Hit NameLength (aa)HSP LengthHSP ScoreHSP Significance
YGL144C (ROG1)68567334070.0
Scas_669.1469067120090.0
CAGL0E04950g67366919660.0
Kwal_23.346466866019400.0
ADL285C64465818180.0
KLLA0E14872g67765116670.0
YDL109C64768014990.0
Scas_613.1462857613870.0
CAGL0H10340g5925828891e-111
Kwal_47.184826236447662e-92
AER322C6366237568e-91
KLLA0B01375g6406407411e-88
YDR444W6876487362e-87
CAGL0M10043g6586526958e-82
Scas_717.506586496503e-75
Kwal_55.217034412131835e-14
AFR386C5042461773e-13
CAGL0L10318g4572301764e-13
YOR059C4502241683e-12
Scas_698.394712231603e-11
Sklu_2393.45462281604e-11
ADR202C4432291551e-10
KLLA0F16709g5312201515e-10
Kwal_27.101022582201431e-09
Sklu_2232.44452121452e-09
KLLA0F16423g4592141452e-09
Scas_632.2294457740.83
CAGL0M01496g95143740.98
Scas_662.159932693.1
YDR039C (ENA2)109199684.2
YDR038C (ENA5)109199684.2
KLLA0B04224g27963665.3
KLLA0C06589g94944675.7
AFL179C64573667.3
Scas_707.259471659.8
BLASTP 2.2.26 [Sep-21-2011]

Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, 
Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), 
"Gapped BLAST and PSI-BLAST: a new generation of protein database search
programs",  Nucleic Acids Res. 25:3389-3402.

Reference for compositional score matrix adjustment: Altschul, Stephen F., 
John C. Wootton, E. Michael Gertz, Richa Agarwala, Aleksandr Morgulis,
Alejandro A. Schaffer, and Yi-Kuo Yu (2005) "Protein database searches
using compositionally adjusted substitution matrices", FEBS J. 272:5101-5109.

Query= YGL144C
         (673 letters)

Database: blastdb 
           34,618 sequences; 16,596,109 total letters

Searching..................................................done

                                                                 Score    E
Sequences producing significant alignments:                      (bits) Value

YGL144C (ROG1) [1843] chr7 complement(232453..234510) Protein of...  1316   0.0  
Scas_669.14                                                           778   0.0  
CAGL0E04950g 478626..480647 similar to sp|P53118 Saccharomyces c...   761   0.0  
Kwal_23.3464                                                          751   0.0  
ADL285C [1456] [Homologous to ScYGL144C - SH; ScYDL109C - SH] (2...   704   0.0  
KLLA0E14872g 1326334..1328367 similar to sp|P53118 Saccharomyces...   646   0.0  
YDL109C (YDL109C) [760] chr4 complement(265258..267201) Protein ...   582   0.0  
Scas_613.14                                                           538   0.0  
CAGL0H10340g 1007564..1009342 similar to sp|P53118 Saccharomyces...   347   e-111
Kwal_47.18482                                                         299   2e-92
AER322C [2823] [Homologous to ScYDR444W - SH] (1229579..1231489)...   295   8e-91
KLLA0B01375g 110709..112631 similar to sgd|S0002852 Saccharomyce...   290   1e-88
YDR444W (YDR444W) [1264] chr4 (1350278..1352341) Protein of unkn...   288   2e-87
CAGL0M10043g complement(999113..1001089) similar to tr|Q04093 Sa...   272   8e-82
Scas_717.50                                                           254   3e-75
Kwal_55.21703                                                          75   5e-14
AFR386C [3578] [Homologous to NOHBY] (1131324..1132838) [1515 bp...    73   3e-13
CAGL0L10318g complement(1103690..1105063) similar to tr|Q08448 S...    72   4e-13
YOR059C (YOR059C) [4867] chr15 complement(438907..440259) Protei...    69   3e-12
Scas_698.39                                                            66   3e-11
Sklu_2393.4 , Contig c2393 3530-5170 reverse complement                66   4e-11
ADR202C [1943] [Homologous to ScYOR059C - SH] (1060157..1061488)...    64   1e-10
KLLA0F16709g 1539612..1541207 weakly similar to ca|CA1159|IPF134...    63   5e-10
Kwal_27.10102                                                          60   1e-09
Sklu_2232.4 YOR059C, Contig c2232 3289-4626                            60   2e-09
KLLA0F16423g complement(1516717..1518096) similar to sgd|S000558...    60   2e-09
Scas_632.22                                                            33   0.83 
CAGL0M01496g complement(171045..173900) similar to tr|Q04175 Sac...    33   0.98 
Scas_662.1                                                             31   3.1  
YDR039C (ENA2) [892] chr4 complement(531302..534577) Member of t...    31   4.2  
YDR038C (ENA5) [891] chr4 complement(527417..530692) Member of t...    31   4.2  
KLLA0B04224g complement(382676..383515) no similarity, hypotheti...    30   5.3  
KLLA0C06589g 575605..578454 similar to sgd|S0002803 Saccharomyce...    30   5.7  
AFL179C [3016] [Homologous to ScYNR008W (LRO1) - SH] (101798..10...    30   7.3  
Scas_707.2                                                             30   9.8  

>YGL144C (ROG1) [1843] chr7 complement(232453..234510) Protein of
           unknown function, has high similarity to uncharacterized
           S. cerevisiae Ydl109p [2058 bp, 685 aa]
          Length = 685

 Score = 1316 bits (3407), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 643/673 (95%), Positives = 643/673 (95%)

Query: 1   MSLTPTNEILFHYKSSVKVGELERYVITYHLYDGEEIPPDLNLNSLWLKVRNMNPLSYRA 60
           MSLTPTNEILFHYKSSVKVGELERYVITYHLYDGEEIPPDLNLNSLWLKVRNMNPLSYRA
Sbjct: 1   MSLTPTNEILFHYKSSVKVGELERYVITYHLYDGEEIPPDLNLNSLWLKVRNMNPLSYRA 60

Query: 61  AYLMGPFMLYCDVKTAQYHHSQKIVASVDYPKFEPNVQTQQDFVAELSVHNIRQKYVWIA 120
           AYLMGPFMLYCDVKTAQYHHSQKIVASVDYPKFEPNVQTQQDFVAELSVHNIRQKYVWIA
Sbjct: 61  AYLMGPFMLYCDVKTAQYHHSQKIVASVDYPKFEPNVQTQQDFVAELSVHNIRQKYVWIA 120

Query: 121 DVMSQILFTTNTNVTYEVTIGTSKESVENPHDLPSHLGSYSPKLTVNRLTTLDLWNLPVQ 180
           DVMSQILFTTNTNVTYEVTIGTSKESVENPHDLPSHLGSYSPKLTVNRLTTLDLWNLPVQ
Sbjct: 121 DVMSQILFTTNTNVTYEVTIGTSKESVENPHDLPSHLGSYSPKLTVNRLTTLDLWNLPVQ 180

Query: 181 ITTPQKKKHLVVLTHGLHSNVSTDLVYIMEQIYKAQKNYPHEQIVVKGYRGNVCQTEKGV 240
           ITTPQKKKHLVVLTHGLHSNVSTDLVYIMEQIYKAQKNYPHEQIVVKGYRGNVCQTEKGV
Sbjct: 181 ITTPQKKKHLVVLTHGLHSNVSTDLVYIMEQIYKAQKNYPHEQIVVKGYRGNVCQTEKGV 240

Query: 241 KYLGTRLAEYIIQDLYDESIRKISFVGHSLGGLIQAFAIAYIYEVYPWFFKKVNPINFIT 300
           KYLGTRLAEYIIQDLYDESIRKISFVGHSLGGLIQAFAIAYIYEVYPWFFKKVNPINFIT
Sbjct: 241 KYLGTRLAEYIIQDLYDESIRKISFVGHSLGGLIQAFAIAYIYEVYPWFFKKVNPINFIT 300

Query: 301 LASPLLGIVTDNPAYIKVLLSFGVIGKTGQDLGLENDVEVGKXXXXXXXXXXXXXXXRRF 360
           LASPLLGIVTDNPAYIKVLLSFGVIGKTGQDLGLENDVEVGK               RRF
Sbjct: 301 LASPLLGIVTDNPAYIKVLLSFGVIGKTGQDLGLENDVEVGKPLLYLLSGLPLIEILRRF 360

Query: 361 KRRTVYANAINDGIVPLYTASLLFLDYNDILEQLQKLKENSKKSPLINDASTPVNQDFFN 420
           KRRTVYANAINDGIVPLYTASLLFLDYNDILEQLQKLKENSKKSPLINDASTPVNQDFFN
Sbjct: 361 KRRTVYANAINDGIVPLYTASLLFLDYNDILEQLQKLKENSKKSPLINDASTPVNQDFFN 420

Query: 421 KTFISPLTKMLSILAPQKFPTENGSEIPKVSFFESASSILLPPLPERAYIMDPDSRDPVI 480
           KTFISPLTKMLSILAPQKFPTENGSEIPKVSFFESASSILLPPLPERAYIMDPDSRDPVI
Sbjct: 421 KTFISPLTKMLSILAPQKFPTENGSEIPKVSFFESASSILLPPLPERAYIMDPDSRDPVI 480

Query: 481 IHDKIYNEDDIPQSEFDIEDGFFGKKNILLQAFFAGKKERAKYRNLEETIARRWHEGMAW 540
           IHDKIYNEDDIPQSEFDIEDGFFGKKNILLQAFFAGKKERAKYRNLEETIARRWHEGMAW
Sbjct: 481 IHDKIYNEDDIPQSEFDIEDGFFGKKNILLQAFFAGKKERAKYRNLEETIARRWHEGMAW 540

Query: 541 RKVVVALKPDAHNNIIVRRKFANAYGWPVIDHLIDVHFXXXXXXXXXXXXXXXSTQVVEP 600
           RKVVVALKPDAHNNIIVRRKFANAYGWPVIDHLIDVHF               STQVVEP
Sbjct: 541 RKVVVALKPDAHNNIIVRRKFANAYGWPVIDHLIDVHFNGDDDDDNDENDDINSTQVVEP 600

Query: 601 IQSVTEGKKKYRKAENIPQEYGWLNKVETNGVFDEGPTGMISTVGEIVEALAKRGFSAVI 660
           IQSVTEGKKKYRKAENIPQEYGWLNKVETNGVFDEGPTGMISTVGEIVEALAKRGFSAVI
Sbjct: 601 IQSVTEGKKKYRKAENIPQEYGWLNKVETNGVFDEGPTGMISTVGEIVEALAKRGFSAVI 660

Query: 661 DRRNASEDPNDEV 673
           DRRNASEDPNDEV
Sbjct: 661 DRRNASEDPNDEV 673

>Scas_669.14
          Length = 690

 Score =  778 bits (2009), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 383/671 (57%), Positives = 489/671 (72%), Gaps = 32/671 (4%)

Query: 7   NEILFHYKSSVKVGELERYVITYHLYDGEEIPPDLNLNSLWLKVRNMNPLSYRAAYLMGP 66
           N++L+  KS++   + +RY+ITY+LYD EEIP D+ L+ L+L+++N+ P+SYRAAYLMGP
Sbjct: 2   NDLLYQNKSTLGAAQQDRYIITYNLYDTEEIPSDIKLDPLYLRIKNIEPISYRAAYLMGP 61

