++I   + PLQ + Y + +K
Sbjct: 443 REYIITCPVTPLQKKYYKQALK 464

 Score =  104 bits (260), Expect = 1e-22,   Method: Compositional matrix adjust.
 Identities = 53/154 (34%), Positives = 84/154 (54%), Gaps = 1/154 (0%)

Query: 652 KYSAKFSILERFLHKIKTESDDKIVLISNYTQTLDLIEKMCRYKHYSAVRLDGTMSINKR 711
           K S K  +L++ + ++  +   K+++ S +   LDLIE      ++ + R+DG+M  N R
Sbjct: 569 KTSGKLQVLQKLVPEL-IKKKHKVLIFSQFVSMLDLIEDWSELNNFISCRIDGSMQNNSR 627

Query: 712 QKLVDRFNDPEGQEFIFLLSSKAGGCGINLIGANRLILMDPDWNPAADQQALARVWRDGQ 771
           ++ ++ F+    +  +FLLS++A G GINL  A+ +I+ D DWNP  D QA+ R  R GQ
Sbjct: 628 KEQIEEFSKKGSKANLFLLSTRAAGLGINLTAADSVIIFDSDWNPQVDLQAMDRAHRIGQ 687

Query: 772 KKDCFIYRFISTGTIEEKIFQRQSMKMSLSSCVV 805
            K   +YR     TIE  I  R   K  L   V+
Sbjct: 688 TKPVIVYRLYCDNTIENVIMTRAVNKRKLEKLVI 721

>YGL150C (INO80) [1838] chr7 complement(221107..225576) Member of the
            Snf2p-like family of probable DNA helicases [4470 bp,
            1489 aa]
          Length = 1489

 Score =  115 bits (289), Expect = 5e-26,   Method: Compositional matrix adjust.
 Identities = 61/156 (39%), Positives = 93/156 (59%), Gaps = 4/156 (2%)

Query: 654  SAKFSILERFLHKIKTESDDKIVLISNYTQTLDLIEKMCRYKHYSAVRLDGTMSINKRQK 713
            SAK   L+  L K+K+E   ++++    T+ +DL+E+   Y+ Y+ +RLDG+  +  R+ 
Sbjct: 1298 SAKLRKLDELLVKLKSEGH-RVLIYFQMTKMMDLMEEYLTYRQYNHIRLDGSSKLEDRRD 1356

Query: 714  LV-DRFNDPEGQEFIFLLSSKAGGCGINLIGANRLILMDPDWNPAADQQALARVWRDGQK 772
            LV D   +PE   F+FLLS++AGG GINL  A+ +I  D DWNP  D QA+ R  R GQ 
Sbjct: 1357 LVHDWQTNPEI--FVFLLSTRAGGLGINLTAADTVIFYDSDWNPTIDSQAMDRAHRLGQT 1414

Query: 773  KDCFIYRFISTGTIEEKIFQRQSMKMSLSSCVVDAK 808
            +   +YR +  GTIEE++  R   K  +   V++ K
Sbjct: 1415 RQVTVYRLLVRGTIEERMRDRAKQKEQVQQVVMEGK 1450

 Score =  108 bits (270), Expect = 9e-24,   Method: Compositional matrix adjust.
 Identities = 87/308 (28%), Positives = 142/308 (46%), Gaps = 42/308 (13%)

Query: 332  IMADEMGLGKTLQCIALMWTLLRQGPQGKRLIDKCIIVCPSSLVNNWANELIKWLGPNTL 391
            I+ADEMGLGKT+Q I+++  L     +   +    ++V P+S ++NW NE+ K+L    +
Sbjct: 728  ILADEMGLGKTVQSISVLAHL----AENHNIWGPFLVVTPASTLHNWVNEISKFLPQFKI 783

Query: 392  TPLAVDGKKSSMGGGNTTVSQAIHA-WAQAQGR---NIVKPVLIISYETLRRNVDQLKNC 447
             P            GN    + +   W +   R   N    V++ SY+ +  + + L+  
Sbjct: 784  LPY----------WGNANDRKVLRKFWDRKNLRYNKNAPFHVMVTSYQMVVTDANYLQKM 833

Query: 448  NVGLMLADEGHRLKNGDSLTFTALDSISCPRRVILSGTPIQNDLSEYFALLSFSNPGLLG 507
                M+ DE   +K+  S  +  L S  C  R++L+GTPIQN + E +ALL F  P L  
Sbjct: 834  KWQYMILDEAQAIKSSQSSRWKNLLSFHCRNRLLLTGTPIQNSMQELWALLHFIMPSLFD 893

Query: 508  SRAEFRKNFENPILRGRDADATDKEITK-GEAQLQKLSTIVSKFIIRRTNDILAKYLPCK 566
            S  EF + F   I    +A+      TK  + QL++L  I+  F++RR    +   L  K
Sbjct: 894  SHDEFNEWFSKDIESHAEAN------TKLNQQQLRRLHMILKPFMLRRVKKNVQSELGDK 947

Query: 567  YEHVIFVNLKPLQNELYNKLIKSR--------EXXXXXXXXXXSQP--------LRAIGI 610
             E  +  +L   Q +LY +++KS+        E          S          + A+  
Sbjct: 948  IEIDVLCDLTQRQAKLY-QVLKSQISTNYDAIENAATNDSTSNSASNSGSDQNLINAVMQ 1006

Query: 611  LKKLCNHP 618
             +K+CNHP
Sbjct: 1007 FRKVCNHP 1014

>KLLA0F21758g complement(2023805..2028523) similar to sp|Q05471
            Saccharomyces cerevisiae YDR334w SWR1 DEAH-box protein,
            putative RNA helicase, hypothetical start
          Length = 1572

 Score =  115 bits (289), Expect = 5e-26,   Method: Compositional matrix adjust.
 Identities = 62/171 (36%), Positives = 96/171 (56%), Gaps = 4/171 (2%)

Query: 655  AKFSILERFLHKIKTESDDKIVLISNYTQTLDLIEKMCRYKHYSAVRLDGTMSINKRQKL 714
             K   L + L  +K ++  + ++ +  T+ LD++E+   +  Y  +RLDG   I  RQ L
Sbjct: 1310 GKLQKLAQLLQNLK-DNGHRALIFTQMTKVLDILEQFLNFHGYLYMRLDGATKIEDRQIL 1368

Query: 715  VDRFN-DPEGQEFIFLLSSKAGGCGINLIGANRLILMDPDWNPAADQQALARVWRDGQKK 773
             +RFN DP     +F+LSS++GG GINL GA+ +I  D DWNPA D+Q   R  R GQ +
Sbjct: 1369 TERFNSDPRIT--VFILSSRSGGLGINLTGADTVIFYDSDWNPAMDKQCQDRCHRIGQTR 1426

Query: 774  DCFIYRFISTGTIEEKIFQRQSMKMSLSSCVVDAKEDVERLFSSDNLRQLF 824
            D  IYRF+S  TIE  I ++ + K  L + V+   +     F+  +++ L 
Sbjct: 1427 DVHIYRFVSDHTIESNILKKANQKRHLDNVVIQTGDFTTDYFTKLSVKDLL 1477

 Score =  110 bits (276), Expect = 2e-24,   Method: Compositional matrix adjust.
 Identities = 82/301 (27%), Positives = 141/301 (46%), Gaps = 36/301 (11%)

Query: 332  IMADEMGLGKTLQCIALMWTLLRQ----GPQGKRLIDKCIIVCPSSLVNNWANELIKWL- 386
            I+ADEMGLGKT+Q I+L+  L  +    GP         +IV P+S++ NW  E  ++  
Sbjct: 787  ILADEMGLGKTIQTISLLAYLACEKENWGPH--------LIVVPTSVLLNWEMEFKRFAP 838

Query: 387  GPNTLTPLAVDGKKSSMGGGNTTVSQAIHAWAQAQGRNIVKPVLIISYETLRRNVDQLKN 446
            G   LT      ++     G          W +    +    V I SY+ +  +    K 
Sbjct: 839  GFKVLTYYGSPQQRREKRKG----------WNKPDAFH----VCITSYQLVVHDQHSFKR 884

Query: 447  CNVGLMLADEGHRLKNGDSLTFTALDSISCPRRVILSGTPIQNDLSEYFALLSFSNP--- 503
                 M+ DE H +KN  S  + AL + +  RR++L+GTP+QN+L+E ++LL F  P   
Sbjct: 885  KKWQYMILDEAHNIKNFRSTRWQALLNFNTERRLLLTGTPLQNNLAELWSLLYFLMPQTA 944

Query: 504  ---GLLGSRAE---FRKNFENPILRGRDADATDKEITKGEAQLQKLSTIVSKFIIRRTND 557
               G +   A+   F++ F  P+ +  +     ++  + +  + KL  ++  +++RR   
Sbjct: 945  LENGKVSGFADLDAFQQWFGRPVDKIVETGENYEQDEETKKTVSKLHQVLRPYLLRRLKA 1004

Query: 558  ILAKYLPCKYEHVIFVNLKPLQNELYNKLIKSREXXXXXXXXXXSQPLRAIGILKKLCNH 617
             + K +P KYEH+I+  L   Q  LY+  +   +             +  +  L+K+CNH
Sbjct: 1005 DVEKQMPGKYEHIIYCRLSKRQRFLYDDFMSRAQTKETLASGNFMSIINCLMQLRKVCNH 1064

Query: 618  P 618
            P
Sbjct: 1065 P 1065

>CAGL0J02662g 261909..264443 similar to sp|P43610 Saccharomyces
           cerevisiae YFR038w, hypothetical start
          Length = 844

 Score =  114 bits (285), Expect = 9e-26,   Method: Compositional matrix adjust.
 Identities = 80/256 (31%), Positives = 128/256 (50%), Gaps = 19/256 (7%)

Query: 332 IMADEMGLGKTLQCIALMWTLLRQGPQGKRLIDKCIIVCPSSLVNNWANELIKWLGPNTL 391
           I+ADEMGLGKT+Q IAL+  +     +G  LI       P S V+NW NE  K+  P   
Sbjct: 241 ILADEMGLGKTIQSIALLSFIYEMDTKGPFLI-----AAPLSTVDNWMNEFAKF-APEI- 293

Query: 392 TPLAVDGKKSSMGGGNTTVSQAIHAWAQAQGRNIVKPVLIISYETLRRNVDQLKNCNVGL 451
            P+     K     G     + +  + +   R   + V++ SYE + R+ + +       
Sbjct: 294 -PIL----KYYSQNGQDARQKLLKKFFKNNNR---EGVIVTSYEMIIRDANIIMGEQWKF 345

Query: 452 MLADEGHRLKNGDSLTFTALDSISCPRRVILSGTPIQNDLSEYFALLSFSNPGLLGSRAE 511
           ++ DEGHRLKN +      L  I+   R++L+GTP+QN+LSE ++LL+F  P +      
Sbjct: 346 LIVDEGHRLKNINCRLIQELKRINTSNRLLLTGTPLQNNLSELWSLLNFILPDIFADFEI 405

Query: 512 FRKNFENPILRGRDADATDKEITKGEAQ---LQKLSTIVSKFIIRRTNDILAK-YLPCKY 567
           F K F+   L  +   A   ++   E +   +  L TI+  F++RR   ++ K  LP K 
Sbjct: 406 FNKWFDFKDLDLQSNSAKLNKLINDELEKNLISNLHTILKPFLLRRLKSVVLKDVLPPKR 465

Query: 568 EHVIFVNLKPLQNELY 583
           E+++   L P+Q + Y
Sbjct: 466 EYIVNCPLSPIQTKFY 481

 Score =  104 bits (260), Expect = 9e-23,   Method: Compositional matrix adjust.
 Identities = 51/132 (38%), Positives = 73/132 (55%)

Query: 674 KIVLISNYTQTLDLIEKMCRYKHYSAVRLDGTMSINKRQKLVDRFNDPEGQEFIFLLSSK 733
           KI++ S +   LDL+E       ++++R+DG +    R++ +D FN       IFLLS++
Sbjct: 613 KILIFSQFVGMLDLLEDWSELNSFNSLRIDGGVDNESRKEYIDEFNKKGDDHQIFLLSTR 672

Query: 734 AGGCGINLIGANRLILMDPDWNPAADQQALARVWRDGQKKDCFIYRFISTGTIEEKIFQR 793
           A G GINL+ A+ +I+ D DWNP  D QA+ R  R GQ K   +YRF    TIE  I  R
Sbjct: 673 AAGLGINLVAADTVIIFDSDWNPQVDLQAMDRCHRIGQTKPVIVYRFCCDNTIEHVILTR 732

Query: 794 QSMKMSLSSCVV 805
              K  L   V+
Sbjct: 733 AVNKRKLERMVI 744

>Kwal_55.20143
          Length = 1494

 Score =  115 bits (287), Expect = 1e-25,   Method: Compositional matrix adjust.
 Identities = 60/154 (38%), Positives = 91/154 (59%), Gaps = 6/154 (3%)

Query: 674  KIVLISNYTQTLDLIEKMCRYKHYSAVRLDGTMSINKRQKLVDRFNDPEGQEFIFLLSSK 733
            + ++ +  T+ LD++E+   Y  Y  +RLDG   I +RQ L +RFN  + +   F+LSS+
Sbjct: 1235 RALIFTQMTKVLDVLEQFLNYHGYLYMRLDGATKIEERQILTERFN-TDNRITAFILSSR 1293

Query: 734  AGGCGINLIGANRLILMDPDWNPAADQQALARVWRDGQKKDCFIYRFISTGTIEEKIFQR 793
            +GG GINL GA+ +I  D DWNPA D+Q   R  R GQ +D  IYRF+S  TIE  I ++
Sbjct: 1294 SGGLGINLTGADTVIFYDSDWNPAMDKQCQDRCHRIGQTRDVHIYRFVSEHTIESNILKK 1353

Query: 794  QSMKMSLSSCVVDAKEDVERLFSSDNLRQLFQKN 827
             + K  L + V+   +     F++D L +L  K+
Sbjct: 1354 ANQKRQLDNVVIQRGD-----FTTDYLTKLSVKD 1382

 Score =  113 bits (282), Expect = 4e-25,   Method: Compositional matrix adjust.
 Identities = 87/305 (28%), Positives = 141/305 (46%), Gaps = 44/305 (14%)

Query: 332 IMADEMGLGKTLQCIALMWTLLRQ----GPQGKRLIDKCIIVCPSSLVNNWANELIKWL- 386
           I+ADEMGLGKT+Q I+L+  L  +    GP         +I+ P+S++ NW  E  ++  
Sbjct: 693 ILADEMGLGKTIQTISLLAYLACEKHNWGPH--------LIIVPTSVLLNWEMEFKRFAP 744

Query: 387 GPNTLTPLAV-DGKKSSMGGGNTTVSQAIHAWAQAQGRNIVKPVLIISYETLRRNVDQLK 445
           G   LT       +K    G N     A H             V I SY+ +  +    K
Sbjct: 745 GFKVLTYYGSPQQRKEKRKGWNR--PDAFH-------------VCITSYQLVVHDQHSFK 789

Query: 446 NCNVGLMLADEGHRLKNGDSLTFTALDSISCPRRVILSGTPIQNDLSEYFALLSFSNPGL 505
                 M+ DE H +KN  S  + AL + +  RR++L+GTP+QN+L+E ++LL F  P  
Sbjct: 790 RKKWQYMILDEAHNIKNFRSTRWQALLNFNTERRLLLTGTPLQNNLAELWSLLYFLMPQT 849

