Hit NameLength (aa)HSP LengthHSP ScoreHSP Significance
YGL146C31130616250.0
Scas_669.162772123617e-41
Sklu_1742.22512393152e-34
Kwal_23.34542582442523e-25
KLLA0E09207g2572692296e-22
AGR377C2271861635e-13
ABR092C100132627.8
BLASTP 2.2.26 [Sep-21-2011]

Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, 
Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), 
"Gapped BLAST and PSI-BLAST: a new generation of protein database search
programs",  Nucleic Acids Res. 25:3389-3402.

Reference for compositional score matrix adjustment: Altschul, Stephen F., 
John C. Wootton, E. Michael Gertz, Richa Agarwala, Aleksandr Morgulis,
Alejandro A. Schaffer, and Yi-Kuo Yu (2005) "Protein database searches
using compositionally adjusted substitution matrices", FEBS J. 272:5101-5109.

Query= YGL146C
         (306 letters)

Database: blastdb 
           34,618 sequences; 16,596,109 total letters

Searching..................................................done

                                                                 Score    E
Sequences producing significant alignments:                      (bits) Value

YGL146C (YGL146C) [1841] chr7 complement(228754..229689) Protein...   630   0.0  
Scas_669.16                                                           143   7e-41
Sklu_1742.2 YGL146C, Contig c1742 1815-2570 reverse complement        125   2e-34
Kwal_23.3454                                                          101   3e-25
KLLA0E09207g complement(825533..826306) weakly similar to sp|P53...    93   6e-22
AGR377C [4688] [Homologous to ScYGL146C - SH] (1425385..1426068)...    67   5e-13
ABR092C [683] [Homologous to ScYKL064W (MNR2) - SH] (551738..554...    28   7.8  

>YGL146C (YGL146C) [1841] chr7 complement(228754..229689) Protein
           with similarity to Bunyamwera virus RNA-directed RNA
           polymerase [936 bp, 311 aa]
          Length = 311

 Score =  630 bits (1625), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 306/306 (100%), Positives = 306/306 (100%)

Query: 1   MEKASLNIAQTKEIPLTDRRMGLRGWKACSRPHLLGRILLFMSILFITSAELSSDVSSRE 60
           MEKASLNIAQTKEIPLTDRRMGLRGWKACSRPHLLGRILLFMSILFITSAELSSDVSSRE
Sbjct: 1   MEKASLNIAQTKEIPLTDRRMGLRGWKACSRPHLLGRILLFMSILFITSAELSSDVSSRE 60

Query: 61  VYMPIFNNKLSFKVPPIKRSLLLGAALYEDFEYSSNNSASDGAFCTVFNAGMNDASREVV 120
           VYMPIFNNKLSFKVPPIKRSLLLGAALYEDFEYSSNNSASDGAFCTVFNAGMNDASREVV
Sbjct: 61  VYMPIFNNKLSFKVPPIKRSLLLGAALYEDFEYSSNNSASDGAFCTVFNAGMNDASREVV 120

Query: 121 FEIHVMDVLQEETDSSRFGGTSHERGRQSLGFSVFNNKNGDLLRSKKNLASGTSVIEVNP 180
           FEIHVMDVLQEETDSSRFGGTSHERGRQSLGFSVFNNKNGDLLRSKKNLASGTSVIEVNP
Sbjct: 121 FEIHVMDVLQEETDSSRFGGTSHERGRQSLGFSVFNNKNGDLLRSKKNLASGTSVIEVNP 180

Query: 181 GNCNEFLICFINLVYDGSWSSIDTEKSVTIKMTYNDKLDPDMLLHLVNQMTPQVVKALNT 240
           GNCNEFLICFINLVYDGSWSSIDTEKSVTIKMTYNDKLDPDMLLHLVNQMTPQVVKALNT
Sbjct: 181 GNCNEFLICFINLVYDGSWSSIDTEKSVTIKMTYNDKLDPDMLLHLVNQMTPQVVKALNT 240