Query: 67  FMLYCDVKTAQYHHSQKIVASVDYPKFEPNVQTQQDFVAELSVHNIRQKYVWIADVMSQI 126
           F+LYCDV+   YHHSQ+I ++ D P+FE N+   QD +  LS+H I+++YVWI DV+SQI
Sbjct: 62  FILYCDVRLETYHHSQRIYSTCDQPQFESNLLPSQDAIWSLSLHQIQKRYVWIVDVVSQI 121

Query: 127 LFTTNTNVTYEVTIGTSKESVENPHDLPSHLGSYSPKLTVNRLTTLDLWNLPVQITTP-- 184
           LFTTNT++TYE+++G +KES+ +  +    LGS   +L V +L TLDLW LPVQ+     
Sbjct: 122 LFTTNTDITYEISMGYTKESLHHSIN-NERLGS--DRLVVTKLNTLDLWKLPVQLAPSDR 178

Query: 185 -QKKKHLVVLTHGLHSNVSTDLVYIMEQIYKAQKNYPHEQIVVKGYRGNVCQTEKGVKYL 243
            +++KHLV+LTHGLHSN++ D+ YIMEQIYK+Q NYP+EQIVV GY GN+CQTE+GVKYL
Sbjct: 179 RRRRKHLVILTHGLHSNLTVDMEYIMEQIYKSQDNYPNEQIVVDGYPGNICQTERGVKYL 238

Query: 244 GTRLAEYIIQDLYDESIRKISFVGHSLGGLIQAFAIAYIYEVYPWFFKKVNPINFITLAS 303
           G RLA+YI+ +LYD SI KISF+GHSLGGL+Q FAIAYI   YPWFF+KV PINFI +AS
Sbjct: 239 GERLAKYIVNELYDASIVKISFIGHSLGGLVQTFAIAYINVKYPWFFQKVQPINFIAMAS 298

Query: 304 PLLGIVTDNPAYIKVLLSFGVIGKTGQDLGLENDVEVGKXXXXXXXXXXXXXXXRRFKRR 363
           PLLGIVTDNPAY+K+LLSFGVIGKTGQDLGL+   E  +                +FKRR
Sbjct: 299 PLLGIVTDNPAYVKLLLSFGVIGKTGQDLGLDRVSETDRPLLYLLPGEPTRSVLLKFKRR 358

Query: 364 TVYANAINDGIVPLYTASLLFLDYNDILEQLQKLKENSKKSPLINDASTPVNQDFFNKTF 423
           T+YANAINDGIVPLYTASLLFLDY+DILEQL K  E+ + +    + + P N   FNK F
Sbjct: 359 TLYANAINDGIVPLYTASLLFLDYDDILEQLHK-NEDEELAKDEQNVTIPENTASFNKNF 417

Query: 424 ISPLTKMLSILAPQKFPTENGSEIPKVSFFESASSILLPPLPERAYIMDPDSRDPVIIHD 483
           ISPLTKMLSI APQKFP    S++PKVS  +SA+SILLPPLP++ Y+++P +R PVIIHD
Sbjct: 418 ISPLTKMLSIWAPQKFPQGPDSKLPKVSMLQSATSILLPPLPDQEYLLNPKARHPVIIHD 477

Query: 484 KIYNEDDIPQSEFDIEDGFFGKKNILLQAFFAGKKERAKYRNLEETIARRWHEGMAWRKV 543
           K Y ++D+P+ + ++ED FF  +N+LLQAF   K  R +Y+ LEE+IARRWHEGM+WRKV
Sbjct: 478 KTYTQEDLPKGDTELEDTFFNSENMLLQAFTDIKAGRKRYQKLEESIARRWHEGMSWRKV 537

Query: 544 VVALKPDAHNNIIVRRKFANAYGWPVIDHLIDVHFXXXXXXXXXXXXX-------XXSTQ 596
           VVALKPDAHNNIIVRR+FANAYGW VIDHLI VHF                       + 
Sbjct: 538 VVALKPDAHNNIIVRRRFANAYGWNVIDHLIGVHFNGDDRLEEEQTKAGLEAPLPNDQSS 597

Query: 597 VVEPIQSVTEGKKKYRKAENIPQEYGWLNKVETNGVFDEGPTGMISTVGEIVEALAKRGF 656
           V+EPI                  EY W+ K E+  +FDEGPTGMIST+GE++E   K   
Sbjct: 598 VIEPI-----------------DEYAWVTKAESESLFDEGPTGMISTMGEMLETFTKTHL 640

Query: 657 SAVIDRRNASE 667
            A I  +N+SE
Sbjct: 641 -ATISNKNSSE 650

>CAGL0E04950g 478626..480647 similar to sp|P53118 Saccharomyces
           cerevisiae YGL144c or tr|Q12103 Saccharomyces cerevisiae
           YDL109c, hypothetical start
          Length = 673

 Score =  761 bits (1966), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 375/669 (56%), Positives = 490/669 (73%), Gaps = 27/669 (4%)

Query: 8   EILFHYKSSVKVGELERYVITYHLYDGEEIPPDLNLNSLWLKVRNMNPLSYRAAYLMGPF 67
           +IL+HY+SSVKVGE+ERY+I Y LY+ +EIP DL L+SL+++++N +PLS+RA YL GPF
Sbjct: 9   DILYHYRSSVKVGEIERYLIEYILYEDDEIPDDLKLDSLYVRLKNCSPLSFRAGYLAGPF 68

Query: 68  MLYCDVKTAQYHHSQKIVASVDYPKFEPNVQTQQDFVAELSVHNIRQKYVWIADVMSQIL 127
           +LY DV++  YHHSQ IV+S DYP+FE N+Q QQ  V ELS+HNI+ KYVWI DV+SQIL
Sbjct: 69  ILYGDVRSNNYHHSQHIVSSADYPQFEANLQAQQVKVMELSLHNIQSKYVWILDVVSQIL 128

Query: 128 FTTNTNVTYEVTIGTSKESVENPHDLPS--HLGSYSPKLTVNRLTTLDLWNLPVQITTPQ 185
           FTTNTNV +EVT+G  ++ +E  +++    HLGS S  L V+RLTT DLW LP ++   +
Sbjct: 129 FTTNTNVPFEVTVGMDRKMLEENNEIECLPHLGSTSNNLIVSRLTTDDLWKLPRELAPKK 188

Query: 186 KKKHLVVLTHGLHSNVSTDLVYIMEQIYKAQKNYPHEQIVVKGYRGNVCQTEKGVKYLGT 245
             KHLV+LTHGLHSNVS DL Y+ME+IYK+Q N+P+E ++V GY  NVC+TEKGV+YLGT
Sbjct: 189 DIKHLVILTHGLHSNVSADLSYLMEEIYKSQANFPNEILIVDGYFDNVCETEKGVRYLGT 248

Query: 246 RLAEYIIQDLYDESIRKISFVGHSLGGLIQAFAIAYIYEVYPWFFKKVNPINFITLASPL 305
           RLA+YII +LYD  ++KISFVGHSLGGL+Q FAI  +   YPWFF KV P+NFIT+ASP+
Sbjct: 249 RLADYIIDNLYDADVKKISFVGHSLGGLVQTFAIGNLAARYPWFFDKVKPVNFITIASPM 308

Query: 306 LGIVTDNPAYIKVLLSFGVIGKTGQDLGLENDVEVGKXXXXXXXXXXXXXXXRRFKRRTV 365
           LGIVTDNPAYI +LLSFGV+G+TG+DL L+ D+   K               R+F+RRT+
Sbjct: 309 LGIVTDNPAYINLLLSFGVVGRTGKDLNLDVDLPDEKPLLYSLSGEFIRSILRKFERRTI 368

Query: 366 YANAINDGIVPLYTASLLFLDYNDILEQLQKLKEN-SKKSPLINDASTPVNQDFFNKTFI 424
           YANA+NDGIVPLYT+ LL+LDY+ IL++L++ +EN S   P  N+ +   N  FFNK FI
Sbjct: 369 YANAVNDGIVPLYTSGLLYLDYDAILKKLREKEENKSLSGP--NNITVSDNTAFFNKNFI 426

Query: 425 SPLTKMLSILAPQKFPTENGSEIPKVSFFESASSILLPPLPERAYIMDPDSRDPVIIHDK 484
           SPLTKMLS+ APQKFP E+  +IPKVSFF+SA+SILLPPLP+  +I++P  R+ +IIHDK
Sbjct: 427 SPLTKMLSLWAPQKFP-ESDPKIPKVSFFQSAASILLPPLPDINFIVNPKHRNDIIIHDK 485

Query: 485 IYNEDDIPQSEFDIEDGFFGKKNILLQAFFAGKKERAKYRNLEETIARRWHEGMAWRKVV 544
           IY E+DI   E D +  FF  KNI LQA      E+ KY+ LE+TIA RWH+G++WRKV+
Sbjct: 486 IYTEEDIKDVEKDPDSSFFNNKNIFLQALSTVTSEKTKYQELEKTIAIRWHKGLSWRKVI 545

Query: 545 VALKPDAHNNIIVRRKFANAYGWPVIDHLIDVHFXXXXXXXXXXXXXXXSTQVVEPIQSV 604
           VALKPDAHNNIIVRR+F+NAYGWPVIDHLI  HF                       ++ 
Sbjct: 546 VALKPDAHNNIIVRRRFSNAYGWPVIDHLISEHFSG---------------------ENF 584

Query: 605 TEGKKKYRKAENIPQEYGWLNKVETNGVFDEGPTGMISTVGEIVEALAKRGFSAVIDRRN 664
               +K        ++  W+ + + +G+F EGPTGMISTVGEIVE+ AK+ FS ++D   
Sbjct: 585 EMDSQKDVSITTTREDLNWIKRPDEDGLFKEGPTGMISTVGEIVESFAKKRFSNLVDATA 644

Query: 665 ASEDPNDEV 673
           ++E+   E+
Sbjct: 645 SNEESLREI 653

>Kwal_23.3464
          Length = 668

 Score =  751 bits (1940), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 366/660 (55%), Positives = 469/660 (71%), Gaps = 23/660 (3%)

Query: 9   ILFHYKSSVKVGELERYVITYHLYDGEE-IPPDLNLNSLWLKVRNMNPLSYRAAYLMGPF 67
           +++H KSSVKVGE+ERY+I+Y LYD +E +P DLNLNSLWLKVRN+   ++RAAYLMGP+
Sbjct: 6   VVYHAKSSVKVGEMERYIISYQLYDDDEGLPADLNLNSLWLKVRNIESFTFRAAYLMGPY 65

Query: 68  MLYCDVKTAQYHHSQKIVASVDYPKFEPNVQTQQDFVAELSVHNIRQKYVWIADVMSQIL 127
           +LYCDV+ + YHHSQ++  S D P FEP +Q QQDF+ ELS+HN+++ YVW+ DV+SQI+
Sbjct: 66  LLYCDVRASDYHHSQRLFVSADQPTFEPTLQPQQDFITELSLHNLKKTYVWVVDVVSQII 125