Query: 506 LGSRA---------EFRKNFENP---ILRGRDADATDKEITKGEAQLQKLSTIVSKFIIR 553
            G+            F++ F  P   I++  +  A D+E  K    + KL  ++  +++R
Sbjct: 850 AGTNGGIQGFADLEAFQQWFGRPVDKIIQTGEGYAQDEETRKT---VTKLHQVLRPYLLR 906

Query: 554 RTNDILAKYLPCKYEHVIFVNLKPLQNELYNKLIKSREXXXXXXXXXXSQPLRAIGILKK 613
           R    + K +P K+EHV++  L   Q  LY+  +   +             +  +  L+K
Sbjct: 907 RLKADVEKQMPAKHEHVVYCRLSKRQRFLYDDFMSRAQTKETLSSGNFMSIINCLMQLRK 966

Query: 614 LCNHP 618
           +CNHP
Sbjct: 967 VCNHP 971

>YAL019W (FUN30) [49] chr1 (114922..118317) Member of the Snf2p family
            of DNA-dependent ATPases, involved in resistance to UV
            radiation [3396 bp, 1131 aa]
          Length = 1131

 Score =  114 bits (284), Expect = 2e-25,   Method: Compositional matrix adjust.
 Identities = 63/163 (38%), Positives = 97/163 (59%), Gaps = 1/163 (0%)

Query: 654  SAKFSILERFLHKIKTESDDKIVLISNYTQTLDLIEKMCRYKHYSAVRLDGTMSINKRQK 713
            S K   L++ L  I  +  +K+++ S +TQ LD++E +     Y  +RLDG+  +N RQ 
Sbjct: 948  SGKIDALKKLLKTIIVDKQEKVLIFSLFTQVLDILEMVLSTLDYKFLRLDGSTQVNDRQL 1007

Query: 714  LVDRFNDPEGQEFIFLLSSKAGGCGINLIGANRLILMDPDWNPAADQQALARVWRDGQKK 773
            L+D+F + +    IF+LS+KAGG GINL+ AN +I+ D  +NP  D+QA  R  R GQ K
Sbjct: 1008 LIDKFYEDKDIP-IFILSTKAGGFGINLVCANNVIIFDQSFNPHDDRQAADRAHRVGQTK 1066

Query: 774  DCFIYRFISTGTIEEKIFQRQSMKMSLSSCVVDAKEDVERLFS 816
            +  I   I+  +IEEKI Q    K++L S + + K+  + L S
Sbjct: 1067 EVNITTLITKDSIEEKIHQLAKNKLALDSYISEDKKSQDVLES 1109

 Score =  112 bits (281), Expect = 3e-25,   Method: Compositional matrix adjust.
 Identities = 88/290 (30%), Positives = 137/290 (47%), Gaps = 28/290 (9%)

Query: 308 LKSDEKALTESQKTEQN-----NRGAYGCIMADEMGLGKTLQCIALMWTLLRQGPQGKRL 362
           L S E +L + Q+T  N      +    CI+AD+MGLGKT Q I+    L +    G  L
Sbjct: 565 LLSPEISLKDYQQTGINWLNLLYQNKMSCILADDMGLGKTCQVISFFAYLKQINEPGPHL 624

Query: 363 IDKCIIVCPSSLVNNWANELIKWLGPNTLTPLAVDGKKSSMGGGNTTVSQAIHAWAQAQG 422
           +     V PSS + NW  E  K+     + P            G+    + +    +   
Sbjct: 625 V-----VVPSSTLENWLREFQKFAPALKIEPYY----------GSLQEREELRDILE--- 666

Query: 423 RNIVKPVLIISYETL----RRNVDQLKNCNVGLMLADEGHRLKNGDSLTFTALDSISCPR 478
           RN  K  +I++   L    + +V  LKN N  +++ DEGH LKN  S  F  L  I    
Sbjct: 667 RNAGKYDVIVTTYNLAAGNKYDVSFLKNRNFNVVVYDEGHMLKNSTSERFAKLMKIRANF 726

Query: 479 RVILSGTPIQNDLSEYFALLSFSNPGLLGSRAEFRKNFENPILRGRDADATDKEITKGEA 538
           R++L+GTP+QN+L E  +LL F  P L  S+ E          +  D +     +   EA
Sbjct: 727 RLLLTGTPLQNNLKELMSLLEFIMPNLFISKKESFDAIFKQRAKTTDDNKNHNPLLAQEA 786

Query: 539 QLQKLSTIVSKFIIRRTNDILAKYLPCKYEHVIFVNLKPLQNELYNKLIK 588
            + +  T++  FI+RR  D + K+LP K+ H+ +  L  +Q ++Y+K I+
Sbjct: 787 -ITRAKTMMKPFILRRRKDQVLKHLPPKHTHIQYCELNAIQKKIYDKEIQ 835

>Kwal_26.7123
          Length = 1081

 Score =  113 bits (283), Expect = 2e-25,   Method: Compositional matrix adjust.
 Identities = 85/278 (30%), Positives = 131/278 (47%), Gaps = 45/278 (16%)

Query: 326 RGAYGCIMADEMGLGKTLQCIALMWTLLRQGPQGKRLIDKCIIVCPSSLVNNWANELIKW 385
           R    CI+ADEMGLGKT Q IA +  L +    G  L+     V PSS + NW  E  K+
Sbjct: 540 RNNLSCILADEMGLGKTCQVIAFLSYLKQNNEPGPHLV-----VVPSSTLENWLREFNKF 594

Query: 386 LGPNTLTPLAVDGKKSSMGGGNTTVSQAIHAWAQAQGRNIVKP------VLIISYETLRR 439
                + P     ++                  +A+ R+I++       V++ +Y     
Sbjct: 595 CPDLKIEPYYGSQQE------------------RAELRDILEDNDGQYDVIVTTYNLASG 636

Query: 440 N---VDQLKNCNVGLMLADEGHRLKNGDSLTFTALDSISCPRRVILSGTPIQNDLSEYFA 496
           N   V  LKN    +++ DEGH LKN  S  FT L  I    R++L+GTP+QN+L E  +
Sbjct: 637 NKYDVSFLKNRGFNVVVYDEGHMLKNSMSERFTKLMKIEANFRLLLTGTPLQNNLKELMS 696

Query: 497 LLSFSNPGLLGSR-----AEFRKNFENPILRGRDADAT-DKEITKGEAQLQKLSTIVSKF 550
           LL F  P L  S+     A FR+       R R +D+  D      +  + +  T++  F
Sbjct: 697 LLEFIMPNLFISKKNDLSAVFRQ-------RARTSDSNKDYNPLLAQEAIARAKTMMKPF 749

Query: 551 IIRRTNDILAKYLPCKYEHVIFVNLKPLQNELYNKLIK 588
           I+RR  D + K+LP K+  + +  +  +Q  +YN+ I+
Sbjct: 750 ILRRRKDQVLKHLPHKHSKIEYCEMSDVQRTIYNREIQ 787

 Score =  110 bits (274), Expect = 2e-24,   Method: Compositional matrix adjust.
 Identities = 58/151 (38%), Positives = 90/151 (59%), Gaps = 1/151 (0%)

Query: 654  SAKFSILERFLHKIKTESDDKIVLISNYTQTLDLIEKMCRYKHYSAVRLDGTMSINKRQK 713
            S K + L + L  I     +K+++ S +TQ LD++E      + + +RLDG+  +N RQ 
Sbjct: 904  SGKITALRKILENIIEHKKEKVLVFSLFTQMLDILEMALTTLNINFLRLDGSTQVNDRQA 963

Query: 714  LVDRFNDPEGQEFIFLLSSKAGGCGINLIGANRLILMDPDWNPAADQQALARVWRDGQKK 773
            L+D+F+D +    +F+LS+KAGG GINL+ AN +I+ D  +NP  D+QA  R  R GQ K
Sbjct: 964  LIDKFHDDDTIP-VFILSTKAGGFGINLVCANNVIIFDQSFNPHDDKQAADRSHRVGQTK 1022

Query: 774  DCFIYRFISTGTIEEKIFQRQSMKMSLSSCV 804
               I   I+  +IEEKI Q    K++L + +
Sbjct: 1023 TVHITTLITRNSIEEKILQLAKNKLALDTYI 1053

>AGR379W [4690] [Homologous to ScYGL150C (INO80) - SH]
            complement(1426843..1431087) [4245 bp, 1414 aa]
          Length = 1414

 Score =  114 bits (284), Expect = 2e-25,   Method: Compositional matrix adjust.
 Identities = 59/155 (38%), Positives = 89/155 (57%), Gaps = 2/155 (1%)

Query: 654  SAKFSILERFLHKIKTESDDKIVLISNYTQTLDLIEKMCRYKHYSAVRLDGTMSINKRQK 713
            SAK   L+  L ++K   + ++++    T+ +DLIE+   Y+ Y  +RLDG+  +  R+ 
Sbjct: 1239 SAKLKKLDELLVRLKA-GEHRVLIYFQMTRMMDLIEEYLTYRQYKHIRLDGSSKLEDRRD 1297

Query: 714  LVDRFNDPEGQEFIFLLSSKAGGCGINLIGANRLILMDPDWNPAADQQALARVWRDGQKK 773
            LV  +   +   FIFLLS++AGG GINL  A+ +I  D DWNP  D QA+ R  R GQ K
Sbjct: 1298 LVHDWQ-TKSDIFIFLLSTRAGGLGINLTSADTVIFYDSDWNPTIDSQAMDRAHRLGQTK 1356

Query: 774  DCFIYRFISTGTIEEKIFQRQSMKMSLSSCVVDAK 808
               +YR +  GTIEE++  R   K  +   V++ K
Sbjct: 1357 QVTVYRLLIKGTIEERMRDRAKQKEHVQQVVMEGK 1391

 Score =  102 bits (254), Expect = 7e-22,   Method: Compositional matrix adjust.
 Identities = 87/312 (27%), Positives = 138/312 (44%), Gaps = 50/312 (16%)

Query: 332 IMADEMGLGKTLQCIALMWTLLRQ----GPQGKRLIDKCIIVCPSSLVNNWANELIKWLG 387
           I+ADEMGLGKT+Q I+++  L  +    GP         I+V P+S ++NW NE+ K++ 
Sbjct: 677 ILADEMGLGKTVQSISVLAHLAERYNIWGP--------FIVVTPASTLHNWVNEIQKFVP 728

Query: 388 PNTLTPLAVDGKKSSMGGGNTTVSQAI--HAWAQAQGR---NIVKPVLIISYETLRRNVD 442
              + P          G GN    + I    W +   R   +    V+I SY+ +  +  
Sbjct: 729 DFKILPY--------WGNGN---DRKILRRFWDRKHLRYSKDAPFHVMITSYQMIVSDAA 777

Query: 443 QLKNCNVGLMLADEGHRLKNGDSLTFTALDSISCPRRVILSGTPIQNDLSEYFALLSFSN 502
            L+      M+ DE   +K+  S  +  L S  C  R++L+GTPIQN + E +ALL F  
Sbjct: 778 YLQKMKWQYMILDEAQAIKSSQSSRWKNLLSFHCRNRLLLTGTPIQNSMQELWALLHFIM 837

Query: 503 PGLLGSRAEFRKNFENPILRGRDADATDKEITK-GEAQLQKLSTIVSKFIIRRTNDILAK 561
           P L  S  EF   F       +D ++  +  T+  + QL++L  I+  F++RR    +  
Sbjct: 838 PSLFDSHDEFNDWF------SKDIESHAQSNTQLNQQQLRRLHMILKPFMLRRIKKNVQS 891

Query: 562 YLPCKYEHVIFVNLKPLQNELY---------------NKLIKSREXXXXXXXXXXSQPLR 606
            L  K E  +  +L   Q +LY               N    S            S+ + 
Sbjct: 892 ELGDKIEIDVMCDLTHRQAKLYQVLKSQVSASYDAIENAASNSSGDDSGNMSLSDSKIMN 951

Query: 607 AIGILKKLCNHP 618
            +   +K+CNHP
Sbjct: 952 TVMEFRKVCNHP 963

>Kwal_47.18077
          Length = 809

 Score =  113 bits (282), Expect = 2e-25,   Method: Compositional matrix adjust.
 Identities = 60/164 (36%), Positives = 85/164 (51%), Gaps = 1/164 (0%)

Query: 642 PGSKARDVQTKYSAKFSILERFLHKIKTESDDKIVLISNYTQTLDLIEKMCRYKHYSAVR 701
           P     D   + S K  IL++ +  +  +   K+++ + +   LDLIE  C        R
Sbjct: 542 PEKLTLDFLLQSSGKLQILQQLVPPL-IKKGHKVLIFTQFVGMLDLIEDWCELNDVRVCR 600

Query: 702 LDGTMSINKRQKLVDRFNDPEGQEFIFLLSSKAGGCGINLIGANRLILMDPDWNPAADQQ 761
           +DG+M    RQ+ ++RFNDP+     FL+S++AGG GINL  A+ +IL D DWNP  D Q
Sbjct: 601 IDGSMGNETRQEHIERFNDPDDSFDAFLISTRAGGLGINLTAADSVILFDSDWNPQVDLQ 660

Query: 762 ALARVWRDGQKKDCFIYRFISTGTIEEKIFQRQSMKMSLSSCVV 805
           A  R  R GQ K   +YR     TIE  I  R + K  L   V+
Sbjct: 661 ATDRTHRIGQTKPVIVYRLCCDNTIEHVILTRAASKRKLEKMVI 704

 Score =  103 bits (256), Expect = 3e-22,   Method: Compositional matrix adjust.
 Identities = 76/256 (29%), Positives = 124/256 (48%), Gaps = 19/256 (7%)

Query: 332 IMADEMGLGKTLQCIALMWTLLRQGPQGKRLIDKCIIVCPSSLVNNWANELIKWLGPNTL 391
           I+ADEMGLGKTLQ IAL+  +      G  LI       P S ++ W NE  ++      
Sbjct: 202 ILADEMGLGKTLQSIALLAFITEMDTGGPFLI-----AAPLSTLDTWVNEFSRF------ 250

Query: 392 TPLAVDGKKSSMGGGNTTVSQAIHAWAQAQGRNIVKPVLIISYETLRRNVDQLKNCNVGL 451
            P     K  S  G +   S     +   +G+ +V    I SYE + R+++ + +     
Sbjct: 251 APDIQVLKYYSTQGQSYRQSLLKKFFKSTKGQGVV----ITSYEIIIRDIELILSYQWKF 306

Query: 452 MLADEGHRLKNGDSLTFTALDSISCPRRVILSGTPIQNDLSEYFALLSFSNPGLLGSRAE 511
           ++ DEGHR+KN +      L  I+   R++++GT +QN+LSE ++LL+F  P +      
Sbjct: 307 LIVDEGHRIKNINCKLIRELKRINTLNRLLITGTALQNNLSELWSLLNFIMPDIFADFEI 366

Query: 512 FRKNFENPILRGRDADATDKEITKGEAQ---LQKLSTIVSKFIIRRTND-ILAKYLPCKY 567
           F K F+   L  + +      +   E +   +  L  I+  F++RR    +LA  LP K 
Sbjct: 367 FHKWFDFSDLELKSSSQGLNRLINDELEKNLISNLHAILKPFLLRRLKKVVLAGSLPPKR 426