Query: 241 VSDGLFQIVSDTTLLQMESDRRDINEATYSYLIVGFVSLMVAQLISNIIVTTYLIIKIKS 300
           VSDGLFQIVSDTTLLQMESDRRDINEATYSYLIVGFVSLMVAQLISNIIVTTYLIIKIKS
Sbjct: 241 VSDGLFQIVSDTTLLQMESDRRDINEATYSYLIVGFVSLMVAQLISNIIVTTYLIIKIKS 300

Query: 301 NPSSHI 306
           NPSSHI
Sbjct: 301 NPSSHI 306

>Scas_669.16
          Length = 277

 Score =  143 bits (361), Expect = 7e-41,   Method: Compositional matrix adjust.
 Identities = 77/212 (36%), Positives = 132/212 (62%), Gaps = 5/212 (2%)

Query: 93  YSSNN--SASDGAFCTVFNAGMNDASREVVFEIHVMDVLQEETDSSRFGGTSHERGRQSL 150
           Y+ NN     + + C + N  ++  S+E+VF I V +VL  + D +RFGGTS E+G+Q L
Sbjct: 55  YTPNNFNVNKNESICIILNTELHKQSQELVFGITVQEVLPYKIDFTRFGGTSSEKGKQKL 114

Query: 151 GFSVFNNKNGDLLRSKKNLASGTSVIEVNPGNCNEFLICFINLVYDGSWSSIDTEKSVTI 210
             +VF  ++G+LL+S ++L +GT++ ++NP   N+F  CF NLV+D SW+SI+  K + +
Sbjct: 115 YLTVFGLRSGNLLQSTRDLLTGTTLFQLNPDGENDFEFCFQNLVFDRSWNSINAIKLIKL 174

Query: 211 KMTYNDKLDPDMLLHLVNQMTPQVVKALNTVSDGLFQIVSDT---TLLQMESDRRDINEA 267
             + ND L+P++  +L  Q T +  K L+     L  I ++T    LL +ES  RDINE 
Sbjct: 175 FTSANDILNPELNKYLETQYTSRAAKRLHKADFTLSNIQNNTLIKELLPLESSHRDINED 234

Query: 268 TYSYLIVGFVSLMVAQLISNIIVTTYLIIKIK 299
            +S ++ GF +L+ A +++++I   +L +++K
Sbjct: 235 IFSRMLNGFAALVFAVIVTSLIQLRFLYLRLK 266

>Sklu_1742.2 YGL146C, Contig c1742 1815-2570 reverse complement
          Length = 251

 Score =  125 bits (315), Expect = 2e-34,   Method: Compositional matrix adjust.
 Identities = 81/239 (33%), Positives = 127/239 (53%), Gaps = 24/239 (10%)

Query: 61  VYMPIFNNKLSFKVPPIKRSLLLGAALYEDFEYSSNNSASDGAFCTVFNAGMNDASREVV 120
           +  P    KLS KVPP+K S +       + +Y           C  F++     + +V 
Sbjct: 20  ISFPSNGQKLSLKVPPVKDSRV------REGDYGKYTQ------CITFDSSTE--TEDVT 65

Query: 121 FEIHVMDVLQEETDSSRFGGTSHERGRQSLGFSVFNNKNGDLLRSKKNLASGTSVIEVNP 180
           F I V + L  ETD  RFG  S  RG+Q L   +F+  + +LLR  ++L +G +V++VN 
Sbjct: 66  FVISVQESLPYETDIDRFGPISSARGKQFLQLEIFDEYD-NLLRGTRHLPNGDNVLQVNT 124

Query: 181 GNCNEFLICFINLVYDGSWSSIDTEKSVTIKMTYNDK-LDPDMLLHLVNQMTPQVVKALN 239
              ++F IC INLVYDGSW SID EK VTI +T  DK L+P + +     +T +    LN
Sbjct: 125 HGSSQFRICLINLVYDGSWKSIDVEKDVTITVTRRDKLLNPSLKI-----ITEEDCDLLN 179