Query: 128 FTTNTNVTYEVTIGTSKESVENPHDLPSHLGSYSPKLTVNRLTTLDLWNLPVQITT-PQK 186
           FTT T V +EV++GTS++ +    +     GS   KL V RLT+LDLWNLPVQ++T   +
Sbjct: 126 FTTTTQVGFEVSVGTSRKCLAKSSEFSPVSGSLESKLNVTRLTSLDLWNLPVQLSTHTHQ 185

Query: 187 KKHLVVLTHGLHSNVSTDLVYIMEQIYKAQKNYPHEQIVVKGYRGNVCQTEKGVKYLGTR 246
           K+HLV+LTHGLHSNV  D+ Y+ EQI K QK YP EQIVVKG+ GNVC+TEKG+ YLGTR
Sbjct: 186 KEHLVILTHGLHSNVHADMFYLKEQIEKCQKYYPEEQIVVKGFNGNVCKTEKGINYLGTR 245

Query: 247 LAEYIIQDLYDESIRKISFVGHSLGGLIQAFAIAYIYEVYPWFFKKVNPINFITLASPLL 306
           LAEYI+++LY E ++KISF+GHSLGGL+Q FAIAYI+  YPWFF+ V+PINFITLA+PLL
Sbjct: 246 LAEYIVKELYHERVKKISFIGHSLGGLVQTFAIAYIHVKYPWFFQNVSPINFITLATPLL 305

Query: 307 GIVTDNPAYIKVLLSFGVIGKTGQDLGLENDVEVGKXXXXXXXXXXXXXXXRRFKRRTVY 366
           GIVTDNPAY+ +LLSFG++GKTGQDLGL    + GK               R FKRRT+Y
Sbjct: 306 GIVTDNPAYVNILLSFGIVGKTGQDLGLTELSKDGKPLLYLLPGKPTKTVLRMFKRRTIY 365

Query: 367 ANAINDGIVPLYTASLLFLDYNDILEQLQKLKENSKKSPLINDASTPVNQDFFNKTFISP 426
           ANA+NDGIVPLY+ASLLFLDY D+L QL+       K  L    S+  + DF ++ F+SP
Sbjct: 366 ANAVNDGIVPLYSASLLFLDYEDVLGQLK------TKPELRERLSSNTSSDFISRNFLSP 419

Query: 427 LTKMLSILAPQKFPTENGSEIPKVSFFESASSILLPPLPERAYIMDPDSRDPVIIHDKIY 486
           ++K +S  APQKFP +   +IPKVS  ESA+S+L+PPLPE+ YIM+P SR+ +IIHDKIY
Sbjct: 420 ISKAISFWAPQKFPDDGSLKIPKVSVIESATSVLIPPLPEKTYIMNPSSRENIIIHDKIY 479

Query: 487 NEDDIPQSEFDIEDGFFGKKNILLQAFFAGKKERAKYRNLEETIARRWHEGMAWRKVVVA 546
            + ++P  E   E       N LL+AF   +      R LEE IARRWHEG++WRKVVV 
Sbjct: 480 CDQEVPPRESQSEKELLESNNTLLKAF--TRSSGKDNRRLEEEIARRWHEGISWRKVVVG 537

Query: 547 LKPDAHNNIIVRRKFANAYGWPVIDHLIDVHFXXXXXXXXXXXXXXXSTQVVEPIQSVTE 606
           LKPDAHNNIIVRR+F+NAYGWPV+DHL   HF                T  V+  Q+  E
Sbjct: 538 LKPDAHNNIIVRRRFSNAYGWPVVDHLTQNHFNSMDDESEEMDSMV--TNSVKSDQTSPE 595

Query: 607 GKKKYRKAENIPQEYGWLNKVETNGVFDEGPTGMISTVGEIVEALAKRGFSAVIDRRNAS 666
             K+ R          W+       +FD GPTGMISTVGEI++++AK  F  +I R N +
Sbjct: 596 DHKEDR---------SWMFDNGKETMFDVGPTGMISTVGEILDSMAKNSF--MIHRSNGA 644

>ADL285C [1456] [Homologous to ScYGL144C - SH; ScYDL109C - SH]
           (201714..203648) [1935 bp, 644 aa]
          Length = 644

 Score =  704 bits (1818), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 350/658 (53%), Positives = 460/658 (69%), Gaps = 43/658 (6%)

Query: 1   MSLTPTNEILFHYKSSVKVGELERYVITYHLYDGEEIPPDLNLNSLWLKVRNMNPLSYRA 60
           M   P  E+L+HY+SSV++GE+ERYVITY LYD EE+P  + L+SLWLKV+N++ L+YRA
Sbjct: 1   MGTEPAREVLYHYRSSVRIGEVERYVITYDLYDEEELPERIQLSSLWLKVKNVSSLTYRA 60

Query: 61  AYLMGPFMLYCDVKTAQYHHSQKIVASVDYPKFEPNVQTQQDFVAELSVHNIRQKYVWIA 120
           AYLMGP+MLYCD++T  YHHSQK+ +S D P+FEP +Q Q +F+AELS+H ++++YVW+ 
Sbjct: 61  AYLMGPYMLYCDLRTEDYHHSQKLFSSADMPQFEPAMQPQHEFLAELSLHRLQKRYVWLL 120

Query: 121 DVMSQILFTTNTNVTYEVTIGTSKESVENPHDLPSHLGSYSPKLTVNRLTTLDLWNLPVQ 180
           DV+SQI+FTTN+ V +EVTI ++K ++E+   L    GS++ +LTVNR TTLDLWNLP Q
Sbjct: 121 DVVSQIIFTTNSVVPFEVTIASAKPALEDTATLAPQAGSFNRRLTVNRQTTLDLWNLPQQ 180

Query: 181 ITTP-QKKKHLVVLTHGLHSNVSTDLVYIMEQIYKAQKNYPHEQIVVKGYRGNVCQTEKG 239
           +     K +HLVVLTHGLHSNV+ D+ Y+ E I + Q+ YP+E IVVKG+  NVC+TEKG
Sbjct: 181 VFDDYTKPEHLVVLTHGLHSNVTADMQYLKETIEQCQQYYPNEHIVVKGFGDNVCKTEKG 240

Query: 240 VKYLGTRLAEYIIQDLYDESIRKISFVGHSLGGLIQAFAIAYIYEVYPWFFKKVNPINFI 299
           +KYLG RL EYI++ LY+E I++ISF+GHSLGGL Q FAIAYI   YPWFF+KV+P+NF+
Sbjct: 241 IKYLGGRLGEYIVKQLYNERIKRISFIGHSLGGLTQTFAIAYIAINYPWFFEKVDPVNFV 300

Query: 300 TLASPLLGIVTDNPAYIKVLLSFGVIGKTGQDLGLENDVEVGKXXXXXXXXXXXXXXXRR 359
            L+SPLLGIVT+NPAY+ +LLS GV+GKTGQDLGL+      +               R+
Sbjct: 301 ALSSPLLGIVTNNPAYVNILLSMGVVGKTGQDLGLQAHQGDDQPLLCSLPGHTTRRILRK 360

Query: 360 FKRRTVYANAINDGIVPLYTASLLFLDYNDILEQLQKLKENSKKSPLINDASTPVNQDFF 419
           FK+RT+YANA+NDGIVPLYT++LL+LDY+ IL+QL   +    K            QDFF
Sbjct: 361 FKKRTLYANAVNDGIVPLYTSALLYLDYDSILKQLDTQEYQVDK------------QDFF 408

Query: 420 NKTFISPLTKMLSILAPQKFPTENGSEIPKVSFFESASSILLPPLPERAYIMDPDSRDPV 479
            KT I+PL K +++L PQ   T++ S IPKVS F+SA S+LLPPLPE++Y+M+P     V
Sbjct: 409 TKTLINPLVKAINVLMPQ---TQSSSSIPKVSMFDSAMSVLLPPLPEKSYLMNPSGDPSV 465

Query: 480 IIHDKIYNEDDIPQSEFDIEDGFFGKKNILLQAFFAGKKERAKYRNLEETIARRWHEGMA 539
           I+HDK+Y+E DIP      E G   +KNI   +         +Y+ LEE IA++WH+GM 
Sbjct: 466 ILHDKMYSEADIP------EVGQPPEKNI-WSSLLLNIGNNEEYKQLEEEIAKKWHKGMT 518

Query: 540 WRKVVVALKPDAHNNIIVRRKFANAYGWPVIDHLIDVHFXXXXXXXXXXXXXXXSTQVVE 599
           WRKV+V LKPDAHNNIIVRR+FANAYGWPVIDHL+  HF                     
Sbjct: 519 WRKVIVHLKPDAHNNIIVRRRFANAYGWPVIDHLVQNHFNGSDY---------------- 562

Query: 600 PIQSVTEGKKKYRKA-ENIPQEYGWLNKVETNGVFDEGPTGMISTVGEIVEALAKRGF 656
                TEG+ +     E I QE  W+N+      FD GPTGMIS+VGEI+E +    F
Sbjct: 563 ---PYTEGETEEAALDELIEQEKKWINRPHNETFFDVGPTGMISSVGEILENIKNSAF 617

>KLLA0E14872g 1326334..1328367 similar to sp|P53118 Saccharomyces
           cerevisiae YGL144c, start by similarity
          Length = 677

 Score =  646 bits (1667), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 317/651 (48%), Positives = 441/651 (67%), Gaps = 48/651 (7%)

Query: 7   NEILFHYKSSVKVGELERYVITYHLYDGEEIPPDLNLNSLWLKVRNMNPLSYRAAYLMGP 66
           ++I++H++SS+++GELERY+ TY LY G+EIP DL L+SLWLK++N+  ++ RAAYLMGP
Sbjct: 32  HDIMYHFQSSLRIGELERYIFTYDLYMGDEIPSDLTLDSLWLKIKNIENVTLRAAYLMGP 91

Query: 67  FMLYCDVKTAQYHHSQKIVASVDYPKFEPNVQTQQDFVAELSVHNIRQKYVWIADVMSQI 126
           ++LY DV+T  YHH Q++  S D P+FE N+Q QQDF+AELS+HN++++YVWI D+ SQI
Sbjct: 92  YVLYADVRTKDYHHKQRLFISADQPQFESNIQPQQDFIAELSLHNLKKRYVWIVDIASQI 151

Query: 127 LFTTNTNVTYEVTIGTSKESVENPHDLPSHLGSYSPKLTVNRLTTLDLWN--LPVQITTP 184
           LFT   ++ + +T+G SKES+         LG  S ++ V+RLTT DLWN  L  +    
Sbjct: 152 LFTKQASINFSITVGGSKESISVDSARNIQLGVQSSRMKVDRLTTADLWNASLLSKSVFG 211

Query: 185 QKKKHLVVLTHGLHSNVSTDLVYIMEQIYKAQKNYPHEQIVVKGYRGNVCQTEKGVKYLG 244
           ++K+HLV+LTHGLHSNV++DL YI EQI K Q N   E +VVKG+  NVC+TEKG+K+LG
Sbjct: 212 RRKEHLVILTHGLHSNVTSDLFYIKEQIEKTQ-NQHEEMLVVKGFTDNVCKTEKGIKWLG 270