Query: 568 EHVIFVNLKPLQNELY 583
           E+++   L  +Q +LY
Sbjct: 427 EYIVNCPLTSVQKKLY 442

>Scas_669.20
          Length = 1397

 Score =  112 bits (281), Expect = 4e-25,   Method: Compositional matrix adjust.
 Identities = 60/156 (38%), Positives = 91/156 (58%), Gaps = 4/156 (2%)

Query: 654  SAKFSILERFLHKIKTESDDKIVLISNYTQTLDLIEKMCRYKHYSAVRLDGTMSINKRQK 713
            SAK   L+  L ++K E   ++++    T+ +DL+E+   Y+ Y+ +RLDG+  +  R+ 
Sbjct: 1219 SAKLKKLDELLVQLKREGH-RVLIYFQMTKMMDLMEEYLTYRQYNHIRLDGSSKLEDRRD 1277

Query: 714  LV-DRFNDPEGQEFIFLLSSKAGGCGINLIGANRLILMDPDWNPAADQQALARVWRDGQK 772
            LV D    PE   F+FLLS++AGG GINL  A+ +I  D DWNP  D QA+ R  R GQ 
Sbjct: 1278 LVHDWQTKPEI--FVFLLSTRAGGLGINLTAADTVIFYDSDWNPTIDSQAMDRAHRLGQT 1335

Query: 773  KDCFIYRFISTGTIEEKIFQRQSMKMSLSSCVVDAK 808
            +   +YR +  GTIEE++  R   K  +   V++ K
Sbjct: 1336 RQVTVYRLLIRGTIEERMRDRAKQKEQVQQVVMEGK 1371

 Score =  112 bits (279), Expect = 8e-25,   Method: Compositional matrix adjust.
 Identities = 96/377 (25%), Positives = 163/377 (43%), Gaps = 42/377 (11%)

Query: 332  IMADEMGLGKTLQCIALMWTLLRQGPQGKRLIDKCIIVCPSSLVNNWANELIKWLGPNTL 391
            I+ADEMGLGKT+Q I+++  L     +   +    ++V P+S ++NW NE+ K++    +
Sbjct: 667  ILADEMGLGKTVQSISVLAHL----AEKHNIWGPYLVVTPASTLHNWVNEITKFVPQFKI 722

Query: 392  TPLAVDGKKSSMGGGNTTVSQAIHAWAQAQGRNIVKP----VLIISYETLRRNVDQLKNC 447
             P            GN    + +  +   +     K     V+I SY+ +  +V  L+  
Sbjct: 723  LPY----------WGNAADRKVLRKFWDRKNLRYTKDSPFHVMITSYQMVVSDVTYLQKM 772

Query: 448  NVGLMLADEGHRLKNGDSLTFTALDSISCPRRVILSGTPIQNDLSEYFALLSFSNPGLLG 507
                M+ DE   +K+  S  +  L S  C  R++L+GTPIQN++ E +ALL F  P L  
Sbjct: 773  KWQYMILDEAQAIKSSQSSRWKNLLSFHCRNRLLLTGTPIQNNMQELWALLHFIMPSLFD 832

Query: 508  SRAEFRKNFENPILRGRDADATDKEITKGEAQLQKLSTIVSKFIIRRTNDILAKYLPCKY 567
            S  EF + F   I    +A+           QL++L  I+  F++RR    +   L  K 
Sbjct: 833  SHDEFSEWFAKDIESHAEANT-----QLNHQQLRRLHMILKPFMLRRVKKNVQSELGDKI 887

Query: 568  EHVIFVNLKPLQNELYNKLIKSREXXXXXXXXXXSQPLRA-------IGILKKLCNHPXX 620
            E  +  +L   Q +LY +++KS            S    +       +   +K+CNHP  
Sbjct: 888  EIDVLCDLTQRQAKLY-QVLKSTSNYDAIENAAGSDEFSSDQNLVNTVMQFRKVCNHPDL 946

Query: 621  XXXXXXXXXXXXXXXXXXYNMPGSKARDVQTKYSAKFSI---LERFLHKIKTESDDKIVL 677
                               ++  S   D    YS+K  I   L R ++      DD  ++
Sbjct: 947  FERADINSPFAFTKFGKTSSILRSSDNDTDVFYSSKNPIEFHLPRLIY------DD--LI 998

Query: 678  ISNYTQTLDLIEKMCRY 694
            + N+  ++D + K+  Y
Sbjct: 999  LPNFENSVDTMAKLLNY 1015

>Kwal_27.11388
          Length = 1334

 Score =  112 bits (280), Expect = 5e-25,   Method: Compositional matrix adjust.
 Identities = 88/302 (29%), Positives = 145/302 (48%), Gaps = 37/302 (12%)

Query: 332 IMADEMGLGKTLQCIALMWTLLRQGPQGKRLIDKCIIVCPSSLVNNWANELIKWLGPNTL 391
           I+ADEMGLGKT+Q I+++  L     +   +    I+V P+S ++NW NE+ K+L    +
Sbjct: 616 ILADEMGLGKTVQSISVLAHL----AENYNIWGPFIVVTPASTLHNWVNEISKFLPDFKI 671

Query: 392 TPLAVDGKKSSMGGGNTTVSQAI--HAWAQAQ---GRNIVKPVLIISYETLRRNVDQLKN 446
            P          G GN    + I    W + Q   G++    V++ SY+ +  +   L+ 
Sbjct: 672 LPY--------WGNGN---DRKILRRFWDRKQFRYGKDAPFHVMVTSYQMVVSDAAYLQK 720

Query: 447 CNVGLMLADEGHRLKNGDSLTFTALDSISCPRRVILSGTPIQNDLSEYFALLSFSNPGLL 506
                M+ DE   +K+  S  +  L S  C  R++L+GTPIQN++ E +ALL F  P L 
Sbjct: 721 MKWQYMILDEAQAIKSSQSSRWKNLLSFHCRNRLLLTGTPIQNNMQELWALLHFIMPSLF 780

Query: 507 GSRAEFRKNFENPILRGRDADATDKEITK-GEAQLQKLSTIVSKFIIRRTNDILAKYLPC 565
            S  EF   F       +D ++  +  TK  + QL++L  I+  F++RR    +   L  
Sbjct: 781 DSHDEFSDWF------SKDIESHAQSNTKLNQQQLRRLHMILKPFMLRRIKKNVQSELGE 834

Query: 566 KYEHVIFVNLKPLQNELYNKLIKSR--------EXXXXXXXXXXSQPL-RAIGILKKLCN 616
           K E  +  +L   Q++LY +++KS+        E           Q +   +   +K+CN
Sbjct: 835 KIEIDVMCDLTRRQHKLY-QVLKSQMSAAYDAIENAAGSDEASSDQNIVNTVMQFRKVCN 893

Query: 617 HP 618
           HP
Sbjct: 894 HP 895

 Score =  110 bits (275), Expect = 2e-24,   Method: Compositional matrix adjust.
 Identities = 61/165 (36%), Positives = 96/165 (58%), Gaps = 7/165 (4%)

Query: 654  SAKFSILERFLHKIKTESDDKIVLISNYTQTLDLIEKMCRYKHYSAVRLDGTMSINKRQK 713
            S K   L+  L  +K ++D ++++    T+ +DL+E+   ++ Y  +RLDG+  +  R+ 
Sbjct: 1169 STKLKKLDELLVNLK-KNDHRVLIYFQMTKMMDLMEEYLSFRQYKHIRLDGSSKLEDRRD 1227

Query: 714  LV-DRFNDPEGQEFIFLLSSKAGGCGINLIGANRLILMDPDWNPAADQQALARVWRDGQK 772
            LV D    PE   FIFLLS++AGG GINL  A+ +I  D DWNP  D QA+ R  R GQ 
Sbjct: 1228 LVHDWQTKPEI--FIFLLSTRAGGLGINLTAADTVIFYDSDWNPTIDSQAMDRAHRLGQT 1285

Query: 773  KDCFIYRFISTGTIEEKIFQRQSMKMSLSSCVVDAK---EDVERL 814
            +   +YR +  GTIEE++  R   K  +   V++ K   +D+++L
Sbjct: 1286 RQVTVYRLLIRGTIEERMRDRAKQKEQVQQVVMEGKTQEKDIQQL 1330

>AAR147W [335] [Homologous to ScYOR191W (RIS1) - SH]
            complement(608865..613607) [4743 bp, 1580 aa]
          Length = 1580

 Score = 97.8 bits (242), Expect = 2e-20,   Method: Compositional matrix adjust.
 Identities = 52/147 (35%), Positives = 90/147 (61%), Gaps = 4/147 (2%)

Query: 671  SDDKIVLISNYTQTLDLIEKMCR-YKHYSAVRLDGTMSINKRQKLVDRFNDPEGQEFIFL 729
            +D+K+++ S +T   D+++   +   + S +R DGTM+ N R  +++RF   E  E + L
Sbjct: 1417 TDEKLIVFSQFTTFFDILQFFIKKVLNVSYLRYDGTMNGNVRASVIERFYR-EKNERLLL 1475

Query: 730  LSSKAGGCGINLIGANRLILMDPDWNPAADQQALARVWRDGQKKDCFIYRFISTGTIEEK 789
            +S KAG  G+ L  AN +IL+DP WNP  ++QA+ R +R  Q+++ +I+R +   TIE++
Sbjct: 1476 ISMKAGNSGLTLTCANHVILVDPFWNPYVEEQAMDRCYRISQQREVYIHRLLLKNTIEDR 1535

Query: 790  IFQRQSMKMSLSSCVVDAKE--DVERL 814
            I + Q+ K +L    +D  E  +V RL
Sbjct: 1536 IVELQNRKRTLVENAMDPTELREVNRL 1562

 Score = 63.5 bits (153), Expect = 7e-10,   Method: Compositional matrix adjust.
 Identities = 62/266 (23%), Positives = 109/266 (40%), Gaps = 62/266 (23%)

Query: 330  GCIMADEMGLGKTLQCIALMWTLLRQGPQGKRLIDKCIIVCPSSLVNNWANELIKWLGPN 389
            G ++AD+MGLGKT+Q IALM                 ++V P +++  W +E+   +   
Sbjct: 917  GGLLADDMGLGKTVQAIALMLA----NRSADSTCKTNLVVGPVAVLRVWHDEINTKVKKQ 972

Query: 390  TLTPLAVDGKKSSMGGGNTTVSQAIHAWAQAQGRNIVKPVLIISYETLR----------- 438
                + + G     GG      +A+H +           V+++SY+TL            
Sbjct: 973  AQFSVMIYG---GFGGKKVENFKAMHNY----------DVVLVSYQTLAVEFKKHWPARL 1019

Query: 439  ------------------RNVDQLKN----------CNVGLMLADEGHRLKNGDSLTFTA 470
                               N  +L+N           N   ++ DE   +KN  +    A
Sbjct: 1020 QGTSENGGQLPEVASIKAMNSMKLRNEYWSPFFSDDSNFYRIILDEAQNIKNKQTQAAKA 1079

Query: 471  LDSISCPRRVILSGTPIQNDLSEYFALLSFSNPGLLGSRAEFRKNFENPIL-RGRDADAT 529
              +++   R  LSGTPIQN++ E ++LL F          +F+++  N +L RG D D+ 
Sbjct: 1080 CCTLNGTYRWALSGTPIQNNILELYSLLRFLRIAPYNREQKFKEDIGNALLSRGGDFDSM 1139

Query: 530  DKEITKGEAQLQKLSTIVSKFIIRRT 555
            D      +  L+K+  ++   ++RR 
Sbjct: 1140 DT-----KRALKKVRVLLRAIMLRRA 1160

>AFR220W [3412] [Homologous to ScYLR032W (RAD5) - SH]
            complement(830240..833497) [3258 bp, 1085 aa]
          Length = 1085

 Score = 94.4 bits (233), Expect = 2e-19,   Method: Compositional matrix adjust.
 Identities = 56/160 (35%), Positives = 88/160 (55%), Gaps = 6/160 (3%)

Query: 651  TKYSAKFSILERFL-HKIKTESDDKIVLISNYTQTLDLIEKMCRYKHYSAV----RLDGT 705
            TK S+K   L R L H   T +++++V+ S ++  LD++E   R    S +    + DG 
Sbjct: 906  TKKSSKIVALIRHLKHLQDTSANEQVVVFSQFSSYLDILENELRQSFASDICEIYKFDGR 965

Query: 706  MSINKRQKLVDRFNDPEGQEF-IFLLSSKAGGCGINLIGANRLILMDPDWNPAADQQALA 764
            + + +R  ++ +F +    +  + LLS KAGG G+NL  A+   +MDP W+P  + QA+ 
Sbjct: 966  LDLKERSNVLAKFTEKSLVKMKVLLLSLKAGGVGLNLTCASHAFIMDPWWSPGMEDQAMD 1025

Query: 765  RVWRDGQKKDCFIYRFISTGTIEEKIFQRQSMKMSLSSCV 804
            R+ R GQ     IYRFI   +IEEK+ + Q  K SL   V
Sbjct: 1026 RIHRIGQSNTVKIYRFIVENSIEEKMLRIQEKKRSLGEFV 1065

 Score = 61.2 bits (147), Expect = 3e-09,   Method: Compositional matrix adjust.
 Identities = 53/214 (24%), Positives = 92/214 (42%), Gaps = 59/214 (27%)

Query: 330 GCIMADEMGLGKTLQCIAL-----------MWTLLRQGPQGKRLID------------KC 366
           G I+ADEMGLGKT+  +AL           + T   + P G   ++              
Sbjct: 455 GGILADEMGLGKTISILALITMVPSDTKHLLTTAQEKPPVGHLSLELGISTVKPYTASTT 514

Query: 367 IIVCPSSLVNNWANELIKWLGPNTLTPLAVDGKKSSMGGGNTTVSQAIHAWAQAQGRNIV 426
           +IV P SL+  W NE ++                  +  GN    +  +A   +  R ++
Sbjct: 515 LIVVPMSLLPQWRNEFVR------------------VNDGNGLYCEVYYAGNVSNLRTLL 556

Query: 427 ------KPVLIISYETLRRNVDQLKN-----CNVGL-------MLADEGHRLKNGDSLTF 468
                   V++ +Y  ++    +L+       N GL       ++ DEGH ++N  + T 
Sbjct: 557 VKQKSPPSVVLTTYGVVQTEWSKLQQFDYEASNEGLFSVEFFRIILDEGHNIRNRTTKTS 616

Query: 469 TALDSISCPRRVILSGTPIQNDLSEYFALLSFSN 502
            A+ +++  R+ +L+GTPI N L + F+L+ F N
Sbjct: 617 KAVMALTSRRKWVLTGTPIMNRLDDLFSLIKFMN 650

>Kwal_47.17771
          Length = 972

 Score = 94.0 bits (232), Expect = 3e-19,   Method: Compositional matrix adjust.
 Identities = 63/181 (34%), Positives = 100/181 (55%), Gaps = 10/181 (5%)

Query: 654 SAKFSILERFLHKIKTESD----DKIVLISNYTQTLDLIE---KMCRYKHYSAV-RLDGT 705
           S+K S ++  +  +K   D    ++IV+ S ++  LD+IE     C  K  + V + DG 
Sbjct: 793 SSKSSKIQSLITSLKRLQDACPGEQIVVFSQFSSFLDIIETEISSCFSKSTTKVYKFDGR 852