Query: 240 TVSDGLFQIV---SDTTLLQMESDRRDINEATYSYLIVGFVSLMVAQLISNIIVTTYLI 295
            V + LF +V   +  TL  +E + RD+NE+++  L+   + + V   + N ++  Y++
Sbjct: 180 EVKEDLFHMVNVKTTQTLTDIEREHRDLNESSFELLMYQLIMVGVLSFLGNCVMVPYVV 238

>Kwal_23.3454
          Length = 258

 Score =  101 bits (252), Expect = 3e-25,   Method: Compositional matrix adjust.
 Identities = 76/244 (31%), Positives = 116/244 (47%), Gaps = 30/244 (12%)

Query: 69  KLSFKVPPIKRSLLLGAALYEDFEYSSNNSASDGAFCTVFNAGMNDASREVVFEIHVMDV 128
           +LSF  PPIK S +   AL++D            A C  F    N  S      I V D 
Sbjct: 37  QLSFVCPPIKVSQV--GALWQD-----------NATCFGFEVDPNSFS--ATLAIEVTDT 81

Query: 129 LQEETDSSRFGGTSHERGRQSLGFSVFNNKNGDLLRSKKNLASGTSVIEVNPGNCNEFL- 187
           +  + D SRF   S ERG+QSL  ++  + + +LLR++ NL +G + I+V   +    L 
Sbjct: 82  ISYKIDWSRFDSNSCERGKQSLDLTI-TDCSDNLLRARNNLRTGKTFIKVRRQDSEPTLN 140

Query: 188 ICFINLVYDGSWSSIDTEKSVTIKMTYNDKLDPDMLLHLVNQMTPQVVKALNTVSDG--- 244
           +CFIN VYD SW SID +K++T+ +        D       ++  Q  KA N +S     
Sbjct: 141 LCFINRVYDCSWKSIDMDKTITVTLI-------DFDSRQTKELKEQTEKAANELSTNAGE 193

Query: 245 ---LFQIVSDTTLLQMESDRRDINEATYSYLIVGFVSLMVAQLISNIIVTTYLIIKIKSN 301
              L        L ++ES+RRD NE T+S L+   +  +    I N ++  Y+  +  S 
Sbjct: 194 LLPLLLPKEKQELFKLESNRRDFNEETFSQLLYAQILYITVLFIFNALIVAYVATRRASQ 253

Query: 302 PSSH 305
            S++
Sbjct: 254 SSNY 257

>KLLA0E09207g complement(825533..826306) weakly similar to sp|P53117
           Saccharomyces cerevisiae YGL146c hypothetical protein
           singleton, hypothetical start
          Length = 257

 Score = 92.8 bits (229), Expect = 6e-22,   Method: Compositional matrix adjust.
 Identities = 69/269 (25%), Positives = 131/269 (48%), Gaps = 23/269 (8%)

Query: 42  MSILFITSAELSSDVSSREVYMPIFNNKLSFKVPPIKRSLLLGAALYEDFEYSSNNSASD 101
           M I  I    L   V S  + +PI  N+L F + P K+             +  + S+  
Sbjct: 1   MVISLIYVLLLICSVVSETLKLPINPNRLEFDLWPYKK-------------WEVDGSSDA 47

Query: 102 GAFCTVFNAGMNDASREVVFEIHVMDVLQEETDSSRFGGTSHERGRQSLGFSVFNNKNGD 161
            ++ T F    N  ++++ F I + +  + + +  RFG T+  +G+Q +   +++ ++ +
Sbjct: 48  SSYQTCFEMNTNIKAKDLQFLIEIEEFTKWKVNVDRFGPTTSSKGKQVVNMDIYD-EDQN 106

Query: 162 LLRSKKNLASGTSVIEVNPGNCNEFLICFINLVYDGSWSSIDTEKSVTIKMTYNDKLDPD 221
           L++S+  L +G +V+ V+      F IC IN   D SW++ID+ K V I +T ND +   
Sbjct: 107 LVQSRHGLENGETVLYVSVYEHQNFQICLINFSLDSSWNAIDSVKQVAISITSNDLIQKQ 166