Query: 245 TRLAEYIIQDLYDESIRKISFVGHSLGGLIQAFAIAYIYEVYPWFFKKVNPINFITLASP 304
           TRLAE+I+ +LY+++  KISF+GHSLGGL+Q+FAIAYI   YP FF++V P+NFIT+ASP
Sbjct: 271 TRLAEHIVHNLYNDATVKISFIGHSLGGLVQSFAIAYISYNYPKFFEQVEPVNFITMASP 330

Query: 305 LLGIVTDNPAYIKVLLSFGVIGKTGQDLGLENDVEVGK-XXXXXXXXXXXXXXXRRFKRR 363
           +LGIV+DN  YI+ LL+ G+ GKTGQDL L+    + +                + FK  
Sbjct: 331 MLGIVSDNAVYIQRLLAMGIAGKTGQDLSLQTYNGLKQPLLQTLSSSSALRRILKCFKSC 390

Query: 364 TVYANAINDGIVPLYTASLLFLDYNDILEQLQKLKENSKKSPLINDASTPVNQDFFNKTF 423
           TVYANA NDGIVPLYT++LLFLDY+DIL++L    E+             +  DFF + F
Sbjct: 391 TVYANACNDGIVPLYTSALLFLDYDDILDKLNMNTED-------------LQTDFFQRNF 437

Query: 424 ISPLTKMLSILAPQKFPTENGSEIPKVSFFESASSILLPPLPERAYIMDPDSRDPVIIHD 483
           ISPLTK + IL PQ+  ++NG++IP  S  +SA S+L+PPLP+++YI DP +R  V++HD
Sbjct: 438 ISPLTKAMDILMPQRV-SQNGTKIPVASMLDSAYSVLIPPLPDKSYITDPKTRKDVVVHD 496

Query: 484 KIYNEDDIPQSEFDIEDGFFGKKNILLQAF---FAGKKERAKYRNLEETIARRWHEGMAW 540
           K+Y+  DIP  + + +       N+LL+ F   F G     +Y+ LEE IAR WH+ + W
Sbjct: 497 KVYSGQDIPDHQSNSQLEVMNSSNVLLKTFNIAFGG-----QYKKLEEQIARNWHKDVKW 551

Query: 541 RKVVVALKPDAHNNIIVRRKFANAYGWPVIDHLIDVHFXXXXXXXXXXXXXXXSTQVVEP 600
           RKV++ LKPDAHNNII RR+F+NAYGWPV+DHL + HF                +  ++P
Sbjct: 552 RKVIINLKPDAHNNIITRRRFSNAYGWPVVDHLTETHF--------LNDDKSSRSWKLDP 603

Query: 601 IQSVTEGKKKYRKAENIPQEYGWLNKVETNGVFDEGPTGMISTVGEIVEAL 651
           I                 +++ W+ K   + VFD GPTGMI T GE++E L
Sbjct: 604 ISK--------------DEDFDWIVKPTVDSVFDVGPTGMICTFGEMLENL 640

>YDL109C (YDL109C) [760] chr4 complement(265258..267201) Protein of
           unknown function, has high similarity to uncharacterized
           S. cerevisiae Rog1p [1944 bp, 647 aa]
          Length = 647

 Score =  582 bits (1499), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 311/680 (45%), Positives = 422/680 (62%), Gaps = 63/680 (9%)

Query: 6   TNEILFHYKSSVKVGELERYVITYHLYDGEEIPPDLNLNSLWLKVRNMNPLSYRAAYLMG 65
            +E+L+H +SSVK+GELERYVITY LY G+ IP D+ L+SLW+K++N   LSY+ AYL+G
Sbjct: 7   ADEVLYHNQSSVKLGELERYVITYELYQGDSIPADITLDSLWVKIKNTTKLSYKPAYLLG 66

Query: 66  PFMLYCDVKTAQYHHSQKIVASVDYPKFEPNVQTQQDFVAELSVHNIRQKYVWIADVMSQ 125
           PF+LYCDV+   Y  S KI+ S D P F+ N+Q QQ F+AELS+H+I+ +YVWI D++SQ
Sbjct: 67  PFILYCDVRAKDYESSYKIICSADKPVFQSNLQAQQKFIAELSLHHIKPRYVWIVDIVSQ 126

Query: 126 ILFTTNTNVTYEVTIGTSKESVENP----HDLPS------HLGSYSPKLTVNRLTTLDLW 175
           ILF   T VT+E+ +G SK S++        LP       H G     L+V+RLTT D+W
Sbjct: 127 ILFNKETKVTFEIVVGNSKASLKRKIRCNDSLPDKACNILHTG-----LSVHRLTTADIW 181

Query: 176 NLPVQITTPQKKKHLVVLTHGLHSNVSTDLVYIMEQIYKAQKNYPHEQIVVKGYRGNVCQ 235
            +P  I   QK  HLV+LTHG  SNVS D+ Y+ME+IYKAQ N P+E++V+KGY  N C+
Sbjct: 182 KVPRPIDMSQKS-HLVILTHGFQSNVSADMEYLMEEIYKAQMNNPNERLVIKGYMKNACE 240

Query: 236 TEKGVKYLGTRLAEYIIQDLYDESIRKISFVGHSLGGLIQAFAIAYIYEVYPWFFKKVNP 295
           TEKG+K+LG  LA YII +LYD+S+ KISF+GHSLGGL Q FAI YI   YP+FFKKV P
Sbjct: 241 TEKGIKFLGVGLANYIIDELYDDSVGKISFIGHSLGGLTQTFAICYIKTKYPYFFKKVEP 300

Query: 296 INFITLASPLLGIVTDNPAYIKVLLSFGVIGKTGQDLGLENDVEVGKXXXXXXXXXXXXX 355
           INFI+LASPLLGI T  P Y+K+ LS G+IG TGQ+LGL++     K             
Sbjct: 301 INFISLASPLLGIATSTPNYVKMSLSMGIIGTTGQELGLKDGNYGDKPLLYLLSEESLIS 360

Query: 356 XXRRFKRRTVYANAINDGIVPLYTASLLFLDYNDILEQLQKLKENSKKSPLINDASTPVN 415
              RFKRRT+YANA+NDGIVPLY++SLLFLDY+ +L++L   +  +   PL     +P+ 
Sbjct: 361 VLARFKRRTLYANAVNDGIVPLYSSSLLFLDYSQLLQKLGG-QTTAPCDPLFQPEVSPIG 419

Query: 416 QDFFNKTFISPLTKMLSILAPQKF--PTENGSE-----IPKVSFFESASSILLPPLPERA 468
           +   N + ++     ++  +   F    EN  +     +   S  +S  S+LL P P+  
Sbjct: 420 E-LPNHSDVANDDDGINASSWNTFWKSKENNCDKKSKRLMNASVIKSMKSVLLSPCPDAK 478

Query: 469 YIMDPDSRDPVIIHDKIYNEDDIPQSEFDIEDGFFGKKNILLQAFFAGKKERAKYRNLEE 528
           +  DPD+R   IIHDKIY E ++P     + +G   K+           + R   + +EE
Sbjct: 479 FFSDPDARVATIIHDKIYTEKNLPPPSPTLYEGTAAKEG----------ETRKTRKEMEE 528

Query: 529 TIARRWHEGMAWRKVVVALKPDAHNNIIVRRKFANAYGWPVIDHLIDVHFXXXXXXXXXX 588
            IARRWH+GM WRKVVV LKPDAHNNIIVRR+F+NAYGWPV+DHL+  HF          
Sbjct: 529 IIARRWHKGMHWRKVVVLLKPDAHNNIIVRRRFSNAYGWPVVDHLVTAHF---------- 578

Query: 589 XXXXXSTQVVEPIQSVTEGKKKYRKAENIP-------QEYGWLNKVETNGVFDEGPTGMI 641
                  Q  +PI S  + K+   +  N+        + Y WL K+E   V+     G++
Sbjct: 579 -------QRDDPIASPMQDKQFAEEDINMATGGVEPNKFYSWLTKIEDPSVYH---GGIV 628

Query: 642 STVGEIVEALAKRGFSAVID 661
           ST  ++  +   +  S+V D
Sbjct: 629 STASQLASSWISK-HSSVTD 647

>Scas_613.14
          Length = 628

 Score =  538 bits (1387), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 281/576 (48%), Positives = 378/576 (65%), Gaps = 29/576 (5%)

Query: 7   NEILFHYKSSVKVGELERYVITYHLYDGEEIPPDLNLNSLWLKVRNMNPLSYRAAYLMGP 66
           +++L+   S VK+G + RY+I Y+LY G+EIP  ++L+ L L ++N    S++AAYLMGP
Sbjct: 8   DQVLYQDTSEVKIGGIRRYIIKYNLYTGDEIPTTISLDPLKLTIKNKVRKSFKAAYLMGP 67

Query: 67  FMLYCDVKTAQYHHSQKIVASVDYPKFEPNVQTQQDFVAELSVHNIRQKYVWIADVMSQI 126
           F LYCDV+   YHH Q+IV+S D P+F  N+Q    F+AELS+H I++KYVWI DV+SQ 
Sbjct: 68  FTLYCDVRAQSYHHKQRIVSSKDVPQFISNLQPHSKFIAELSLHEIKKKYVWIIDVISQS 127

Query: 127 LFTTNTNVTYEVTIGTSKESVENPHDLPSHLGSYSPKLTVNRLTTLDLWNLPVQI---TT 183
           +F+ N+  ++E+T+GT+  +  +        GS    L V  L+T  +WN    I     
Sbjct: 128 IFSLNSVTSFELTLGTTTNNYNS--------GS---SLEVETLSTDVIWNEKATIPLLRE 176

Query: 184 PQKKKHLVVLTHGLHSNVSTDLVYIMEQIYKAQKNYPHEQIVVKGYRGNVCQTEKGVKYL 243
            +K  HLV+LTHG+HSNV+ D+ Y+MEQIY  Q  Y +E+IVVKGY GNVC+TE G+K+L
Sbjct: 177 SRKMIHLVILTHGMHSNVTADMSYLMEQIYNTQSLYSNEKIVVKGYVGNVCKTEMGIKFL 236

Query: 244 GTRLAEYIIQDLYDESIRKISFVGHSLGGLIQAFAIAYIYEVYPWFFKKVNPINFITLAS 303
           G  LA+YII  LY   + KISF+GHSLGGLIQ+FAI+ I  ++PWFF+KV P+NFITLA+
Sbjct: 237 GEGLAKYIIDTLYSVEVAKISFIGHSLGGLIQSFAISSIAVLHPWFFEKVKPVNFITLAT 296

Query: 304 PLLGIVTDNPAYIKVLLSFGVIGKTGQDLGLENDVEVGKXXXXXXXXXXXXXXXRRFKRR 363
           P LGIVTDNP+Y+K+LLS G+IGKTG DLGL+   +                  ++F+RR
Sbjct: 297 PFLGIVTDNPSYVKMLLSAGIIGKTGVDLGLKEHYD---NILYLLSGEPIKSIMKKFERR 353