Query: 706 MSINKRQKLVDRFNDPEGQEF-IFLLSSKAGGCGINLIGANRLILMDPDWNPAADQQALA 764
           +S+ +R K++  F   +     I LLS KAGG G+NL  A+R  +MDP W+P+ + QA+ 
Sbjct: 853 LSMKERSKVLQDFAVKDMTRLKILLLSLKAGGVGLNLTCASRAYMMDPWWSPSLEDQAID 912

Query: 765 RVWRDGQKKDCFIYRFISTGTIEEKIFQRQSMKMSLSSCVVDAKEDVERLFSSDNLRQLF 824
           R+ R GQ  +  + RFI   +IEEK+ + Q  K +L    VDA ED  R    + ++ LF
Sbjct: 913 RIHRIGQVNNVKVVRFIIEHSIEEKMLRIQERKRTLGEA-VDADEDERRKRRIEEIKMLF 971

Query: 825 Q 825
           +
Sbjct: 972 E 972

 Score = 61.2 bits (147), Expect = 3e-09,   Method: Compositional matrix adjust.
 Identities = 56/215 (26%), Positives = 94/215 (43%), Gaps = 59/215 (27%)

Query: 330 GCIMADEMGLGKTLQCIALMWTLLRQGPQGKRLIDKC----------------------- 366
           G I+ADEMGLGKT+  +A++ T+      GK  + +                        
Sbjct: 335 GGILADEMGLGKTISILAMILTVPSDSSYGKEKLREASESPDPEISVLGSQWSGGSKPYA 394

Query: 367 ----IIVCPSSLVNNWANELIKWLGPNTLTPLAVDGKKSS---MGGGNTTVSQAIHAWAQ 419
               ++V P SL++ W  E  K          A   K+++     GGNT+  +++    +
Sbjct: 395 SGTTLVVVPMSLLSQWQQEFEK----------ASSSKEATCEIYYGGNTSSLKSLLTKTK 444

Query: 420 AQGRNIVKPVLIISYETLRRNVDQLKNCN-------VGL-------MLADEGHRLKNGDS 465
           +        VLI +Y T++    +L N N        GL       ++ DEGH ++N ++
Sbjct: 445 SP-----PTVLITTYGTVQHEWSRLLNKNGQMDTDVSGLFSVEFFRIVIDEGHTIRNRNT 499

Query: 466 LTFTALDSISCPRRVILSGTPIQNDLSEYFALLSF 500
            T  +L  +   R  IL+GTPI N L + ++L+ F
Sbjct: 500 RTSRSLMDLKSTRSWILTGTPIINRLDDLYSLVKF 534

>CAGL0A03432g 345192..348647 similar to sp|P32849 Saccharomyces
            cerevisiae YLR032w RAD5, hypothetical start
          Length = 1151

 Score = 90.1 bits (222), Expect = 4e-18,   Method: Compositional matrix adjust.
 Identities = 55/177 (31%), Positives = 97/177 (54%), Gaps = 7/177 (3%)

Query: 655  AKFSILERFLHKIKTES-DDKIVLISNYTQTLDLIEKMCRYKHYS----AVRLDGTMSIN 709
            AK + L R L +++  S  +++V+ S ++  LD++E      + S      + DG +S+ 
Sbjct: 975  AKLNALIRHLQQLQDSSAGEQVVVFSQFSSYLDILESQLNEVYSSNKLKVYKFDGRLSLK 1034

Query: 710  KRQKLVDRFNDPE-GQEFIFLLSSKAGGCGINLIGANRLILMDPDWNPAADQQALARVWR 768
            +R  +++ F   +   + + LLS KAGG G+NL  A+   +MDP W+P+ + QA+ R+ R
Sbjct: 1035 ERTAVLEDFKVKDYAVQKVLLLSLKAGGVGLNLTCASYAFMMDPWWSPSMEDQAIDRIHR 1094

Query: 769  DGQKKDCFIYRFISTGTIEEKIFQRQSMKMSLSSCVVDAKEDVERLFSSDNLRQLFQ 825
             GQ     + RF+  G+IEEK+ + Q  K +L    +D  ED  R    + ++ LF+
Sbjct: 1095 IGQTNSVKVIRFVIDGSIEEKMLRIQDRKRTLGEA-MDTDEDERRKRRIEEIQMLFE 1150

 Score = 54.7 bits (130), Expect = 3e-07,   Method: Compositional matrix adjust.
 Identities = 54/213 (25%), Positives = 85/213 (39%), Gaps = 55/213 (25%)

Query: 330 GCIMADEMGLGKTLQCIALMW-----------TLLRQG--------------PQGKRLID 364
           G I++DEMGLGKT+  ++L+            +L  Q               P+      
Sbjct: 508 GGILSDEMGLGKTISALSLVLMRPKDEHTTSQSLFHQESSNLSSDDVIEIKEPERSYAYK 567

Query: 365 KCIIVCPSSLVNNWANELIKWLGPNTLT-PLAVDGKKSSMGG-----------GNTTVSQ 412
             +I+ P SL+  W +E  K      LT  L   G  SS+               TT   
Sbjct: 568 TTLIIVPMSLLTQWRDEFDKVNNNAGLTCELYYGGNVSSLKSLLIKRKNPPTVVLTTYGI 627

Query: 413 AIHAWAQAQG-----RNIVKPVLIISYETLRRNVDQLKNCNVGLMLADEGHRLKNGDSLT 467
             + W +        R++ +   I S E  R             ++ DEGH ++N  ++T
Sbjct: 628 VQNEWTKLSKDGTNIRSLGRTSGIFSIEFFR-------------IILDEGHTIRNKSTIT 674

Query: 468 FTALDSISCPRRVILSGTPIQNDLSEYFALLSF 500
             A+  +S   R IL+GTPI N L + ++L+ F
Sbjct: 675 SKAVLELSSKYRWILTGTPIINRLDDLYSLVKF 707

>CAGL0G09493g complement(902228..906454) similar to tr|Q08562
            Saccharomyces cerevisiae YOR191w RIS1, hypothetical start
          Length = 1408

 Score = 90.1 bits (222), Expect = 4e-18,   Method: Compositional matrix adjust.
 Identities = 53/190 (27%), Positives = 103/190 (54%), Gaps = 15/190 (7%)

Query: 639  YNMPGSKARD-VQTKYSAKFSILE---------RFLHKIKTESD-DKIVLISNYTQTLDL 687
            +N+   K +D  +  Y+  ++ LE           ++K+  +SD +KI++ S +T  LDL
Sbjct: 1206 FNLEMDKQKDRKKNAYTTDYNTLEPSTKMNQCMDVINKVFEKSDSEKIIIFSQFTTFLDL 1265

Query: 688  IEKMCRYK-HYSAVRLDGTMSINKRQKLVDRFNDPEGQEFIFLLSSKAGGCGINLIGANR 746
            +E +   +   S ++  G M+   R +++ RF   E +  + L+S KAG  G+ L  AN 
Sbjct: 1266 LEHILATRLKISCLKYTGDMNAKVRSEIISRFYSEEDKR-VLLISMKAGNSGLTLTCANH 1324

Query: 747  LILMDPDWNPAADQQALARVWRDGQKKDCFIYRFISTGTIEEKIFQRQSMKMSLSSCVVD 806
            ++++DP WNP  ++QA  R +R  Q ++  ++R     ++E++I + Q +K  +    +D
Sbjct: 1325 VVIVDPFWNPYVEEQAQDRCYRISQTREVTVHRLFIKNSVEDRILELQKLKRDMVDAAMD 1384

Query: 807  AK--EDVERL 814
            AK  +D+ +L
Sbjct: 1385 AKKIKDINKL 1394

 Score = 60.5 bits (145), Expect = 5e-09,   Method: Compositional matrix adjust.
 Identities = 55/207 (26%), Positives = 90/207 (43%), Gaps = 53/207 (25%)

Query: 330 GCIMADEMGLGKTLQCIALMWTLLRQGPQGKRLIDKCIIVCPSSLVNNWANELIKWLGPN 389
           G ++AD+MGLGKT+Q IALM    R   + K+     +IV P S++  W  E+       
Sbjct: 754 GGLLADDMGLGKTVQAIALMLAN-RSSNESKK---TNLIVAPVSVLRVWKGEI------E 803

Query: 390 TLTPLAVDGKKSSMGGGNTTVSQAIHAWAQAQGRNIVKPVLIISYETLRRNV-----DQL 444
           T    + D   +  GG N        +W +    +    V+++SY+TL   +     ++L
Sbjct: 804 TKIKESSDFNSAIYGGVNGI---KFRSWDKLSNFD----VILVSYQTLANELKKHWPERL 856

Query: 445 KNCNVGL-------------------------------MLADEGHRLKNGDSLTFTALDS 473
           K  +  L                               ++ DEG  +KN  +    A  +
Sbjct: 857 KTDSKQLPPVPDIKAMNSLKTKNEYWSPFYSDDSTFYRIILDEGQNIKNMKTQAAKACCT 916

Query: 474 ISCPRRVILSGTPIQNDLSEYFALLSF 500
           ++   R ILSGTPIQN++ E ++L+ F
Sbjct: 917 VNSVYRWILSGTPIQNNMEELYSLIRF 943

>Scas_721.100
          Length = 1137

 Score = 88.6 bits (218), Expect = 1e-17,   Method: Compositional matrix adjust.
 Identities = 56/177 (31%), Positives = 98/177 (55%), Gaps = 7/177 (3%)

Query: 655  AKFSILERFLHKIKTES-DDKIVLISNYTQTLDLIEKMCRYKHYSAV----RLDGTMSIN 709
            AK S L + L  ++  S  +++V+ S ++  LD++E   +    + V    + DG +S+ 
Sbjct: 962  AKLSALLKHLQLLQDSSAGEQVVIFSQFSSYLDILEDELKEAFPTDVAKIYKFDGRLSLK 1021

Query: 710  KRQKLVDRFNDPE-GQEFIFLLSSKAGGCGINLIGANRLILMDPDWNPAADQQALARVWR 768
            +R  ++  F   +  ++ I LLS KAGG G+NL  A+   +MDP W+P+ + QA+ R+ R
Sbjct: 1022 ERSTVLQDFQIKDLSRQKILLLSLKAGGVGLNLTCASHAYMMDPWWSPSMEDQAIDRIHR 1081

Query: 769  DGQKKDCFIYRFISTGTIEEKIFQRQSMKMSLSSCVVDAKEDVERLFSSDNLRQLFQ 825
             GQ  +  + RFI   +IEEK+ + Q  K ++    +DA ED  R    + ++ LF+
Sbjct: 1082 IGQTNNVKVVRFIIENSIEEKMLRIQERKRTIGEA-MDADEDERRKRRIEEIKMLFE 1137

 Score = 58.9 bits (141), Expect = 2e-08,   Method: Compositional matrix adjust.
 Identities = 53/209 (25%), Positives = 90/209 (43%), Gaps = 52/209 (24%)

Query: 330 GCIMADEMGLGKTLQCIALMWTLLRQGPQGKRLIDK------------------------ 365
           G I++DEMGLGKT+  +AL+ +     P    ++DK                        
Sbjct: 501 GGILSDEMGLGKTISTLALILSC----PYDSEVVDKKLFKGEEDDIRETQPHLKPYASKT 556

Query: 366 CIIVCPSSLVNNWANELIKWLGPNTL-TPLAVDGKKSSMGGGNT------TVSQAIHAWA 418
            +IV P SL+N W  E  K    + + + +   G  SS+    T      TV    +   
Sbjct: 557 TLIVVPMSLLNQWNTEFNKANNSSDMRSEIYYGGNVSSLKKLLTKTHNPPTVVITTYGIV 616

Query: 419 QAQGRNIVKPVLIISYETLRRNVDQLKNCNVGL-------MLADEGHRLKNGDSLTFTAL 471
           Q++   I K          ++N+      + GL       ++ DEGH ++N  +LT  A+
Sbjct: 617 QSEWSKIFK----------KQNIGAEIQSSSGLFSVDFYRIVIDEGHTIRNRTTLTSKAI 666

Query: 472 DSISCPRRVILSGTPIQNDLSEYFALLSF 500
             ++   + +L+GTPI N L + ++L+ F
Sbjct: 667 MDLTSKCKWVLTGTPIINRLDDLYSLVRF 695

>KLLA0F17479g complement(1601287..1604631) similar to sp|P32849
            Saccharomyces cerevisiae YLR032w RAD5 DNA helicase, start
            by similarity
          Length = 1114

 Score = 88.6 bits (218), Expect = 1e-17,   Method: Compositional matrix adjust.
 Identities = 55/178 (30%), Positives = 96/178 (53%), Gaps = 7/178 (3%)

Query: 654  SAKFSILERFLHKIK-TESDDKIVLISNYTQTLDLIEKMCRYK----HYSAVRLDGTMSI 708
            S K   L R L +I+ T   ++I++ S ++  LD++E   R           + DG + +
Sbjct: 938  STKIKALLRHLKQIQETSPGEQIIVFSQFSSFLDILEIELRSHLPRDQVIIYKFDGRLDM 997

Query: 709  NKRQKLVDRFNDPEGQEF-IFLLSSKAGGCGINLIGANRLILMDPDWNPAADQQALARVW 767
             +R +++++F+D +     + LLS K GG G+NL  A+R  +MDP W+P  + QA+ R+ 
Sbjct: 998  KERTRILEQFHDKDLSCIKLLLLSLKTGGVGLNLTCASRAFMMDPWWSPGMEDQAIDRIH 1057

Query: 768  RDGQKKDCFIYRFISTGTIEEKIFQRQSMKMSLSSCVVDAKEDVERLFSSDNLRQLFQ 825
            R GQ++   + RFI   ++EEK+ + Q  K  L   +V+  E   R    + ++ LFQ
Sbjct: 1058 RIGQQQTVKVVRFIIDNSVEEKMLRIQERKRMLGD-IVEGDEAERRQKRIEEIQMLFQ 1114

 Score = 65.5 bits (158), Expect = 2e-10,   Method: Compositional matrix adjust.
 Identities = 61/232 (26%), Positives = 93/232 (40%), Gaps = 39/232 (16%)

Query: 330 GCIMADEMGLGKTLQCIALMWTLLRQGPQGKRL--------------IDK---------- 365
           G I+ADEMGLGKT+  +AL+ T        K++              +D           
Sbjct: 479 GGILADEMGLGKTISALALICTASYDEAHEKKIESTKKPSMKEMSSQVDSSPLRHSQHKH 538

Query: 366 -------CIIVCPSSLVNNWANELIKWLGPNTLTPLAVDGKKSSMGGGNTTVSQAIHAWA 418
                   +IV P SL+N W +E  K      L       K+  +  GN       +   
Sbjct: 539 DTYAYRTTLIVVPMSLLNQWQSEFEK--ANKDLK------KRCEIYYGNNIKDLRAYVLG 590

Query: 419 QAQGRNIVKPVLIISYETLRRNVDQLKNCNVGLMLADEGHRLKNGDSLTFTALDSISCPR 478
                 I+    II  E  R +   L N     ++ DEGH ++N  + T  A+ ++   R
Sbjct: 591 PNAPSVIITTYGIIQSEYGRTSTSGLFNVVFFRIILDEGHTIRNRSTRTSKAVIALRSSR 650