Query: 222 MLLHLVNQMTPQVVKALNTVSDGLFQIVSDTT---LLQMESDRRDINEATYSYLIVGFVS 278
                 + +T   +  L+   D LF +VS  +   L  ++ D R++NE+T+SYL+     
Sbjct: 167 KW----DLITDDDLNLLSQGRDDLFSLVSADSGQELHALDVDHRNLNESTFSYLLAKVTI 222

Query: 279 LMVAQLISNIIVTTYLIIKI--KSNPSSH 305
           L     + +++V   L+ +I  K  P+ +
Sbjct: 223 LFCIIGVCHLLVFPILLYRIVSKGQPTKN 251

>AGR377C [4688] [Homologous to ScYGL146C - SH] (1425385..1426068)
           [684 bp, 227 aa]
          Length = 227

 Score = 67.4 bits (163), Expect = 5e-13,   Method: Compositional matrix adjust.
 Identities = 52/186 (27%), Positives = 86/186 (46%), Gaps = 17/186 (9%)

Query: 91  FEYSSNNSASDGAFCTVFNAGMNDASREVVFEIHVMDVLQEETDSSRFGGTSHERGRQSL 150
           +E +      +   C  + AG   A   +   +   D +    D +RFG TS + GRQ L
Sbjct: 22  WEVAPRKVGREVYECVRWEAGRAGA---LSVRVRRTDRVGHAVDEARFGPTSVQLGRQQL 78

Query: 151 GFSVFNNKNGDLLRSKKNLASGTSV-IEVNPGNCNEFLICFINLVYDGSWSSIDTEKSVT 209
           G  V++ +   L+R ++  A G +V    NP    +  +C IN+  D SW +IDT  +V 
Sbjct: 79  GLEVWDTEANVLVRDRRVPAHGRTVRFSANPA--QQVDVCLINVSRDASWRAIDTVAAVE 136

Query: 210 IKMTYNDKLDPDMLLHLVNQMTPQVVKALNTVS-DGLFQIVSDTTLLQMESDRRDINEAT 268
           + +  +    P         +T   +  L  V  D   Q  +D  +L  E  RRD+NE+T
Sbjct: 137 VAVHADAGRVP---------LTEDDMAVLAAVERDTRAQQTAD-AVLGSEHVRRDLNEST 186

Query: 269 YSYLIV 274
           Y++++V
Sbjct: 187 YTWVVV 192

>ABR092C [683] [Homologous to ScYKL064W (MNR2) - SH]
           (551738..554743) [3006 bp, 1001 aa]
          Length = 1001

 Score = 28.5 bits (62), Expect = 7.8,   Method: Compositional matrix adjust.
 Identities = 14/32 (43%), Positives = 20/32 (62%), Gaps = 2/32 (6%)

Query: 153 SVFNNKNGDLLRSKKNLASGTSVIEVNPGNCN 184
           SV++N  GD  R+  N A+GT+ +   PGN N
Sbjct: 450 SVYSNSGGD--RAGSNNANGTAAVSHAPGNIN 479

  Database: blastdb
    Posted date:  Apr 3, 2006  3:33 PM
  Number of letters in database: 16,596,109
  Number of sequences in database:  34,618
  
Lambda     K      H
   0.319    0.134    0.377 

Gapped
Lambda     K      H
   0.267   0.0410    0.140 

Matrix: BLOSUM62
Gap Penalties: Existence: 11, Extension: 1
Number of Sequences: 34618
Number of Hits to DB: 9,654,526
Number of extensions: 403165
Number of successful extensions: 1108
Number of sequences better than 10.0: 14
Number of HSP's gapped: 1097
Number of HSP's successfully gapped: 14
Length of query: 306
Length of database: 16,596,109
Length adjustment: 101
Effective length of query: 205
Effective length of database: 13,099,691
Effective search space: 2685436655
Effective search space used: 2685436655
Neighboring words threshold: 11
Window for multiple hits: 40
X1: 16 ( 7.4 bits)
X2: 38 (14.6 bits)
X3: 64 (24.7 bits)
S1: 41 (21.8 bits)
S2: 61 (28.1 bits)