Query: 364 TVYANAINDGIVPLYTASLLFLDYNDILEQLQKLKENSKKSPLINDASTPVNQDFFNKTF 423
           T+YANA+NDGIVPLYT+ LLFLDY D+L +L  LK  S K  +    S   ++   N + 
Sbjct: 354 TLYANAMNDGIVPLYTSCLLFLDYADVLSELDNLKR-SIKITIDTPESGRESEKIINTS- 411

Query: 424 ISPLTKMLSILAPQKFPTENGSEIPKVSFFESASSILLPPLPERAYIMDPDSRDPVIIHD 483
            S  +K+       +   ++  ++PK S  ES +SIL PP P   YI +P SR  VIIHD
Sbjct: 412 -SSWSKVFK----HRKEDKHSVKLPKTSIIESMASILQPPSPTDEYITNPSSRAKVIIHD 466

Query: 484 KIYNEDDIPQSEFDIEDGFFGKKN-ILLQAFFAGKKERAKYRNLEETIARRWHEGMAWRK 542
           K+Y EDDI +    IE  F+  KN  LL  F+       +   LE  IA+RWH G  WRK
Sbjct: 467 KVYTEDDIER----IESNFYKLKNDRLLSRFYRRHSTGKQNERLEVEIAKRWHSGTPWRK 522

Query: 543 VVVALKPDAHNNIIVRRKFANAYGWPVIDHLIDVHF 578
           V+VAL  +AHNNIIVRR+F+N YGW VIDHLI+ HF
Sbjct: 523 VIVALGSEAHNNIIVRRRFSNGYGWEVIDHLIENHF 558

>CAGL0H10340g 1007564..1009342 similar to sp|P53118 Saccharomyces
           cerevisiae YGL144c or tr|Q12103 Saccharomyces cerevisiae
           YDL109c, hypothetical start
          Length = 592

 Score =  347 bits (889), Expect = e-111,   Method: Compositional matrix adjust.
 Identities = 202/582 (34%), Positives = 329/582 (56%), Gaps = 62/582 (10%)

Query: 10  LFHYKSSVKVGELERYVITYHLYDGEEIPPDLNLNSLWLKVRNMNPLSYRAAYLMGPFML 69
           + H + ++ +GE  R++I        E+  +++   +++++RN    + RA YL+GPF+L
Sbjct: 1   MIHVRGALAIGETSRFLI--------EVNSNID-GPVFVRLRNRTKATRRATYLLGPFVL 51

Query: 70  YCDVKTAQYHHSQKIVASVDYPKFEPNVQTQQDFVAELSVHNIRQ---KYVWIADVMSQI 126
           YCD +     +  + V     P+F+ N++ Q  F  +L   + R    K  WI DV+S++
Sbjct: 52  YCDSRPVIPANQNEYV-----PQFKANIEPQGKFTFQLKPEDARDVGGKRCWIIDVVSEV 106

Query: 127 LFTTNTNVTYEVTIGTSKESVENPHDLPSHLGSYSPKLTVNRLTTLDLWNLPVQI----- 181
           LF   T V YE+ I     + +          S    +   + +  D+    +++     
Sbjct: 107 LFNQITKVDYELLISLDINNFKKSKYQQDIYESIEGDVVAKQYSNHDIQEF-IEVGAKIK 165

Query: 182 --TTPQKKKHLVVLTHGLHSNVSTDLVYIMEQIYKAQKNYPHEQIVVKGYRGNVCQTEKG 239
              T ++ +HLV++THG+ SNVS D++YIMEQ+    ++   E++++ GY GNVC+TE G
Sbjct: 166 KSQTKERNQHLVIVTHGMISNVSNDMMYIMEQLRAIDRDDLDEELILDGYTGNVCRTELG 225

Query: 240 VKYLGTRLAEYIIQDLYDESIRKISFVGHSLGGLIQAFAIAYIYEVYPWFFKKVNPINFI 299
           +K LG RLA YI+++ Y+ +I+KISF+GHSLGGL+Q FAIAYIY ++ WFF  V P+NFI
Sbjct: 226 IKNLGIRLANYIVKERYNTNIKKISFIGHSLGGLVQTFAIAYIYILHGWFFDAVKPVNFI 285

Query: 300 TLASPLLGIVTDNPAYIKVLLSFGVIGKTGQDLGLENDVEVGKXXXXXXXXXX-XXXXXR 358
           +LA+P LG+ +    Y K LLS G +G+TG+DL   +  ++                  +
Sbjct: 286 SLATPFLGLYSHIGNYTKRLLSSGALGQTGEDLRYHSHNKLKNFSILYLLSGDPAHSILQ 345

Query: 359 RFKRRTVYANAINDGIVPLYTASLLFLDYNDILEQLQKLKENSK--KSPLINDASTPVNQ 416
           +F+RRT+YANAINDGIVPL +++LL+LDY+ IL+  + LK+ +   +S ++       ++
Sbjct: 346 KFERRTLYANAINDGIVPLASSALLYLDYSKILKDSKLLKKETDDIRSIVMTWKEFQDSE 405

Query: 417 DFFNKTFISPLTKMLSILAPQKFPTENGSEIPKVSFFESASSILLPPLPERAYIMDPDSR 476
           DF     ++P +K+                  +VS   +  +++LP  P+     +  S 
Sbjct: 406 DFKVYKKVNPKSKIFR----------------RVSLTNTVGNLVLPEPPK-----NITSD 444

Query: 477 DPVIIHDKIYNEDDIPQSEFDIEDGFFGKKNILLQAFFAGKKERAKYRNLEETIARRWHE 536
             V+IHD++Y  +DIP SE+   DG        +    A  + +     L+E +ARRWH 
Sbjct: 445 MKVLIHDQVYQYNDIPDSEYFPPDG--------IDEIMAMDRHQ-----LQECMARRWHA 491

Query: 537 GMAWRKVVVALKPDAHNNIIVRRKFANAYGWPVIDHLIDVHF 578
           G +WRKV+V L+ DAHN+I VRR+++N+ GW VI H+I  HF
Sbjct: 492 GKSWRKVIVCLEGDAHNSINVRRRYSNSCGWAVISHMILNHF 533

>Kwal_47.18482
          Length = 623

 Score =  299 bits (766), Expect = 2e-92,   Method: Compositional matrix adjust.
 Identities = 216/644 (33%), Positives = 328/644 (50%), Gaps = 95/644 (14%)

Query: 1   MSLTPTNEILF-HYKSSVKVGELERYVITYHLYDGEEIPPDLN-LNSLWLKVRNMNPLSY 58
           M+ T   ++L    +  + +GEL RY +T    D   +   L+ +   +L  +N      
Sbjct: 1   MTFTTEEDLLLVDDRLKLGLGELVRYNVTV---DRSLLDDHLSHITEFYLTFKNTESAFL 57

Query: 59  RAAYLMGPFMLYCDVKTAQYHHSQKIVASVDYPKFEPNVQTQQDFVAELSVH-NIR---- 113
           R  YL GP+  Y DV+   Y         +   +F  +V+  +++ A L ++ N R    
Sbjct: 58  RPIYLTGPYSFYVDVQPCNYDERIPFNEKL---QFCEDVKPNEEYRAVLQLNDNSRVEES 114

Query: 114 QKYVWIADVMSQILFTTNTNVTYEVTIGTSKESVENPHDLPSHLGSYSPKLTVNRLTTLD 173
           +++VW  +VMSQ+  T    + + + I   K S     ++PS   +        +  T  
Sbjct: 115 ERFVWQINVMSQLSVTKIPVLGFRLCISCGKSS-----EIPSSPVTSIKGFVCEKWDTHG 169

Query: 174 LWNLPVQITTPQKKKHLVVLTHGLHSNVSTDLVYIMEQIYKAQ----KNYPHEQIVVKGY 229
           LWNLP +   P +  HLVVLTHG+ SNV  DLVY+ ++I  A     K+     +VV+GY
Sbjct: 170 LWNLPPRF--PDRPLHLVVLTHGIFSNVGCDLVYLKDRIEAAASVAGKDSKTSNLVVRGY 227

Query: 230 RGNVCQTEKGVKYLGTRLAEYIIQ---DLYDE-SIRKISFVGHSLGGLIQAFAIAYIYEV 285
            GN  ++ KG+K  G RLA++II+   DL +E  ++ ISFV HSLGG  QA AI YI   
Sbjct: 228 MGNQGRSSKGIKANGVRLAKFIIETVDDLKEEYDLQYISFVAHSLGGPSQAMAIRYICLE 287

Query: 286 YPWFF---KKVNPINFITLASPLLGIVTDNPAYIKVLLSFGVIGKTGQDLGL-------- 334
            P  F   K + P+NFITLASP LGI  + P ++ + L  GV+G+TG DL L        
Sbjct: 288 RPDIFDPAKGLKPLNFITLASPYLGIAGEVPPFVTLALDVGVLGQTGADLNLNRTFFLSK 347

Query: 335 ----ENDVEVG----KXXXXXXXXXXXXXXXRRFKRRTVYANAINDGIVPLYTASLLFLD 386
                 D ++G    K               +RF+ RT+YAN ++DGIVPL TA+LL+LD
Sbjct: 348 DGIVRKDEKLGSYRRKPLLEIIPSRPLTELIQRFENRTIYANILHDGIVPLRTAALLYLD 407

Query: 387 YNDILEQLQKLKENSKKSPLINDASTPVNQDFFNKTFISPLTKM-----LSILAPQK--- 438
           +  + +     +EN K     +D  TP + +  +     P  KM     L  L PQ    
Sbjct: 408 WKALGDVRGIRRENGK-----DDEGTPYSSNEKDAIGKIPEEKMDKQSALKYLMPQAALR 462

Query: 439 -----------FPTENGSE-------------IPKVSFFESASSILLPPLPERAYIMDPD 474
                         E+G+E              P  +   SA++I++ PLP + Y+ +P 
Sbjct: 463 RKYKKYTRTQILSQESGNENSYSEESTEPISPPPSANPLVSAANIIVAPLPTQKYLQNPK 522

Query: 475 SRDPVIIHDKIYNEDDIPQSEFDIEDGFFGKKNILLQAFFAGKKERAKYRNLEETIARRW 534
            R+  I+HDKIY  D++P + +        K+++L +  +   +    YR ++E IAR+W
Sbjct: 523 EREDKIVHDKIYYPDELPPAHYR-------KRDVLKKIIYPNDR---IYR-VQERIARQW 571

Query: 535 HEGMAWRKVVVALKPDAHNNIIVRRKFANAYGWPVIDHLIDVHF 578
            E M WRKV+V+++PD+HNNI+VRRKF NA+GW V+DHL+  HF
Sbjct: 572 QETMNWRKVLVSIEPDSHNNIVVRRKFVNAFGWVVVDHLVKEHF 615

>AER322C [2823] [Homologous to ScYDR444W - SH] (1229579..1231489)
           [1911 bp, 636 aa]
          Length = 636

 Score =  295 bits (756), Expect = 8e-91,   Method: Compositional matrix adjust.
 Identities = 187/623 (30%), Positives = 318/623 (51%), Gaps = 71/623 (11%)