Query: 479 RVILSGTPIQNDLSEYFALLSFSNPGLLGSRAEFRKNFENPILRGRDADATD 530
           + IL+GTPI N L + F+L+ F N         +++    P  +G  A A D
Sbjct: 651 KWILTGTPIINRLDDLFSLVQFLNLEPWSHINYWKRYVSVPFEKGNYAQAFD 702

>CAGL0K07766g 770935..773427 highly similar to sp|P31244
           Saccharomyces cerevisiae YBR114w RAD16 DNA repair
           protein, start by similarity
          Length = 830

 Score = 87.4 bits (215), Expect = 3e-17,   Method: Compositional matrix adjust.
 Identities = 54/172 (31%), Positives = 91/172 (52%), Gaps = 2/172 (1%)

Query: 654 SAKFSILERFLHKIKTESDD-KIVLISNYTQTLDLIEKMCRYKHYSAVRLDGTMSINKRQ 712
           S K   L   L+K+++     K ++ S +T  LDL+E   +   +  V+L G+MS  +R 
Sbjct: 658 STKIEALVEELYKLRSPVKTVKSIVFSQFTSMLDLVEWRLKRAGFQTVKLQGSMSPTQRD 717

Query: 713 KLVDRFNDPEGQEFIFLLSSKAGGCGINLIGANRLILMDPDWNPAADQQALARVWRDGQK 772
           + +  F D    E +FL+S KAGG  +NL  A+++ ++DP WNP+ + Q+  RV R GQ 
Sbjct: 718 QTIKYFMDNIECE-VFLVSLKAGGVALNLCEASQVFILDPWWNPSVEWQSGDRVHRIGQY 776

Query: 773 KDCFIYRFISTGTIEEKIFQRQSMKMSLSSCVVDAKEDVERLFSSDNLRQLF 824
           +   I RF    +IE +I + Q  K ++    ++  E      +  +L+ LF
Sbjct: 777 RPVKITRFCIEDSIEARIIELQEKKANMIHATINQDEAAINRLTPADLQFLF 828

 Score = 62.4 bits (150), Expect = 1e-09,   Method: Compositional matrix adjust.
 Identities = 45/178 (25%), Positives = 83/178 (46%), Gaps = 22/178 (12%)

Query: 330 GCIMADEMGLGKTLQCIALMWTLLRQGPQGKRLIDKCIIVCPSSLVNNWANELIKWLGPN 389
           G ++ADEMG+GKT+Q IAL+     + P         ++V P+  +  W NE I+     
Sbjct: 246 GGVLADEMGMGKTIQTIALLMNDRSKKPS--------LVVAPTVALMQWKNE-IEQHTNG 296

Query: 390 TLTPLAVDGKKSSMGGGNT-------TVSQAIHAWAQAQGRNIVKPVLIISYETLRRNVD 442
            L+     G   ++   +        T    + +  + Q     +   ++  ++L  N+D
Sbjct: 297 ALSTYIYHGASRTINIHDLKDIDVILTTYSVLESVFRKQNYGFRRKNGLVKEKSLLHNID 356

Query: 443 QLKNCNVGLMLADEGHRLKNGDSLTFTALDSISCPRRVILSGTPIQNDLSEYFALLSF 500
             +       + DE H +K+  S T  A++++   +R  LSGTP+QN + E ++L+ F
Sbjct: 357 FYR------AILDEAHNIKDRTSNTSRAVNALKTQKRWCLSGTPLQNRIGEMYSLIRF 408

>Kwal_23.3660
          Length = 768

 Score = 85.5 bits (210), Expect = 9e-17,   Method: Compositional matrix adjust.
 Identities = 47/151 (31%), Positives = 82/151 (54%), Gaps = 1/151 (0%)

Query: 674 KIVLISNYTQTLDLIEKMCRYKHYSAVRLDGTMSINKRQKLVDRFNDPEGQEFIFLLSSK 733
           K ++ S +T  LDL+E   +   +  V+L G+M+  +R + +  F D    E +FL+S K
Sbjct: 617 KSIVFSQFTSMLDLVEWRLKRAGFQTVKLQGSMTPTQRDQTIKYFMDNTHCE-VFLVSLK 675

Query: 734 AGGCGINLIGANRLILMDPDWNPAADQQALARVWRDGQKKDCFIYRFISTGTIEEKIFQR 793
           AGG  +NL  A+++ ++DP WNP+ + Q+  RV R GQ +   I RF    +IE +I + 
Sbjct: 676 AGGVALNLCEASQVFILDPWWNPSVEWQSGDRVHRIGQYRPVKITRFCIEDSIESRIIEL 735

Query: 794 QSMKMSLSSCVVDAKEDVERLFSSDNLRQLF 824
           Q  K ++    ++  +      +  +L+ LF
Sbjct: 736 QEKKANMIHATINQDDAAINRLTPGDLQFLF 766

 Score = 69.7 bits (169), Expect = 6e-12,   Method: Compositional matrix adjust.
 Identities = 46/173 (26%), Positives = 83/173 (47%), Gaps = 8/173 (4%)

Query: 330 GCIMADEMGLGKTLQCIALMWTLLRQGPQGKRLIDKCIIVCPSSLVNNWANELIKWLGPN 389
           G ++ADEMG+GKT+Q IAL+   + + P         ++V P+  +  W NE+ +  G  
Sbjct: 183 GGVLADEMGMGKTIQTIALLMNDVTKKPS--------LVVAPTVALMQWKNEIEQHTGGK 234

Query: 390 TLTPLAVDGKKSSMGGGNTTVSQAIHAWAQAQGRNIVKPVLIISYETLRRNVDQLKNCNV 449
             T +     ++S  G    V   +  +A  +     +         + +    L N N 
Sbjct: 235 LKTHIFHGANRTSNVGEFKDVDVLLTTYAVLESVFRKQNYGFKRKSGVYKEPSVLHNMNF 294

Query: 450 GLMLADEGHRLKNGDSLTFTALDSISCPRRVILSGTPIQNDLSEYFALLSFSN 502
             ++ DE H +K+  S T  A++S+   ++  L+GTP+QN + E ++L+ F N
Sbjct: 295 YRVILDEAHNIKDRQSNTAKAVNSLLTEKKWCLTGTPLQNRIGEMYSLIRFLN 347

>Kwal_14.1868
          Length = 1357

 Score = 85.1 bits (209), Expect = 1e-16,   Method: Compositional matrix adjust.
 Identities = 50/152 (32%), Positives = 79/152 (51%), Gaps = 7/152 (4%)

Query: 657  FSILERFLHKIKTESDDKIVLISNYTQTLDLIEKMCRYKHYSA--VRLDGTMSINKRQKL 714
              I+     K KTE   KI++ S +T   DL++   R K   A  +R DG+M    R   
Sbjct: 1182 LDIIRDVFLKSKTE---KIIVFSQFTTFFDLLQHFIR-KDLGAQYLRYDGSMDSQSRAAT 1237

Query: 715  VDRFNDPEGQEFIFLLSSKAGGCGINLIGANRLILMDPDWNPAADQQALARVWRDGQKKD 774
            ++ F     +  I L+S KAG  G+ L  AN +IL+DP WNP  ++QA+ R +R  Q +D
Sbjct: 1238 IEEFYR-SLERRILLISMKAGNAGLTLTCANHVILIDPFWNPFVEEQAMDRCYRISQTRD 1296

Query: 775  CFIYRFISTGTIEEKIFQRQSMKMSLSSCVVD 806
              ++R +   ++E++I + Q  K  L    +D
Sbjct: 1297 VQVHRLLVKNSVEDRILELQKKKRELVEIAMD 1328

 Score = 64.3 bits (155), Expect = 4e-10,   Method: Compositional matrix adjust.
 Identities = 64/279 (22%), Positives = 119/279 (42%), Gaps = 69/279 (24%)

Query: 321 TEQNNRGAYGCIMADEMGLGKTLQCIALMWTLLRQGPQGKRLIDKC---IIVCPSSLVNN 377
            E++NR   G ++AD+MGLGKT+Q IALM          K  ++ C   +IV P +++  
Sbjct: 689 VEKSNRK--GGLLADDMGLGKTVQAIALMLA-------NKSGVENCKTNLIVAPVAVLRV 739

Query: 378 WANELIKWLGPNTLTPLAVDGKKSSMGGGNTTVSQAIHAWAQAQGRNIVKPVLIISYETL 437
           W  E+   +   +   + +       GGGN    +   +        +   V+++SY+TL
Sbjct: 740 WQAEVKTKVKKTSGLKVLI------YGGGNGAKVENYRSL-------LRHDVVLVSYQTL 786

Query: 438 R--------------------------RNVDQLKN---------CNVG---LMLADEGHR 459
                                      + ++ LK          CN      ++ DE   
Sbjct: 787 ASELKKHWPARLSEDSEEAKITDIPDLKALNSLKERKEYWSPFYCNESKFYRIILDEAQN 846

Query: 460 LKNGDSLTFTALDSISCPRRVILSGTPIQNDLSEYFALLSFSNPGLLGSRAEFRKNFENP 519
           +KN  + +  A  ++    R  LSGTP+QN++ E ++L+ F          +F+ +  NP
Sbjct: 847 IKNKKTQSAKACCTLDATYRWALSGTPMQNNIMELYSLIRFLKISPYKREQKFKLDIGNP 906

Query: 520 ILRG-RDADATDKEITKGEAQLQKLSTIVSKFIIRRTND 557
           + +   D D+ D+     +  ++K+  ++   ++RRT D
Sbjct: 907 LGKATNDYDSHDR-----QQAIKKVQVLLRAIMLRRTKD 940

>ADL345C [1395] [Homologous to ScYBR114W (RAD16) - SH]
           (100332..102572) [2241 bp, 746 aa]
          Length = 746

 Score = 84.7 bits (208), Expect = 1e-16,   Method: Compositional matrix adjust.
 Identities = 51/174 (29%), Positives = 91/174 (52%), Gaps = 2/174 (1%)

Query: 652 KYSAKFSILERFLHKIKTESDD-KIVLISNYTQTLDLIEKMCRYKHYSAVRLDGTMSINK 710
           + S K   L   L+ +++ +   K ++ S +T  LDL+E   +   +   +L G+M+  +
Sbjct: 572 RSSTKIEALLEELYNLRSSTRTIKSIVFSQFTSMLDLVEWRLKRAGFQTAKLQGSMTPTQ 631

Query: 711 RQKLVDRFNDPEGQEFIFLLSSKAGGCGINLIGANRLILMDPDWNPAADQQALARVWRDG 770
           R + ++ F D    E +FL+S KAGG  +NL  A+++ ++DP WNP+ + Q+  RV R G
Sbjct: 632 RAETINYFMDNVHCE-VFLVSLKAGGVALNLCEASQVFILDPWWNPSVEWQSGDRVHRIG 690

Query: 771 QKKDCFIYRFISTGTIEEKIFQRQSMKMSLSSCVVDAKEDVERLFSSDNLRQLF 824
           Q +   I RF    +IE +I + Q  K ++    +   E      +  +L+ LF
Sbjct: 691 QHRPVKITRFCIEDSIESRIIELQEKKANMIHATLGQDEGAVNRLTPADLQFLF 744

 Score = 66.2 bits (160), Expect = 7e-11,   Method: Compositional matrix adjust.
 Identities = 52/196 (26%), Positives = 89/196 (45%), Gaps = 43/196 (21%)

Query: 322 EQNNRGAYGCIMADEMGLGKTLQCIALMWTLLRQGPQGKRLIDKCIIVCPSSLVNNWANE 381
           ++NN    G ++ADEMG+GKT+Q I+L+     +GP         ++V P+  +  W NE
Sbjct: 156 QENNERYRGGVLADEMGMGKTVQMISLLLHA-NKGPT--------LVVAPTVALIQWKNE 206

Query: 382 LIKWLGPNTLTPLAVDGKKSSMGGGNTTVSQAIHAWAQAQGRNIVKPVLIISYETLR--- 438
           + K+ G   L  L   G       G + VS+ + A            V++ +Y  L    
Sbjct: 207 IDKYTG-GALRSLVFHGP------GRSAVSEELAA----------ADVVLTTYAVLESVY 249

Query: 439 --------------RNVDQLKNCNVGLMLADEGHRLKNGDSLTFTALDSISCPRRVILSG 484
                         R    L   +   ++ DE H +K+  S T  +++++   RR  L+G
Sbjct: 250 RKQTQGFRRKAGVVREQSPLHAVDFYRVVLDEAHNIKDRSSGTARSVNALRAVRRWCLTG 309

Query: 485 TPIQNDLSEYFALLSF 500
           TP+QN + E ++L+ F
Sbjct: 310 TPLQNRIGEMYSLIRF 325

>YBR114W (RAD16) [303] chr2 (467204..469576) Nucleotide excision
           repair protein involved in G2 repair of inactive genes,
           component of the nucleotide excision repair factor four
           (NEF4, Rad7p-Rad16p) ATP-dependent damage recognition
           complex, has DNA helicase domain of Snf2p family [2373
           bp, 790 aa]
          Length = 790

 Score = 84.7 bits (208), Expect = 1e-16,   Method: Compositional matrix adjust.
 Identities = 53/172 (30%), Positives = 91/172 (52%), Gaps = 2/172 (1%)

Query: 654 SAKFSILERFLHKIKTESDD-KIVLISNYTQTLDLIEKMCRYKHYSAVRLDGTMSINKRQ 712
           S K   L   L+K+++     K ++ S +T  LDL+E   +   +  V+L G+MS  +R 
Sbjct: 618 STKIEALVEELYKLRSNKRTIKSIVFSQFTSMLDLVEWRLKRAGFQTVKLQGSMSPTQRD 677

Query: 713 KLVDRFNDPEGQEFIFLLSSKAGGCGINLIGANRLILMDPDWNPAADQQALARVWRDGQK 772
           + +  F +    E +FL+S KAGG  +NL  A+++ ++DP WNP+ + Q+  RV R GQ 
Sbjct: 678 ETIKYFMNNIQCE-VFLVSLKAGGVALNLCEASQVFILDPWWNPSVEWQSGDRVHRIGQY 736

Query: 773 KDCFIYRFISTGTIEEKIFQRQSMKMSLSSCVVDAKEDVERLFSSDNLRQLF 824
           +   I RF    +IE +I + Q  K ++    ++  E      +  +L+ LF
Sbjct: 737 RPVKITRFCIEDSIEARIIELQEKKANMIHATINQDEAAISRLTPADLQFLF 788

 Score = 63.9 bits (154), Expect = 4e-10,   Method: Compositional matrix adjust.
 Identities = 52/186 (27%), Positives = 88/186 (47%), Gaps = 34/186 (18%)

Query: 330 GCIMADEMGLGKTLQCIALMWTLLRQGPQGKRLIDKCIIVCPSSLVNNWANELIKWLGPN 389
           G ++ADEMG+GKT+Q IAL+   L + P         ++V P+  +  W NE+ +    +
Sbjct: 205 GGVLADEMGMGKTIQTIALLMNDLTKSPS--------LVVAPTVALMQWKNEIEQ----H 252

Query: 390 TLTPLAVDGKKSSMGGGNTTVSQAIHAWAQAQGRNIVKPVLII--------SYETLRRN- 440
           T   L +       G   TT  + +      QG ++V     +        +Y   R+N 
Sbjct: 253 TKGQLKI---YIYHGASRTTDIKDL------QGYDVVLTTYAVLESVFRKQNYGFRRKNG 303