Query: 9   ILFHYKSSVKVGELERYVITYHLYDGEEIPPDLNLNSLWLKVRNMNPLSYRAAYLMGPFM 68
           +L++ +  +  GE+ RY+I     D  ++     +  L L+++N+     R  YL GP+ 
Sbjct: 24  LLYNDQRGISQGEVFRYIIKV---DKAQLDAKTKIEELVLRIKNVESPLLRPIYLTGPYS 80

Query: 69  LYCDVKTAQYHHSQKIVASVDYPKFEPNVQTQQDFVAELSVHNIRQK-----YVWIADVM 123
           +Y +V+   Y++ +      D  +F  +++  + F A L ++   Q      Y W ADV+
Sbjct: 81  VYAEVRP--YNYDENTAFQGDDLQFISDLKPDEAFSATLKLNGDSQVLESTVYSWTADVL 138

Query: 124 SQILFTTNTNVTYEVTIGTSKESVENPHDLPSHLGSYSPKLTVNRLTTLDLWNLPVQITT 183
           SQ+ +  +  +   ++IG ++   +     P+         TV    T+ +WN P     
Sbjct: 139 SQMTWMVDHPILVRLSIGNTRSIGKAAMKTPARAVEPVSGFTVEIQDTMTVWNEPPLF-- 196

Query: 184 PQKKKHLVVLTHGLHSNVSTDLVYIMEQIYK---AQKNYPHEQIVVKGYRGNVCQTEKGV 240
           P++  HLV++THG+ SN+  D++Y+ +++ K   A +   ++ +VV+GY GN+ ++ KG+
Sbjct: 197 PERPVHLVIVTHGIFSNIGCDMLYLRDRLKKCAHAVEENCNQNVVVRGYHGNIGKSHKGI 256

Query: 241 KYLGTRLAEYIIQDLY----DESIRKISFVGHSLGGLIQAFAIAYIYEVYPWFFK----K 292
           +YL  R+A+Y+++ +     +  + +ISF+GHSLGGL+Q FAI Y+ E  P  F      
Sbjct: 257 EYLAMRVADYVLKTIAQMPNEYFLDRISFIGHSLGGLVQTFAIQYMLERDPGIFSPQAGG 316

Query: 293 VNPINFITLASPLLGIVTDNPAYIKVLLSFGVIGKTGQDLGLENDVEVG----------- 341
           + P+NFI LASP LG++ D P Y  V L+FG +G+TG+DL L+ND  +            
Sbjct: 317 LRPMNFIALASPFLGVIGDFPLYATVALNFGALGRTGKDLNLKNDFAISELVRNPKQAYN 376

Query: 342 -KXXXXXXXXXXXXXXXRRFKRRTVYANAINDGIVPLYTASLLFLDYNDILE-------- 392
            +               + F  RT+YANA++DGIVPL T++LL+LD+  + E        
Sbjct: 377 RRPVLESIVSGSMKSVLQAFSNRTLYANALHDGIVPLRTSALLYLDWYSLQEVNLIGAQE 436

Query: 393 --QLQKLKENSKKSPLINDASTPVN----QDFFNKTFISPLTKMLSILAPQKFPTENGSE 446
             +   L E        +    P +    +D         L K       +    + G E
Sbjct: 437 GAETFDLGEEDHALKRYDTVEIPPDLSEKKDTIRWLLPRALIKRRHKWYKRSQTVKPGIE 496

Query: 447 -----------IPKVSFFESASSILLPPLPERAYIMDPDSRDPVIIHDKIYNEDDIPQSE 495
                      + K S   SA++IL+ P P + Y  DP SR   I HDK Y+ +++P + 
Sbjct: 497 QLWDEDSDYHPLTKASALSSAANILVAPPPTQDYYKDPQSRTDYIFHDKRYSPEELPPA- 555

Query: 496 FDIEDGFFGKKNILLQAFFAGKKERAKYRNLEETIARRWHEGMAWRKVVVALKPDAHNNI 555
                 ++  + +L +  +       K    +E IAR + E M+WRKV+V ++P++HNNI
Sbjct: 556 ------YYRNRELLKKILYPND----KVHRTQEKIARGYQESMSWRKVLVNIQPESHNNI 605

Query: 556 IVRRKFANAYGWPVIDHLIDVHF 578
           IVRR+F N++GW VI+HL++ HF
Sbjct: 606 IVRRRFVNSFGWIVIEHLVNEHF 628

>KLLA0B01375g 110709..112631 similar to sgd|S0002852 Saccharomyces
           cerevisiae YDR444w, start by similarity
          Length = 640

 Score =  290 bits (741), Expect = 1e-88,   Method: Compositional matrix adjust.
 Identities = 201/640 (31%), Positives = 321/640 (50%), Gaps = 95/640 (14%)

Query: 9   ILFHYKSSVKVGELERYVITYH----LYDGEEIPPDLNLNSLWLKVRNMNPLSYRAAYLM 64
           +L     S+ +G++ RY I       L DG E   D    +L+L+ +N      R  ++ 
Sbjct: 19  LLLRETGSLGIGDVNRYKIIVDKNKLLSDGIECTDD----TLYLEFKNQESALLRPLWIT 74

Query: 65  GPFMLYCDVKTAQYHHSQKIVASVDYPKFEPNVQTQQDFVAELSVH-NIR----QKYVWI 119
           GP+ +Y ++    Y   ++ +   D  +F  +++  ++F A+L ++ N R      Y W 
Sbjct: 75  GPYSIYVEITPNNYDERKQFIG--DGIEFMSDLKPDENFKAKLYLNSNARVDGTSCYAWK 132

Query: 120 ADVMSQILFTTNTNVTYEVTIGTSKESVENPHDLPSHLGSYSPKLTVNRLTTLDLWNLPV 179
            D+++Q    T   + +  T+ T+ ++ ++     +     +  L +++L T  LWNLP 
Sbjct: 133 IDLIAQFTVVTIVRLPFVFTLATTYKTAKHSQKDKNIEVQQTDGLKISKLDTEQLWNLPP 192

Query: 180 QITTPQKKKHLVVLTHGLHSNVSTDLVYIMEQIYKAQKNYPHEQ---IVVKGYRGNVCQT 236
               P K  HLV++THG+ S++  D++ + + I +A    P +    +V++GY GNV ++
Sbjct: 193 PF--PDKPVHLVIITHGIFSSIGGDMLCLKDTIERASNFLPDDNNGNLVIRGYPGNVGKS 250

Query: 237 EKGVKYLGTRLAEYIIQDLYDE-----SIRKISFVGHSLGGLIQAFAIAYIYEVYPWFFK 291
            KG+++LG +LAEYII D  D+     ++ +ISFVGHSLGG +QA AI YI    P  F 
Sbjct: 251 HKGIRHLGFKLAEYII-DTIDKLQQQFTLTRISFVGHSLGGPVQAMAIHYISVERPDIFD 309

Query: 292 K---VNPINFITLASPLLGIVTDNPAYIKVLLSFGVIGKTGQDLGLE------------- 335
           K   + P+NF+  ASP LG++ D P YI ++L  G +G+TG+DL L+             
Sbjct: 310 KTTGLTPVNFVAAASPFLGVIGDLPKYISIVLDIGALGQTGRDLTLKRSYFLPSKGIVNN 369

Query: 336 ---NDVEVGKXXXXXXXXXXXXXXXRRFKRRTVYANAINDGIVPLYTASLLFLDYNDILE 392
              +D    K               +RFK RTVYAN   DGIVPL TA+LL+LD+  + +
Sbjct: 370 DGSHDRIKSKPILELLPKHPALEVFQRFKCRTVYANVAFDGIVPLRTAALLYLDWRGLSD 429

Query: 393 QLQKLKENS----------KKSPL--INDASTP--------VNQDFFNKTFISPLTKMLS 432
             Q   EN+          K S L  I ++S+         + Q    K    P  +  +
Sbjct: 430 VQQVRSENNAQSEEGVEEQKGSSLGEIPESSSDNKSILQWLLPQSLIKKEKYKPYVRTQT 489

Query: 433 ILA--------------PQKFPTENGSEIPKVSFFESASSILLPPLPERAYIMDPDSRDP 478
             +              P  F         K +  ++A+S +  PLP  +Y++DP SR  
Sbjct: 490 TSSVESASSDSNNNSDSPTTFKPPK-----KANTLQAAASTISAPLPGMSYLVDPSSRTD 544

Query: 479 VIIHDKIYNEDDIPQSEFDIEDGFFGKKNILLQAFFAGKKERAKYRNLEETIARRWHEGM 538
            IIHDK+Y  +++P       D  +  K ++ +  +       K    EE IAR W E M
Sbjct: 545 RIIHDKVYTPEELP-------DKHYKHKKLVKKIIYPNYSIHMK----EERIARYWQETM 593

Query: 539 AWRKVVVALKPDAHNNIIVRRKFANAYGWPVIDHLIDVHF 578
            WRKV+V L+PD+HNNIIVRR+F N++GW V++H+ D HF
Sbjct: 594 DWRKVIVELQPDSHNNIIVRRRFVNSFGWIVVNHIADEHF 633

>YDR444W (YDR444W) [1264] chr4 (1350278..1352341) Protein of unknown
           function, has low similarity to C. albicans Orf6.7404p
           [2064 bp, 687 aa]
          Length = 687

 Score =  288 bits (736), Expect = 2e-87,   Method: Compositional matrix adjust.
 Identities = 203/648 (31%), Positives = 334/648 (51%), Gaps = 103/648 (15%)

Query: 9   ILFHYKSSVKVGELERYVITYHLYDGEEIPPDLNLNSLWLKVRNMNPLSYRAAYLMGPFM 68
           +L   +  +++GEL RY  + +    +E    L+++ L+L+++N      R  YL GP+ 
Sbjct: 21  LLVDERKRLRIGELYRYKFSVNKDVIKE--QGLDVSHLFLRIKNEESALLRPLYLTGPYS 78

Query: 69  LYCDVKTAQYHHSQKIVASVDYPKFEPNVQTQQDFVAELSVH-NIR----QKYVWIADVM 123
            Y DV+   Y+ ++K       P F  N++  + F  ++ ++ N R      Y W  D++
Sbjct: 79  FYIDVRPHNYNENRKFPGKEIIP-FVENLKPDERFKVKILLNENSRVGDTSLYSWTIDII 137

Query: 124 SQILFTTNTNVTYEVTIGTSKESVENPHDLPSHLGSYSPKLTVNRLTTLDLWNLPVQITT 183
           SQ+  TT   + +   IGT+++ V+  + L   +   S ++      T  LW+LP +   
Sbjct: 138 SQLAVTTIPKLEFSFRIGTTRKVVKKSNGLFKSIEGVSLEM----WDTETLWDLPPKF-- 191

Query: 184 PQKKKHLVVLTHGLHSNVSTDLVYIMEQIYKAQKNYPHEQ-----IVVKGYRGNVCQTEK 238
           P+K  HLV++THG+ SN+  D++Y+ ++I   +  +P ++     I+V+G+ GNV ++  
Sbjct: 192 PEKPVHLVIMTHGIFSNIGCDMLYMKDKI--EEMTFPMDESINPNIIVRGFMGNVGKSGH 249

Query: 239 GVKYLGTRLAEYIIQDL----YDESIRKISFVGHSLGGLIQAFAIAYIYEVYPWFF---K 291
           G+  LG R+ +Y+++ +        + +ISF+GHSLGG  Q+ A+ YI    P FF   K
Sbjct: 250 GIHCLGVRVGKYVLETVDKLNKKYKVDRISFIGHSLGGPTQSMAVRYISIKRPDFFDAVK 309

Query: 292 KVNPINFITLASPLLGIVTDNPAYIKVLLSFGVIGKTGQDL-----------GLENDVEV 340
            V P+NFITLASP +G++ D P Y+ V L  G +G TG+DL           GL  D EV
Sbjct: 310 GVKPVNFITLASPFIGVIGDFPFYLSVPLDMGALGLTGRDLNLKYTPLTSKDGLYADDEV 369

Query: 341 ----GKXXXXXXXXXXXXXXXRRFKRRTVYANAINDGIVPLYTASLLFLDYNDILEQLQK 396
                K                 FKRRT+YAN ++DGIVPL TA+LL+LD+  I  ++QK
Sbjct: 370 YPEHSKYILEILPQAPAKKVFESFKRRTIYANVMDDGIVPLRTAALLYLDWRSI-HKVQK 428

Query: 397 LKENSKKSPLIND-----------ASTPVNQDFFNKTFI---SPLTK-MLSILAPQKFPT 441
           +++ +K SP  ++           AS+P N++  N   I   SP  K  L    PQ    
Sbjct: 429 IRKKNKNSPTSSEFVSSDSPESSGASSPSNENGNNVGEIPAESPNKKATLQWTLPQA--V 486

Query: 442 ENGSEIPKVSF----------------------FE---------SASSILLPPLPERAYI 470
            +GS+I K                         FE         SA S+L   +P++ YI
Sbjct: 487 IHGSKINKYKRGQTNEANSDSDNEQGVFLDGQKFEPPKEANTVLSALSVLTAAIPDQEYI 546

Query: 471 MDPDSRDPVIIHDKIYNEDDIPQSEFDIEDGFFGKKNILLQAFFAGKKERAKYRNLEETI 530
            +P  R   +IHDK+Y+ +++P   ++        + I+ +  +  +        ++E I
Sbjct: 547 KNPAVRKDEVIHDKLYHPEELPPPHYE-------NRPIVKKLIYPNE----SVNRIQERI 595

Query: 531 ARRWHEGMAWRKVVVALKPDAHNNIIVRRKFANAYGWPVIDHLIDVHF 578
           AR W E M WRKV+V ++PD+HNNI+VRR+F N YG+  ++H+++ HF
Sbjct: 596 AREWQETMTWRKVLVQIQPDSHNNIVVRRRFVNLYGYVAVEHMVEHHF 643

>CAGL0M10043g complement(999113..1001089) similar to tr|Q04093
           Saccharomyces cerevisiae YDR444w, hypothetical start
          Length = 658

 Score =  272 bits (695), Expect = 8e-82,   Method: Compositional matrix adjust.
 Identities = 197/652 (30%), Positives = 321/652 (49%), Gaps = 103/652 (15%)

Query: 9   ILFHYKSSVKVGELERYVITYHLYDGEEIPPD-LNLNSLWLKVRNMNPLSYRAAYLMGPF 67
           +L H K+S+ +G + RY++     D +++  D ++   L+L+ +N+     R  YL GP+
Sbjct: 8   LLVHEKNSLGIGGMCRYILQV---DHKKLKEDGIDTQELYLRFKNLESPLLRPVYLTGPY 64

Query: 68  MLYCDVKTAQYHHSQKIVASVDYPKFEPNVQTQQDFVAEL--------SVHNIRQK-YVW 118
             Y DV+   Y   +  + S D   F  +++  + F A+L           N R + Y W
Sbjct: 65  AFYIDVRPCNYDEDKTYIGSEDV-AFCSDLKPDEKFKAKLYFNANSRLQTKNARDEIYSW 123

Query: 119 IADVMSQILFTTNTNVTYEVTIGTSKESVENPHDLPSHLGSYSPKLTVNRLTTLDLWNLP 178
             D++SQ+   T   + Y   +GTSK+ V+          +    L++       LWNLP
Sbjct: 124 TIDIISQLAVVTFPILKYSFKVGTSKKIVKK---SKGKKVTSVRGLSLKMWDEKSLWNLP 180

Query: 179 VQITTPQKKKHLVVLTHGLHSNVSTDLVYIMEQIYKAQKNYPHE---QIVVKGYRGNVCQ 235
            +   P K  HLV+LTHG+ SNV  D++Y+ ++I +   N        +VV+G   N+ +
Sbjct: 181 PKY--PDKPIHLVILTHGIFSNVGCDMLYMKDKIEQTAMNIEERYNPNVVVRGCMDNMGK 238

Query: 236 TEKGVKYLGTRLAEYII---QDLYDE-SIRKISFVGHSLGGLIQAFAIAYIYEVYPWFFK 291
           +  G+ YLG RLA++++   ++L  E  + KISF+GHSLGG  Q+ AI YI  +YP FF 
Sbjct: 239 SAHGIYYLGKRLAKFVVRTVEELRKEYHVDKISFIGHSLGGPTQSMAIHYISVMYPDFFN 298

Query: 292 KVN---PINFITLASPLLGIVTDNPAYIKVLLSFGVIGKTGQDLGL-------------- 334
            V+   P++FI LASP +G++ D P Y+ V L  G +G TG+DL L              
Sbjct: 299 TVSGIKPMHFIALASPFIGVIGDFPLYLSVPLDMGALGLTGRDLNLKYTPLTSNEGLSAL 358

Query: 335 ---ENDVEVGKXXXXXXXXXXXXXXXRRFKRRTVYANAINDGIVPLYTASLLFLDYNDIL 391
              + +  + K               + F  RT+YAN ++DGIVPL TA+LL+LD+   L
Sbjct: 359 TLAQENSHLPKNILEIIPQPPAQQVFQLFMNRTLYANIVHDGIVPLRTAALLYLDWRS-L 417

Query: 392 EQLQKLKEN---------SKKSPLINDASTPVNQDF----------FNKTFISPLTKMLS 432
            Q++ +K++         ++ SP  N++ +  N+D            +K F+      + 
Sbjct: 418 TQVKDIKKSAGEKSNNKITEDSPTDNESVSTTNKDNKMGEIPSESPNSKNFLQWALPQVI 477

Query: 433 ILAPQ--KFP--------------TENGSEIPK----------VSFFESASSILLPPLPE 466
           I  P+  KF               T+  S   K           S F SA S L  P+P 
Sbjct: 478 IKGPKMNKFKRGQIMDTKSNESSDTDTESSDSKQEQKFKGPSEASTFMSALSTLTAPVPT 537

Query: 467 RAYIMDPDSRDPVIIHDKIYNEDDIPQSEFDIEDGFFGKKNILLQAFFAGKKERAKYRNL 526
           + YI +P  R   ++HD++Y   D+P+         + K++ + +  +  +        +
Sbjct: 538 QEYIKNPKVRKDRVVHDRVYEPQDLPEQH-------YLKRSTMKRVVYPNE----SVNRI 586

Query: 527 EETIARRWHEGMAWRKVVVALKPDAHNNIIVRRKFANAYGWPVIDHLIDVHF 578
           +E IAR W   M+WRKV+V ++PD+HNNI+VRR+F N YG   + H++  HF
Sbjct: 587 QERIARAWQMNMSWRKVLVEIQPDSHNNIVVRRRFVNLYGNVAVSHMVREHF 638

>Scas_717.50
          Length = 658

 Score =  254 bits (650), Expect = 3e-75,   Method: Compositional matrix adjust.
 Identities = 195/649 (30%), Positives = 300/649 (46%), Gaps = 99/649 (15%)

Query: 9   ILFHYKSSVKVGELERYVITYHLYDGEEIPPDLNLNSLWLKVRNMNPLSYRAAYLMGPFM 68
           +L +    + +G+L RY+I+      E+    + +  L+L+++N      R  YL GP+ 
Sbjct: 18  LLLNETKKLGIGDLSRYIISVDKKKLED--SGICIEELFLRIKNEESPLLRPVYLTGPYT 75

Query: 69  LYCDVKTAQYHHSQ-----KIVASVDYPKFEPNVQTQQDFVAELSVHNIRQKYVWIADVM 123
            Y DV+   YH  +     +++   ++ K +   +T+        V N    Y W  D++
Sbjct: 76  FYVDVRPHNYHEDEIFEGDEVIPFCEHLKPDARFKTKIFLNKHSRVANT-NTYSWTVDIL 134

Query: 124 SQILFTTNTNVTYEVTIGTSKESVENPHD--LPSHLGSYSPKLTVNRLTTLDLWNLPVQI 181
           SQ+       + Y   I T+K+  +N      P  +  +  KL    L T  LW+ P + 
Sbjct: 135 SQLCVIPTPTLKYSFRIATTKKETKNGSKGKKPVKMDGFEVKL----LDTSSLWSFPPKY 190

Query: 182 TTPQKKKHLVVLTHGLHSNVSTDLVYIMEQIYKAQKNYPHE---QIVVKGYRGNVCQTEK 238
             P K  HLV++THG+ SN+  D++Y+ ++I +   + P +    +VV+G   N+ ++  
Sbjct: 191 --PNKPVHLVIMTHGIFSNIGCDMLYMKDKIEETANSVPEDINPNVVVRGCMKNMGKSAH 248

Query: 239 GVKYLGTRLAEYIIQDLYDE-----SIRKISFVGHSLGGLIQAFAIAYIYEVYPWFF--- 290
           GV YLG R+AEYII+ + DE      + KISF+GHSLGG  Q  A+ YI    P  F   
Sbjct: 249 GVHYLGKRVAEYIIETV-DELNKKYKVDKISFIGHSLGGPTQGMAVHYISVKRPDIFHPT 307

Query: 291 KKVNPINFITLASPLLGIVTDNPAYIKVLLSFGVIGKTGQDL-----------GLENDVE 339
           K + P+NFITLASP +G++ D P Y+ + L  G +G TG+DL           GL  D  
Sbjct: 308 KGIKPVNFITLASPFIGVIGDFPLYVSLPLDAGSLGLTGRDLNLKYTPLTSKDGLTTDGN 367

Query: 340 VGKXXXXXXXXXXXXXXX--RRFKRRTVYANAINDGIVPLYTASLLFLDYNDILEQLQKL 397
             K                  RF  RT+YAN ++DGIVPL TA+LL+LD+N     L K 
Sbjct: 368 AAKTKLILEIIPQPPALAIFERFVHRTLYANVVHDGIVPLRTAALLYLDWN----SLAKA 423