Query: 441 ----VDQLKNCNVGLMLADEGHRLKNGDSLTFTALDSISCPRRVILSGTPIQNDLSEYFA 496
                  L N +   ++ DE H +K+  S T  A++++   +R  LSGTP+QN + E ++
Sbjct: 304 LFKQPSVLHNIDFYRVILDEAHNIKDRQSNTARAVNNLKTQKRWCLSGTPLQNRIGEMYS 363

Query: 497 LLSFSN 502
           L+ F N
Sbjct: 364 LIRFLN 369

>KLLA0B09240g complement(810178..812580) similar to sp|P31244
           Saccharomyces cerevisiae YBR114w RAD16 nucleotide
           excision repair protein, start by similarity
          Length = 800

 Score = 84.3 bits (207), Expect = 2e-16,   Method: Compositional matrix adjust.
 Identities = 52/172 (30%), Positives = 91/172 (52%), Gaps = 2/172 (1%)

Query: 654 SAKFSILERFLHKIKTESDD-KIVLISNYTQTLDLIEKMCRYKHYSAVRLDGTMSINKRQ 712
           S K   L   L+ ++++    K ++ S +T  LDL+E   +   +  V+L G+M+  +R 
Sbjct: 628 STKIEALVEELYNLRSDKRTIKSIVFSQFTSMLDLVEWRLKRAGFQTVKLQGSMTPTQRD 687

Query: 713 KLVDRFNDPEGQEFIFLLSSKAGGCGINLIGANRLILMDPDWNPAADQQALARVWRDGQK 772
           + +  F +    E +FL+S KAGG  +NL  A+++ ++DP WNP+ + Q+  RV R GQ 
Sbjct: 688 QTIKYFMENIHCE-VFLVSLKAGGVALNLCEASQVFILDPWWNPSVEWQSGDRVHRIGQF 746

Query: 773 KDCFIYRFISTGTIEEKIFQRQSMKMSLSSCVVDAKEDVERLFSSDNLRQLF 824
           +   I RF    +IE +I + Q  K S+    ++  E      +  +L+ LF
Sbjct: 747 RPVKITRFCIEDSIESRIIELQEKKASMIHATINQDEAAINRLTPADLQFLF 798

 Score = 67.4 bits (163), Expect = 3e-11,   Method: Compositional matrix adjust.
 Identities = 46/179 (25%), Positives = 85/179 (47%), Gaps = 20/179 (11%)

Query: 330 GCIMADEMGLGKTLQCIALMWTLLRQGPQGKRLIDKCIIVCPSSLVNNWANELIKWLGPN 389
           G ++ADEMG+GKT+Q IAL+ + + + P         ++V P+  +  W NE+ +     
Sbjct: 215 GGVLADEMGMGKTIQTIALLMSDITRKPS--------LVVAPTVALMQWKNEIEQHTNKK 266

Query: 390 TLTPLAVDGKKSSMGGGNTTVSQAIHAWAQAQGRNIVKPVLIISYETLRRNVDQLK---- 445
               +     +++  G    V   +  +A      +++ V        +R    +K    
Sbjct: 267 LSVYMYHGANRTNNLGDFKDVDVILTTYA------VLESVYRKQVYGFKRKAGTVKEKSL 320

Query: 446 --NCNVGLMLADEGHRLKNGDSLTFTALDSISCPRRVILSGTPIQNDLSEYFALLSFSN 502
             + N   ++ DE H +K+  S T  A++S+   +R  LSGTP+QN + E ++L+ F N
Sbjct: 321 LHSINFYRVILDEAHNIKDRTSNTAKAVNSLQTKKRWCLSGTPLQNRIGEMYSLIRFLN 379

>YLR032W (RAD5) [3450] chr12 (204992..208501) Single-stranded
            DNA-dependent ATPase of the Snf2p family of DNA
            helicases, member of the RAD6 epistasis group, involved
            in error-free DNA repair [3510 bp, 1169 aa]
          Length = 1169

 Score = 84.3 bits (207), Expect = 2e-16,   Method: Compositional matrix adjust.
 Identities = 55/178 (30%), Positives = 97/178 (54%), Gaps = 7/178 (3%)

Query: 654  SAKFSILERFLHKIKTES-DDKIVLISNYTQTLDLIEKMCRYKHYSAV----RLDGTMSI 708
            S+K + L + L  ++  S  +++V+ S ++  LD++EK   +     V    + DG +S+
Sbjct: 993  SSKITALLKELQLLQDSSAGEQVVIFSQFSTYLDILEKELTHTFSKDVAKIYKFDGRLSL 1052

Query: 709  NKRQKLVDRFNDPE-GQEFIFLLSSKAGGCGINLIGANRLILMDPDWNPAADQQALARVW 767
             +R  ++  F   +  ++ I LLS KAGG G+NL  A+   +MDP W+P+ + QA+ R+ 
Sbjct: 1053 KERTSVLADFAVKDYSRQKILLLSLKAGGVGLNLTCASHAYMMDPWWSPSMEDQAIDRLH 1112

Query: 768  RDGQKKDCFIYRFISTGTIEEKIFQRQSMKMSLSSCVVDAKEDVERLFSSDNLRQLFQ 825
            R GQ     + RFI   +IEEK+ + Q  K ++    +D  ED  R    + ++ LF+
Sbjct: 1113 RIGQTNSVKVMRFIIQDSIEEKMLRIQEKKRTIGEA-MDTDEDERRKRRIEEIQMLFE 1169

 Score = 55.8 bits (133), Expect = 1e-07,   Method: Compositional matrix adjust.
 Identities = 50/211 (23%), Positives = 88/211 (41%), Gaps = 51/211 (24%)

Query: 330 GCIMADEMGLGKTLQCIALMWTLLRQGPQGKRLIDK------------------------ 365
           G I++DEMGLGKT+      ++L+   P    ++DK                        
Sbjct: 527 GGILSDEMGLGKTVAA----YSLVLSCPHDSDVVDKKLFDIENTAVSDNLPSTWQDNKKP 582

Query: 366 -----CIIVCPSSLVNNWANELIKWLGPNTLTPLAVDGKKSSMGGGNTTVSQAIHAWAQA 420
                 +IV P SL+  W+NE  K          + D       GGN +  + +    + 
Sbjct: 583 YASKTTLIVVPMSLLTQWSNEFTK-------ANNSPDMYHEVYYGGNVSSLKTLLTKTKT 635

Query: 421 QGRNIVKPVLIISYETLR----RNVDQLKNCNVGL-------MLADEGHRLKNGDSLTFT 469
               ++    I+  E  +    R  D+  N + GL       ++ DEGH ++N  ++T  
Sbjct: 636 PPTVVLTTYGIVQNEWTKHSKGRMTDEDVNISSGLFSVNFYRIIIDEGHNIRNRTTVTSK 695

Query: 470 ALDSISCPRRVILSGTPIQNDLSEYFALLSF 500
           A+ ++    + +L+GTPI N L + ++L+ F
Sbjct: 696 AVMALQGKCKWVLTGTPIINRLDDLYSLVKF 726

>Scas_591.10
          Length = 772

 Score = 84.0 bits (206), Expect = 3e-16,   Method: Compositional matrix adjust.
 Identities = 54/173 (31%), Positives = 93/173 (53%), Gaps = 4/173 (2%)

Query: 654 SAKFSILERFLHKIKTESDD-KIVLISNYTQTLDLIEKMCRYKHYSAVRLDGTMSINKRQ 712
           S K   L   L+K+++     K ++ S +T  LDL+E   +   +  V+L G+MS  +R 
Sbjct: 600 STKIEALVEELYKLRSPVRTIKSIVFSQFTSMLDLVEWRLKRAGFQTVKLQGSMSPTQRD 659

Query: 713 KLVDRF-NDPEGQEFIFLLSSKAGGCGINLIGANRLILMDPDWNPAADQQALARVWRDGQ 771
           + +  F N+ E +  +FL+S KAGG  +NL  A+++ ++DP WNP+ + Q+  RV R GQ
Sbjct: 660 ETIKYFMNNIECE--VFLVSLKAGGVALNLCEASQVFILDPWWNPSVEWQSGDRVHRIGQ 717

Query: 772 KKDCFIYRFISTGTIEEKIFQRQSMKMSLSSCVVDAKEDVERLFSSDNLRQLF 824
            +   I RF    +IE +I + Q  K ++    ++  E      +  +L+ LF
Sbjct: 718 FRPVKITRFCIEDSIESRIIELQEKKANMIHATINQDEAAIGRLTPADLQFLF 770

 Score = 63.2 bits (152), Expect = 6e-10,   Method: Compositional matrix adjust.
 Identities = 50/198 (25%), Positives = 87/198 (43%), Gaps = 43/198 (21%)

Query: 323 QNNRGAY-GCIMADEMGLGKTLQCIALMWTLLRQGPQGKRLIDKCIIVCPSSLVNNWANE 381
           Q   G + G ++ADEMG+GKT+Q IAL+   L + P         ++V P+  +  W NE
Sbjct: 179 QQEEGIFKGGVLADEMGMGKTIQTIALLMNDLTKRPS--------LVVAPTVALMQWKNE 230

Query: 382 LIKWLGPNTLTPLAVDGKKSSMGGGNTTVSQAIHAWAQAQGRNIVKPVLIISYETLR--- 438
           + +            DGK        T+ +  I   ++         V++ +Y  L    
Sbjct: 231 INQ----------HTDGKLKVYMFHGTSKNIDIKTLSEYD-------VVLTTYAVLESVF 273

Query: 439 --------------RNVDQLKNCNVGLMLADEGHRLKNGDSLTFTALDSISCPRRVILSG 484
                         + +  L N     ++ DE H +K+  S T  A++++   +R  L+G
Sbjct: 274 RKQNYGFKRKHGVVKELSVLHNIEFYRVILDEAHNIKDRQSNTARAVNNLKTQKRWCLTG 333

Query: 485 TPIQNDLSEYFALLSFSN 502
           TP+QN + E ++L+ F N
Sbjct: 334 TPLQNRIGEMYSLIRFLN 351

>KLLA0C05368g 481598..486415 some similarities with sgd|S0005717
            Saccharomyces cerevisiae YOR191w RIS1, hypothetical start
          Length = 1605

 Score = 81.6 bits (200), Expect = 2e-15,   Method: Compositional matrix adjust.
 Identities = 40/139 (28%), Positives = 80/139 (57%), Gaps = 2/139 (1%)

Query: 669  TESDDKIVLISNYTQTLDLIEKMCRYK-HYSAVRLDGTMSINKRQKLVDRFNDPEGQEFI 727
            + +D+K+V+ S +T   +++    +     + +R DG+MS ++R   ++ F        +
Sbjct: 1443 SNTDEKLVIFSQFTMFFEILGHFIKKNLGLNFLRYDGSMSSSQRSACIESFYQDNNYR-V 1501

Query: 728  FLLSSKAGGCGINLIGANRLILMDPDWNPAADQQALARVWRDGQKKDCFIYRFISTGTIE 787
             L+S KAG  G+ L  AN +IL DP WNP  ++QA+ R  R  Q+++ +++R +   ++E
Sbjct: 1502 MLISMKAGNSGLTLTCANHVILADPFWNPFVEEQAMDRCHRISQEREVYVHRLLIKMSVE 1561

Query: 788  EKIFQRQSMKMSLSSCVVD 806
            ++I + Q+ K +L +  +D
Sbjct: 1562 DRIVELQNKKKTLVNLAMD 1580

 Score = 70.5 bits (171), Expect = 5e-12,   Method: Compositional matrix adjust.
 Identities = 63/263 (23%), Positives = 113/263 (42%), Gaps = 54/263 (20%)

Query: 330  GCIMADEMGLGKTLQCIALMWTLLRQGPQGKRLIDKCIIVCPSSLVNNWANELIKWLGPN 389
            G ++AD+MGLGKT+Q +AL   L+   P+ K  I   ++V P +++  W +E+   +  +
Sbjct: 940  GGLLADDMGLGKTVQSLAL---LMANKPEPKSAIKTTLVVAPVAVLRVWKDEVAVKIKKD 996

Query: 390  TLTPLAVDGKKSSMGGGNTTVSQAIHAWAQAQGRNIVKPVLIISYETLRRN--------- 440
                  V+ K    GGG    S+   +W      +IV    ++SY+TL            
Sbjct: 997  ------VNVKVVIFGGGENNSSK-FRSWKDLAEYDIV----LVSYQTLASEFKKHWPLSW 1045

Query: 441  ----------------VDQLKNCNVGL------------MLADEGHRLKNGDSLTFTALD 472
                            ++Q+K+ +               ++ DE   +KN  +    A  
Sbjct: 1046 KNGEHQPDVHAVDLKLMNQVKSSDEYFSPFYRNDSEFYRVILDEAQNIKNKKTQAAKACC 1105

Query: 473  SISCPRRVILSGTPIQNDLSEYFALLSFSNPGLLGSRAEFRKNFENPILRGRDADATDKE 532
            +IS   R  LSGTPIQN++ E ++L+ F         A+F  +    +   +  D  D E
Sbjct: 1106 TISSTFRWALSGTPIQNNIGELYSLIRFLRIPPYNKEAKFHSDIGAVLNTKKPYDYNDSE 1165

Query: 533  ITKGEAQLQKLSTIVSKFIIRRT 555
              +    ++K+  ++   ++RRT
Sbjct: 1166 RQRA---MKKVQVLLRAIMLRRT 1185

>YOR191W (RIS1) [4987] chr15 (692475..697334) Protein involved in
            silencing, member of Snf2p DNA-dependent ATPase family
            [4860 bp, 1619 aa]
          Length = 1619

 Score = 81.6 bits (200), Expect = 2e-15,   Method: Compositional matrix adjust.
 Identities = 45/168 (26%), Positives = 90/168 (53%), Gaps = 7/168 (4%)

Query: 641  MPGSKARDVQTKYSAKFSILERFLHKIKTESDDKIVLISNYTQTLDLIEKMCRYK-HYSA 699
            +P  ++ +  TK      +++R   +  TE   KI++ S +T   +++E   + K ++  
Sbjct: 1433 VPNFESLEPSTKIEQCIQVIQRVFDESATE---KIIIFSQFTTFFEILEHFLKNKLNFPY 1489

Query: 700  VRLDGTMSINKRQKLVDRF-NDPEGQEFIFLLSSKAGGCGINLIGANRLILMDPDWNPAA 758
            ++  G+M+  +R  +++ F  DPE +  I L+S KAG  G+ L  AN ++++DP WNP  
Sbjct: 1490 LKYIGSMNAQRRSDVINEFYRDPEKR--ILLISMKAGNSGLTLTCANHVVIVDPFWNPYV 1547

Query: 759  DQQALARVWRDGQKKDCFIYRFISTGTIEEKIFQRQSMKMSLSSCVVD 806
            ++QA  R +R  Q K   +++     ++E++I + Q  K  +    +D
Sbjct: 1548 EEQAQDRCYRISQTKKVQVHKLFIKDSVEDRISELQKRKKEMVDSAMD 1595

 Score = 61.6 bits (148), Expect = 2e-09,   Method: Compositional matrix adjust.
 Identities = 59/213 (27%), Positives = 91/213 (42%), Gaps = 55/213 (25%)

Query: 325  NRGAYGCIMADEMGLGKTLQCIALMWTLLRQGPQGKRLIDKCIIVCPSSLVNNWANELIK 384
            N    G ++AD+MGLGKT+Q IALM  L  +  + K      +IV P S++  W  EL  
Sbjct: 959  NSAKKGGLLADDMGLGKTIQAIALM--LANRSEESK--CKTNLIVAPVSVLRVWKGELET 1014

Query: 385  WLGPNTLTPLAVDGKKSSMGGGNTTVSQAIHAWAQAQGRNIVK-PVLIISYETLR----- 438
             +         + G     G GN  V      W     R++ +   +++SY+TL      
Sbjct: 1015 KVKKRAKFTTFIFG-----GSGNGKVKH----W-----RDLARYDAVLVSYQTLANEFKK 1060

Query: 439  ---RNVDQLKN-------------------------CNVGL---MLADEGHRLKNGDSLT 467
               + +D  +N                         CN      +L DEG  +KN ++  
Sbjct: 1061 HWPKKLDGEQNQLPAVPHIQALNRLKTSNEYYSPFFCNDSTFYRILLDEGQNIKNKNTRA 1120

Query: 468  FTALDSISCPRRVILSGTPIQNDLSEYFALLSF 500
              A  +I+   R +LSGTPIQN + E ++L+ F
Sbjct: 1121 SKACCTINGMYRWVLSGTPIQNSMDELYSLIRF 1153

>Sklu_2412.7 YLR032W, Contig c2412 15481-18864
          Length = 1127

 Score = 77.8 bits (190), Expect = 2e-14,   Method: Compositional matrix adjust.
 Identities = 54/162 (33%), Positives = 86/162 (53%), Gaps = 5/162 (3%)

Query: 648  DVQTKYSAKFSILERFLHKIKTESDDKIVLISNYTQTLDLIEKMCRYKHYSA----VRLD 703
            D  +K S   S+L+      +T   +++V+ S ++  LD++E         A     + D
Sbjct: 946  DTSSKSSKICSLLKHLKQLQETCPGEQVVVFSQFSSYLDILENELTSSFSKADAKIYKFD 1005

Query: 704  GTMSINKRQKLVDRF-NDPEGQEFIFLLSSKAGGCGINLIGANRLILMDPDWNPAADQQA 762
            G +++  R +++D F      +  I LLS KAGG G+NL  A+R  +MDP W+P+ + QA
Sbjct: 1006 GRLNLKDRSRVLDTFATKDLSKLKILLLSLKAGGVGLNLTCASRAYMMDPWWSPSLEDQA 1065

Query: 763  LARVWRDGQKKDCFIYRFISTGTIEEKIFQRQSMKMSLSSCV 804
            + RV R GQ+ +  I RFI   +IEEK+   Q  K +L   V
Sbjct: 1066 IDRVHRIGQESNVKIIRFIMENSIEEKMLSIQDRKRTLGEAV 1107

 Score = 54.3 bits (129), Expect = 4e-07,   Method: Compositional matrix adjust.
 Identities = 54/209 (25%), Positives = 90/209 (43%), Gaps = 51/209 (24%)

Query: 330 GCIMADEMGLGKTLQCIALMWTL-----------LRQGPQG---------KRLIDKC-II 368
           G ++ADEMGLGKT+  +A++  +            R+   G         K    K  +I
Sbjct: 495 GGLLADEMGLGKTISTLAMISMVPCDTDPVEEKNKRENEIGMNDYGYKSDKPYASKTTLI 554

Query: 369 VCPSSLVNNWANELIKWLG-PNTLTPLAVDGKKSSMGGGNTTVSQAIHAWAQAQGRNIVK 427
           V P SL+  W  E  K    PN    +   G+    G   T +++  +            
Sbjct: 555 VVPMSLLFQWQKEFEKANNNPNAHCEIYYGGR---AGNLITLLTKTKNP----------P 601

Query: 428 PVLIISYETLRRNVDQLKNCN---------VGL-------MLADEGHRLKNGDSLTFTAL 471
            +++ SY  ++    +L  CN         +GL       ++ DEGH ++N  + T  A+
Sbjct: 602 TIILTSYGVIQSEWSKLPRCNNNRIEQGAAIGLFSVEFFRIVIDEGHSIRNRTTRTSKAV 661

Query: 472 DSISCPRRVILSGTPIQNDLSEYFALLSF 500
             +S  R+ +L+GTPI N L + F+L+ F
Sbjct: 662 MDLSSSRKWVLTGTPIINRLDDLFSLVKF 690

>Scas_674.12d
          Length = 1323

 Score = 76.6 bits (187), Expect = 5e-14,   Method: Compositional matrix adjust.
 Identities = 42/148 (28%), Positives = 80/148 (54%), Gaps = 9/148 (6%)

Query: 664  LHKIKTESD-DKIVLISNYTQTLDL----IEKMCRYKHYSAVRLDGTMSINKRQKLVDRF 718
            + K+   SD +KI++ S +T   D+    +EK+ +  +   ++  G M+  +R  ++ +F
Sbjct: 1156 IKKVFENSDTEKIIIFSQFTSFFDIFQHFLEKLLKVPY---LKYTGAMTAQQRADVITKF 1212

Query: 719  NDPEGQEFIFLLSSKAGGCGINLIGANRLILMDPDWNPAADQQALARVWRDGQKKDCFIY 778
               +  E I L+S KAG  G+ L  AN +I++DP WNP  ++QA  R +R  Q ++  ++
Sbjct: 1213 YR-QANERILLISMKAGNSGLTLTCANHVIIVDPFWNPYVEEQAQDRCYRISQTREVHVH 1271

Query: 779  RFISTGTIEEKIFQRQSMKMSLSSCVVD 806
            R     ++E++I + Q  K  +    +D
Sbjct: 1272 RLFIKDSVEDRIAELQEKKREMVDAAMD 1299

 Score = 58.2 bits (139), Expect = 2e-08,   Method: Compositional matrix adjust.
 Identities = 63/261 (24%), Positives = 107/261 (40%), Gaps = 57/261 (21%)

Query: 330 GCIMADEMGLGKTLQCIALMWTLLRQGPQGKRLIDKCIIVCPSSLVNNWANELIKWLGPN 389
           G ++AD+MGLGKT+Q IALM     +    K      +IV P +++  W  EL       
Sbjct: 671 GGLLADDMGLGKTVQGIALMLANRSKDQACK----TNLIVAPVAVLRVWGGEL------- 719

Query: 390 TLTPLAVDGKKSSM--GGGNTTVSQAIHAWAQAQGRNIVK---PVLIISYE-----TLRR 439
             T +  +   S+   GGG+      +  W +    + +    P L I ++     +L +
Sbjct: 720 -ETKIKKEANFSAFIYGGGD-----KLATWKELSEYDAIMVSYPTLAIEFKKHWPASLGK 773

Query: 440 NVDQLKN---------------------CNVGL---MLADEGHRLKNGDSLTFTALDSIS 475
           +  QL                       CN      ++ DEG  +KN  +    A  S+ 
Sbjct: 774 DQKQLPAIPQLAAMNSLKKKDEYFSPFFCNESTFYRIILDEGQNIKNKKTRAAKACCSLD 833

Query: 476 CPRRVILSGTPIQNDLSEYFALLSFSNPGLLGSRAEFRKNFENPILRGR-DADATDKEIT 534
              R + SGTPIQN + E ++L+ F           F  +   P LR   + D  D+   
Sbjct: 834 ATYRWVFSGTPIQNSMDELYSLIRFLRIPPYHREERFMADIGRPFLRKNGNYDDFDR--- 890

Query: 535 KGEAQLQKLSTIVSKFIIRRT 555
             +  ++K+  ++S  ++RR+
Sbjct: 891 --KQAIKKVQVLLSAIMLRRS 909

>KLLA0F12166g complement(1116715..1121301) weakly similar to
            sgd|S0004237 Saccharomyces cerevisiae YLR247c,
            hypothetical start
          Length = 1528

 Score = 59.3 bits (142), Expect = 1e-08,   Method: Compositional matrix adjust.
 Identities = 50/196 (25%), Positives = 99/196 (50%), Gaps = 25/196 (12%)

Query: 659  ILERFLHKIKTESDDKIVLISNYTQTLDLIEKMCRYKHYSAVRLDGTMSINKRQKLVDRF 718
            I ++ L K   + + +IV+ S+++  L ++  +    + +  R    +   K  K VD F
Sbjct: 1338 IKQQHLEKEPHKKNPQIVIFSSHSAFLSILSTLLTAHNVTHAR---PLRNTKFAKAVDTF 1394

Query: 719  -NDPEGQEFIFLLSSKAGGCGINLIGANRLILMDPDWNPAADQQALARVWRDGQKKDCFI 777
              DP       LL+  +   G+ L+ A  LIL++P  + + + QA++R+ R GQK   ++
Sbjct: 1395 RKDPNCT--CLLLNVHSQSTGLTLVNARHLILLEPIMDSSTEAQAISRIHRIGQKDVTYV 1452

Query: 778  YRFISTGTIEEKIFQRQS------------MKMSLSSCVV-DAKEDVERLFSSDNLRQLF 824
            + F+   T+EE I + ++            ++ S S   V +A++++ER FS DN+ +  
Sbjct: 1453 WNFMVRNTVEESIMKYKAVLEGKKKKKTEELRASGSKISVEEAEQEIERNFSMDNITE-- 1510

Query: 825  QKNENTICETHETYHC 840
               +++  +TH  +HC
Sbjct: 1511 ---DDSEGKTH-LWHC 1522

 Score = 41.2 bits (95), Expect = 0.005,   Method: Compositional matrix adjust.
 Identities = 20/63 (31%), Positives = 34/63 (53%), Gaps = 12/63 (19%)

Query: 332 IMADEMGLGKTLQCIALMWTLLRQ------------GPQGKRLIDKCIIVCPSSLVNNWA 379
           ++ADEMGLGKT++ + L+ T +R               +  R +   +IVCP S++  W 
Sbjct: 354 VLADEMGLGKTIEILTLISTNVRNLSNESSSFVSPINEKEVRRVKTNLIVCPESILQQWI 413

Query: 380 NEL 382
           +E+
Sbjct: 414 DEI 416

>AAL030C [157] [Homologous to ScYLR247C - SH] (284758..289377) [4620
            bp, 1539 aa]
          Length = 1539

 Score = 57.8 bits (138), Expect = 4e-08,   Method: Compositional matrix adjust.
 Identities = 36/124 (29%), Positives = 65/124 (52%), Gaps = 5/124 (4%)

Query: 674  KIVLISNYTQTLDLIEKMCRYKHYSAVRLDGTMSINKRQKLVDRFN-DPEGQEFIFLLSS 732
            +IV+ S Y + L+++  +   K  S   L  T ++    K+V+ F  DPE      LL +
Sbjct: 1359 QIVIYSQYAELLEIVAHVL--KQNSIKFLTTTKNVRNFAKVVETFKADPEIT--CLLLDT 1414

Query: 733  KAGGCGINLIGANRLILMDPDWNPAADQQALARVWRDGQKKDCFIYRFISTGTIEEKIFQ 792
            K    G+ LI A  + L++P  N + + QA+ R+ R GQ  + +++ F+   T+E  I +
Sbjct: 1415 KRQASGLTLINATHVFLLEPIVNNSTEFQAINRIHRIGQTSETYVWHFMLLNTVEHSILR 1474

Query: 793  RQSM 796
             +S+
Sbjct: 1475 YKSI 1478

 Score = 32.3 bits (72), Expect = 2.1,   Method: Compositional matrix adjust.
 Identities = 19/67 (28%), Positives = 37/67 (55%), Gaps = 15/67 (22%)

Query: 332 IMADEMGLGKTLQCIAL--------------MWTLLRQGPQGKRLIDKCIIVCPSSLVNN 377
           ++++EMGLGKT++ +AL              ++ ++  G + +R +   +IVCP  +V  
Sbjct: 381 MLSEEMGLGKTVEVLALLLLRPRAMDPVEEQVYEVVSTGKRMRR-VKTNLIVCPQVIVQQ 439

Query: 378 WANELIK 384
           W +E+ K
Sbjct: 440 WLDEIAK 446

>Kwal_14.1287
          Length = 1518

 Score = 57.0 bits (136), Expect = 6e-08,   Method: Compositional matrix adjust.
 Identities = 39/150 (26%), Positives = 76/150 (50%), Gaps = 17/150 (11%)

Query: 674  KIVLISNYTQTLDLIEKMCRYKHYSAVRLDGTMSINKRQKLVDRFN-DPEGQEFIFLLSS 732
            +I++ S Y++ L L+ K+ + +H  +++   T    K  K+V++F  +PE      LL+ 
Sbjct: 1332 QIIIYSQYSEFLGLLSKVLK-QH--SIQHCNTAGSGKFSKIVEKFKKNPEVT--CLLLNV 1386

Query: 733  KAGGCGINLIGANRLILMDPDWNPAADQQALARVWRDGQKKDCFIYRFIS---------- 782
                 G+ L+ A  + +MDP  N + + QA+ R  R GQ ++ +++ F+           
Sbjct: 1387 TRQATGLTLVNATHVFIMDPIMNTSDELQAINRTHRIGQTRETYVWNFVVRNTVEQNIVR 1446

Query: 783  -TGTIEEKIFQRQSMKMSLSSCVVDAKEDV 811
              G +EE+I  RQ +K   S  +   +E++
Sbjct: 1447 LKGVLEERIASRQRLKTQPSKTIPMKREEI 1476

 Score = 40.4 bits (93), Expect = 0.008,   Method: Compositional matrix adjust.
 Identities = 23/61 (37%), Positives = 35/61 (57%), Gaps = 10/61 (16%)

Query: 332 IMADEMGLGKTLQCIALMWTLLRQ---GP----QGKRLIDKC---IIVCPSSLVNNWANE 381
           ++++EMGLGKTL+ +ALM    R     P      K+ I K    +IVCP S++  W +E
Sbjct: 356 VLSEEMGLGKTLEILALMLVHKRTINGAPTFLSDSKKTILKTATNLIVCPDSILQQWIDE 415

Query: 382 L 382
           +
Sbjct: 416 V 416

>YLR247C (YLR247C) [3643] chr12 complement(628686..633356) Protein
            containing an SNF2 related N-terminal domain, a C3HC4
            type (RING) zinc finger, and a helicase conserved
            C-terminal domain, has a region of low similarity to a
            region of transcription termination factor RNA polymerase
            II (human TTF2) [4671 bp, 1556 aa]
          Length = 1556

 Score = 56.6 bits (135), Expect = 9e-08,   Method: Compositional matrix adjust.
 Identities = 37/156 (23%), Positives = 79/156 (50%), Gaps = 13/156 (8%)

Query: 649  VQTKYSAKFSILERFLHKIKTESDD------KIVLISNYTQTLDLIEKMCRYKHYSAVRL 702
            ++  + AK   + + +  ++ +S+       +++L S  T+ L +I K+ +  H     +
Sbjct: 1350 IKESFGAKIDFVIKLISYLRLKSEQENADPPQVILYSQKTEYLKVIGKVLKLYH-----I 1404

Query: 703  DGTMSINKRQKLVDRFNDPEGQEFI--FLLSSKAGGCGINLIGANRLILMDPDWNPAADQ 760
            +    ++    + +  N+ + Q  +   LL+ K  G G+NLI A  + L+DP  N + + 
Sbjct: 1405 EHLACLSNTANVGETINNFKRQPSVTCLLLNVKTLGAGLNLINAKHIFLLDPILNNSDEL 1464

Query: 761  QALARVWRDGQKKDCFIYRFISTGTIEEKIFQRQSM 796
            QA+ R  R GQ ++ F++ F+   T+EE I + + +
Sbjct: 1465 QAMGRNNRIGQDEETFVWNFMIRNTVEENILRYKCI 1500

 Score = 33.1 bits (74), Expect = 1.2,   Method: Compositional matrix adjust.
 Identities = 63/327 (19%), Positives = 121/327 (37%), Gaps = 67/327 (20%)

Query: 273 PHQVEGVRFLYRCVTGLVMKDYLEAEAFNTSSEDPLKSDEKALTESQKTEQNNRGAYGCI 332
           P +V G   L+  +TG ++     A  +N   ++ L  D     +              +
Sbjct: 343 PDEV-GPSLLWNKLTGYILTTEDAAHLYNQYRKERLSGDYPVCAKG-------------V 388

Query: 333 MADEMGLGKTLQCIALMW-----------TLLRQGPQGKRLIDKCIIVCPSSLVNNWANE 381
           +A+EMGLGKT++ ++L+            T +    +        +I+CP++++  W  E
Sbjct: 389 LAEEMGLGKTIEILSLILLNRRKLKDSEATFIDDENRTITKTKTTLIICPNAILKQWLEE 448

Query: 382 LIKWLGPNTLTPLAVDGKKSSMGGGNTTVSQAIHAWAQAQGRNIVKPVLIISYETLRRNV 441
           +   L  N+L      G    M     TV +A+    Q         +++ SY  +   V
Sbjct: 449 I--ELHANSLKWYTYRGYNEIMKDC-KTVDEAVQQLCQYD-------IIVTSYNIIATEV 498

Query: 442 DQLK-----------------NCNVGLM-----LADEGHRLKNGDSLTFTALDSISCPRR 479
              +                 +  + LM     + DE   L++  + +      +     
Sbjct: 499 HHAEFNRSIRSRRLKSPKYDYSSPLALMQFYRIILDEVQMLRSSSTYSAKCTSLLHRIHT 558

Query: 480 VILSGTPIQNDLSEYFALLSFSNPGLLGSRAEFRKNFENPI-LRGRDADATDKEITKGEA 538
             +SGTPIQN +  +  ++S+          +F +  +  I LR    D T  +      
Sbjct: 559 WGVSGTPIQN-IYNFRMIMSYLKLHPFCDEVDFIRTLQEEIKLRNEAKDYTSNDFV---C 614

Query: 539 QLQKLSTIVSKFIIRRTNDILAKYLPC 565
           QL+ +     +F I+   +I  +Y  C
Sbjct: 615 QLKGV-----RFSIKDCMNIFYRYDLC 636

>Scas_573.9
          Length = 1502

 Score = 52.0 bits (123), Expect = 2e-06,   Method: Compositional matrix adjust.
 Identities = 24/65 (36%), Positives = 39/65 (60%)

Query: 728  FLLSSKAGGCGINLIGANRLILMDPDWNPAADQQALARVWRDGQKKDCFIYRFISTGTIE 787
             LL+ K  G G+NL+ A  + L+DP  N + + QA+ R  R GQK + +++  I   ++E
Sbjct: 1384 LLLNVKTLGAGLNLLNARHIFLLDPIINHSDELQAMNRNNRIGQKYETYVWNLIINNSVE 1443

Query: 788  EKIFQ 792
            E IF+
Sbjct: 1444 ENIFK 1448

 Score = 40.0 bits (92), Expect = 0.011,   Method: Compositional matrix adjust.
 Identities = 19/60 (31%), Positives = 33/60 (55%), Gaps = 10/60 (16%)

Query: 332 IMADEMGLGKTLQCIALMWTLLRQGPQGKRLIDK----------CIIVCPSSLVNNWANE 381
           ++++EMGLGKT++ +AL+    R   +    ID            +IVCP++++  W NE
Sbjct: 372 LLSEEMGLGKTIEVLALIMLNKRDVIKEDSFIDDQNKTIRRTNLTLIVCPNAILTQWINE 431

>CAGL0B05049g 487186..491598 some similarities with tr|Q06554
            Saccharomyces cerevisiae YLR247c, hypothetical start
          Length = 1470

 Score = 50.8 bits (120), Expect = 4e-06,   Method: Compositional matrix adjust.
 Identities = 22/65 (33%), Positives = 41/65 (63%)

Query: 728  FLLSSKAGGCGINLIGANRLILMDPDWNPAADQQALARVWRDGQKKDCFIYRFISTGTIE 787
             LL+ ++ G G+NL+ A  + L+DP  N   + QA++R  R GQ+++ +++ F+   T+E
Sbjct: 1350 LLLNIRSLGAGLNLLNARHIFLLDPILNVNEEIQAMSRNNRIGQRQETYVWNFMLENTVE 1409

Query: 788  EKIFQ 792
            E I +
Sbjct: 1410 ESIMR 1414

 Score = 46.2 bits (108), Expect = 1e-04,   Method: Compositional matrix adjust.
 Identities = 34/119 (28%), Positives = 59/119 (49%), Gaps = 21/119 (17%)

Query: 278 GVRFLYRCVTGLVMKDYLEAEAFN--TSSEDPLKSDEKALTESQKTEQNNRGAYGCIMAD 335
            V F Y  +  LV K +     +     S++ ++S + +  E +       GA G ++A+
Sbjct: 304 SVSFGYSTIKDLVSKQFYFWNKYTGYILSQEEVRSLKSSFNEYE------VGAKG-VLAE 356

Query: 336 EMGLGKTLQCIALMWTLLRQG---------PQGKRLIDKC---IIVCPSSLVNNWANEL 382
           EMGLGKTL+ +AL+    R+           +  ++I KC   +IVCP S++  W +E+
Sbjct: 357 EMGLGKTLEILALICINKRKYKADEPLDFVSESGKVISKCSTTLIVCPGSILKQWIDEM 415

>Sklu_2234.2 YOR191W, Contig c2234 6350-9366 reverse complement
          Length = 1006

 Score = 43.9 bits (102), Expect = 7e-04,   Method: Compositional matrix adjust.
 Identities = 34/125 (27%), Positives = 58/125 (46%), Gaps = 30/125 (24%)

Query: 330  GCIMADEMGLGKTLQCIALMWTLLRQGPQGKRLIDKC---IIVCPSSLVNNWANELIKWL 386
            G ++AD+MGLGKT+Q IALM          +  ++ C   +IV P +++  W  E+   +
Sbjct: 906  GGLLADDMGLGKTVQAIALMIA-------NRSELESCKTNLIVAPVAVLRVWQAEIQTKI 958

Query: 387  GPNTLTPLAVDGKKSSMGGGNTTVSQAIHAWAQAQGRNIVK-PVLIISYETLRRNVDQLK 445
              N      +       GG N  VS           +++++   +++SY+TL     +LK
Sbjct: 959  KKNATFKAFI------YGGNNKVVSY----------KDLLRYDAVLVSYQTL---ASELK 999

Query: 446  NCNVG 450
            N   G
Sbjct: 1000 NIGRG 1004

>Sklu_2432.9 , Contig c2432 20306-24733 reverse complement
          Length = 1475

 Score = 42.7 bits (99), Expect = 0.001,   Method: Compositional matrix adjust.
 Identities = 21/65 (32%), Positives = 34/65 (52%)

Query: 728  FLLSSKAGGCGINLIGANRLILMDPDWNPAADQQALARVWRDGQKKDCFIYRFISTGTIE 787
             L++ K    G+ L  A  +ILM+P       +QA+ R+ R GQ KD F++  ++  T E
Sbjct: 1352 LLMNPKWCSRGLKLTNATHVILMEPMSEGRIQEQAVERIHRIGQGKDTFVWHLMTRNTAE 1411

Query: 788  EKIFQ 792
            E   +
Sbjct: 1412 ESTLK 1416

 Score = 33.9 bits (76), Expect = 0.76,   Method: Compositional matrix adjust.
 Identities = 17/62 (27%), Positives = 33/62 (53%), Gaps = 12/62 (19%)

Query: 332 IMADEMGLGKTLQCIALMWTLLRQG----------PQGKRLIDK--CIIVCPSSLVNNWA 379
           I++D+ GLGKT++ +AL+    R+           P+G+ ++     +I CP  ++  W 
Sbjct: 353 ILSDDTGLGKTVETLALVCLHRRKFRPDEPRSYTLPEGREILKAKTTLICCPGPILQQWL 412

Query: 380 NE 381
           +E
Sbjct: 413 DE 414

>KLLA0F23716g join(complement(2216857..2218129), some similarities
           with ca|CA1415|CaDBP2.exon2 Candida albicans
           ATP-dependent RNA helicase of DEAD box family, exon 2
           (by homology), hypothetical start
          Length = 554

 Score = 35.0 bits (79), Expect = 0.25,   Method: Compositional matrix adjust.
 Identities = 37/153 (24%), Positives = 70/153 (45%), Gaps = 15/153 (9%)

Query: 660 LERFLHKIKTESDDKIVLISNYTQTLDLIEKMCRYKHYSAVRLDGTMSINKRQKLVDRFN 719
           L + L     + D KI++ ++  +T D I    R + + A+ + G  + N+R  ++  F 
Sbjct: 348 LAKHLETASQDQDSKIIIFASTKRTCDEITSYLRTEGWPALAIHGDKAQNERDWVLAEFR 407

Query: 720 DPEGQEFIFLLSSKAGGCGINLIGANRLILMDPDWNPAADQQALARVWRDGQKKDCFIYR 779
              G+  I ++++     GI++ G N +I  D    P   +  + R+ R G        R
Sbjct: 408 --SGRSPI-MVATDVAARGIDVKGINYVINYD---MPGNIEDYVHRIGRTG--------R 453

Query: 780 FISTGT-IEEKIFQRQSMKMSLSSCVVDAKEDV 811
             STGT I       +S+  +L   + +AK+D+
Sbjct: 454 AGSTGTAISFFTEGNKSLGAALIKIMREAKQDI 486

>CAGL0L10230g 1098614..1099747 similar to sp|Q08446 Saccharomyces
           cerevisiae YOR057w SGT1 suppressor of G2 allele of SKP1,
           start by similarity
          Length = 377

 Score = 32.7 bits (73), Expect = 1.4,   Method: Compositional matrix adjust.
 Identities = 22/56 (39%), Positives = 32/56 (57%), Gaps = 6/56 (10%)

Query: 48  HIPPAAGRIATGS--DNIVGGRSLRKRSATVCYSGLDINADEAEYN-SQDISFSQL 100
           HIPP A   ATG+  D++    S +K+   + +S +DI+ DE + N S D  F QL
Sbjct: 276 HIPPTATTNATGNNRDSLSYPNSSKKK---IDWSKIDIDDDETDQNQSTDAFFQQL 328

>YML091C (RPM2) [3880] chr13 complement(87123..90731) Bifunctional
           protein that acts as the protein component of
           mitochondrial Ribonuclease P (RNase P) involved in tRNA
           maturation, and is also required for optimal translation
           of certain mitochondrial mRNAs [3609 bp, 1202 aa]
          Length = 1202

 Score = 32.0 bits (71), Expect = 2.5,   Method: Compositional matrix adjust.
 Identities = 17/45 (37%), Positives = 26/45 (57%), Gaps = 1/45 (2%)

Query: 359 GKRLIDKCIIVCPSSL-VNNWANELIKWLGPNTLTPLAVDGKKSS 402
            K++IDKC+ VCP S+ + N  N +I  +    LT L ++  K S
Sbjct: 804 NKQIIDKCLEVCPDSIELKNIVNLMISKIPGRNLTQLIINNPKFS 848

>Kwal_34.16080
          Length = 290

 Score = 31.6 bits (70), Expect = 2.7,   Method: Compositional matrix adjust.
 Identities = 18/42 (42%), Positives = 28/42 (66%), Gaps = 3/42 (7%)

Query: 784 GTIEEKIFQRQSMKMSLSSCVV-DAKEDVERLFSSDNLRQLF 824
           G+IEEKI+ RQ  K  L++ ++ D K+  +R F S+ L+ LF
Sbjct: 4   GSIEEKIYHRQIFKQFLTNKILTDPKQ--KRFFKSNELQDLF 43

>CAGL0C03399g 341755..343191 similar to sp|P39008 Saccharomyces
           cerevisiae YNR052c POP2, start by similarity
          Length = 478

 Score = 30.8 bits (68), Expect = 5.6,   Method: Compositional matrix adjust.
 Identities = 16/33 (48%), Positives = 22/33 (66%), Gaps = 1/33 (3%)

Query: 434 YETLRRNVDQLKNCNVGLMLADE-GHRLKNGDS 465
           Y+T+R NVD L    +GL L+DE G++  NG S
Sbjct: 264 YQTMRANVDFLNPIQLGLSLSDENGNKPDNGPS 296

>KLLA0D08932g 751943..752779 similar to sp|P09064 Saccharomyces
           cerevisiae YPL237w SUI3 translation initiation factor
           eIF2 beta subunit singleton, start by similarity
          Length = 278

 Score = 30.4 bits (67), Expect = 6.4,   Method: Compositional matrix adjust.
 Identities = 38/135 (28%), Positives = 56/135 (41%), Gaps = 30/135 (22%)

Query: 484 GTPIQNDLSEYFALLSFSNPGLLGSRAEFRKNFENPILRGRDAD----ATDKEI------ 533
           G P Q+ LS +F +L+ +NP L G R+  +     PI + RD      A  +EI      
Sbjct: 121 GLPYQDLLSRFFKILNTNNPELAGDRSGPKFKIPPPICQ-RDGKKTIFANIQEISEKLQR 179

Query: 534 --------------TKGEAQLQKLSTIVSKFIIRRTNDILAKYL----PCKYEHVIFVNL 575
                         T G    QK   I  KF+ ++  ++L +Y+     CK    I   L
Sbjct: 180 SPEHVIQYLFAELGTSGSVDGQKRLVIKGKFLPKQMENLLRRYILEYVTCKTCKSINTVL 239

Query: 576 KPLQ-NELYNKLIKS 589
           K  Q N L+  + KS
Sbjct: 240 KKEQSNRLFFLVCKS 254

  Database: blastdb
    Posted date:  Apr 3, 2006  3:33 PM
  Number of letters in database: 16,596,109
  Number of sequences in database:  34,618
  
Lambda     K      H
   0.317    0.134    0.391 

Gapped
Lambda     K      H
   0.267   0.0410    0.140 

Matrix: BLOSUM62
Gap Penalties: Existence: 11, Extension: 1
Number of Sequences: 34618
Number of Hits to DB: 28,687,720
Number of extensions: 1256946
Number of successful extensions: 5587
Number of sequences better than 10.0: 141
Number of HSP's gapped: 5382
Number of HSP's successfully gapped: 230
Length of query: 883
Length of database: 16,596,109
Length adjustment: 111
Effective length of query: 772
Effective length of database: 12,753,511
Effective search space: 9845710492
Effective search space used: 9845710492
Neighboring words threshold: 11
Window for multiple hits: 40
X1: 16 ( 7.3 bits)
X2: 38 (14.6 bits)
X3: 64 (24.7 bits)
S1: 41 (21.7 bits)
S2: 66 (30.0 bits)