Query: 398 KENSKKSPLINDASTPVNQDFFNKTFISPLTKMLSILAPQKFPTENGSEIPKVSFFESAS 457
           K    +S    +A+TP   D  + +     T   S  A  + PT    EIP     + A+
Sbjct: 424 KRIQDRSSSTQEAATPNVPD--DSSVSRSETGSPSPNARHETPT---GEIPSSGIDKKAA 478

Query: 458 SILLPPLP------ERAYIMDPDSRDPVIIHDKIYNEDD--------------------- 490
                PLP      +R  + +    D          +D+                     
Sbjct: 479 LRWALPLPSKRSKFKRGQVTESSMEDSSGNGSTTETDDNDANEFTAPPEASTMLAALSVL 538

Query: 491 ---IPQSEF-----------DIEDGFFGKKNILLQAFFAGKKERAK--YRN-----LEET 529
              +P  E+            + D  +  K I  +A +A +    K  Y N      +E 
Sbjct: 539 TAPLPSQEYIKNPEVRHHDAIVHDKIYTPKEI-PRAHYANRPAIKKVIYPNESVNRTQER 597

Query: 530 IARRWHEGMAWRKVVVALKPDAHNNIIVRRKFANAYGWPVIDHLIDVHF 578
           IAR+W   M WRKV+V +KPD+HNNI+VRR+F N YG   + H+++ HF
Sbjct: 598 IARQWQMTMNWRKVLVKIKPDSHNNIVVRRRFVNLYGDVAVSHMVEEHF 646

>Kwal_55.21703
          Length = 441

 Score = 75.1 bits (183), Expect = 5e-14,   Method: Compositional matrix adjust.
 Identities = 65/213 (30%), Positives = 97/213 (45%), Gaps = 30/213 (14%)

Query: 188 KHLVVLTHGL-----HSNVSTDLVYIMEQIYKAQKNYPHEQIVVKGYRGN-VCQTEKGVK 241
           KHL VL HGL     H N   D+         A+  + HE  +    R N   +T  G++
Sbjct: 4   KHLFVLVHGLWGNYKHMNAIRDVF--------AETFHDHENTLFFSPRQNGYFKTFDGIE 55

Query: 242 YLGTR----LAEYIIQDLYDESIRKISFVGHSLGGLIQAFAIAYIYEVYPWFFKKVNPIN 297
            +G R    L  +I Q    E I KISFVG+S+GGLI  F I  ++      F+ + P  
Sbjct: 56  IMGYRTLLELCRFIEQFPKGE-ITKISFVGYSMGGLIARFMIGKMFTECHELFQCIEPQL 114

Query: 298 FITLASPLLGI--------VTDNPAYIKVLLSFG--VIGKTGQDLGLENDVEVGKXXXXX 347
           FIT A+P LG+         +   A +++L + G  ++G+TG+ L +++ +   +     
Sbjct: 115 FITFATPHLGVHFFLKEDRASHRRALLRILSALGTTILGRTGRQLFIQDSLP-EQSILVQ 173

Query: 348 XXXXXXXXXXRRFKRRTVYANAINDGIVPLYTA 380
                      RFK R   AN  ND  V  YT+
Sbjct: 174 LSSGEYLHGLARFKHRLCVANVKNDRTVAFYTS 206

>AFR386C [3578] [Homologous to NOHBY] (1131324..1132838) [1515 bp,
           504 aa]
          Length = 504

 Score = 72.8 bits (177), Expect = 3e-13,   Method: Compositional matrix adjust.
 Identities = 60/246 (24%), Positives = 109/246 (44%), Gaps = 24/246 (9%)

Query: 189 HLVVLTHGLHSNVSTDLVYIMEQIYKAQKNYPHEQIVVKGYRGNVCQTEKGVKYLGTRLA 248
           HLV L HGL  NV T + Y+   + + Q+  P   +V         +T  G+   G R+A
Sbjct: 5   HLVFLVHGLWGNV-THMEYLGRAVSQLQERSPETLVVYAAKMNQGYRTYDGIDICGYRVA 63

Query: 249 EYIIQDLYDES-------IRKISFVGHSLGGLIQAFAIAYIYEVYPWFFKK--VNPINFI 299
           + I + +   +       + K S VG+S+GGLI  +A+  +Y     FFKK  +  INF 
Sbjct: 64  KEIQEQVATLNCPETGTVVTKFSIVGYSMGGLISRYAVGLLYS--NQFFKKQDIKLINFT 121

Query: 300 TLASPLLGIVTDNPAYIKVLLSFG---VIGKTGQDLGLENDVEVGKXX----XXXXXXXX 352
           T  SP +G++         + +F    ++G +G+ + L++ ++                 
Sbjct: 122 TFCSPHVGVLAPGKNLAVRVFNFVCSLILGNSGRQMFLKDRIKAANGMPLIVLMSVGDSI 181

Query: 353 XXXXXRRFKRRTVYANAINDGIVPLYTASLL----FLDYNDILEQLQKLKENSKKSPLIN 408
                 +F+ R++YAN +ND     +T+ +     F D   +   +++        P++ 
Sbjct: 182 FYKALEQFQHRSLYANIVNDKRTAWWTSGISMNDPFFDVT-VTNGVERFHYIHPYEPIVI 240

Query: 409 DASTPV 414
           D S P+
Sbjct: 241 DTSQPI 246

>CAGL0L10318g complement(1103690..1105063) similar to tr|Q08448
           Saccharomyces cerevisiae YOR059c, start by similarity
          Length = 457

 Score = 72.4 bits (176), Expect = 4e-13,   Method: Compositional matrix adjust.
 Identities = 66/230 (28%), Positives = 104/230 (45%), Gaps = 28/230 (12%)

Query: 188 KHLVVLTHGLHSNVS--TDLVYIMEQIYKAQKNYPHEQIVVKGYRGNVC-QTEKGVKYLG 244
           KHL VL HGL  N      L  +++     +K+   +  V    + N   +T  G++ +G
Sbjct: 5   KHLFVLIHGLWGNYKHMKSLEKVLDATLNGKKSGKDKDYVFFLPKQNATFKTFDGIEIIG 64

Query: 245 TR----LAEYIIQDLYDESIRKISFVGHSLGGLIQAFAIAYIYEVYPWFFKKVNPINFIT 300
            R    L E++ ++  D +I KISFVG+SLGGL+  F +  +Y      F  +    F+T
Sbjct: 65  YRTLLELCEFM-KEFKDGNITKISFVGYSLGGLVARFVVGKMYSECNDIFGNIERCIFMT 123

Query: 301 LASPLLGIVTDNP-AYIKVLLSFG--------VIGKTGQDLGL---ENDVEVGKXXXXXX 348
           +A+P LGI   NP  Y+   L F         ++GK+G++L +    ND+ V        
Sbjct: 124 MATPHLGIQFYNPLGYLHRKLLFSTFTGLGSTILGKSGRELFIANSSNDILV------RL 177

Query: 349 XXXXXXXXXRRFKRRTVYANAINDGIVPLYTASLLFLDYNDILEQLQKLK 398
                      F  R ++AN  ND  V  +T      D +  LE   ++K
Sbjct: 178 SEGKYIEALEEFNHRILFANVKNDRTVAFFTG--FIADVDPFLESDNRIK 225

>YOR059C (YOR059C) [4867] chr15 complement(438907..440259) Protein
           of unknown function, has low similarity to
           uncharacterized C. albicans Orf6.7873p [1353 bp, 450 aa]
          Length = 450

 Score = 69.3 bits (168), Expect = 3e-12,   Method: Compositional matrix adjust.
 Identities = 63/224 (28%), Positives = 104/224 (46%), Gaps = 24/224 (10%)

Query: 188 KHLVVLTHGLHSNVS--TDLVYIMEQIYKAQKNYPHEQIVVKGYRGNVCQTEKGVKYLGT 245
           KHL VL HGL  N +    +  I+    K +++   + I     +  + +T  G++ +G 
Sbjct: 5   KHLFVLIHGLWGNYTHMESMRTILSTTLK-KEDVNDDMIYFLPKQNAMFKTFDGIEIIGY 63

Query: 246 R----LAEYIIQDLYDESIRKISFVGHSLGGLIQAFAIAYIYEVYPWFFKKVNPINFITL 301
           R    + E+I +D  D  I K+S +G+S GGL+  F I  +   +   F+ + P  FIT+
Sbjct: 64  RTLIEVCEFI-RDYKDGKITKLSVMGYSQGGLVARFMIGKMLTEFKELFEDIEPQLFITM 122

Query: 302 ASPLLGIVTDNP---AYIKVL------LSFGVIGKTGQDLGLENDVEVGKXXXXXXXXXX 352
           A+P LG+   NP   AY   L      L   ++GK+G+++ + N                
Sbjct: 123 ATPHLGVEFYNPTGIAYKSALYSALRTLGSTILGKSGREMFIANS---SNNILVKLSQGE 179

Query: 353 XXXXXRRFKRRTVYANAINDGIVPLYTASLL----FLDYNDILE 392
                  FK R  +AN  ND  V  YTA +     F+D+++ L+
Sbjct: 180 YLEALSLFKWRIAFANVKNDRTVAFYTAFITDCDPFIDFDNKLK 223

>Scas_698.39
          Length = 471

 Score = 66.2 bits (160), Expect = 3e-11,   Method: Compositional matrix adjust.
 Identities = 66/223 (29%), Positives = 100/223 (44%), Gaps = 33/223 (14%)

Query: 181 ITTPQKKKHLVVLTHGLHSNVSTDLVYIMEQIYKAQKNYPHEQ-----IVVKGYRGNVC- 234
           + + QK  HL +L HGL  N        ME + +  KN   +      +V    R N   
Sbjct: 9   LVSNQKDAHLFILLHGLWGNYKH-----MESLKETLKNSIQDDTDRLPLVFFSPRQNAMF 63

Query: 235 QTEKGVKYLGTRLAEYIIQ--DLYDE-SIRKISFVGHSLGGLIQAFAIAYIY-----EVY 286
           +T  GV+ +G R    IIQ   L+ E    K+S +G+S+GGLI  F I  ++     E  
Sbjct: 64  KTFDGVEVVGYRALIEIIQFIQLHPEFKFTKLSILGYSMGGLIARFLIGVMFDKNNDEDE 123

Query: 287 PWFFKKVNPINFITLASPLLGIVTDNP------AYIKVLLSF---GVIGKTGQDLGLEND 337
              FK + P  FIT A+P LGI   NP       ++  +L+     +IG +G+++ +  +
Sbjct: 124 MKVFKGMEPQLFITFATPHLGIHFYNPLNNMLRTFLNPMLTLIGSNIIGVSGREMFIMRN 183

Query: 338 VEVGKXXXXXXXXXXXXXXXRRFKRRTVYANAINDGIVPLYTA 380
            E+                  +FK R V+AN  ND  V  YT+
Sbjct: 184 TEL-----VELSSGKYLDALSKFKWRIVFANVKNDRTVAFYTS 221

>Sklu_2393.4 , Contig c2393 3530-5170 reverse complement
          Length = 546

 Score = 66.2 bits (160), Expect = 4e-11,   Method: Compositional matrix adjust.
 Identities = 66/228 (28%), Positives = 101/228 (44%), Gaps = 37/228 (16%)

Query: 182 TTPQKKKHLVVLTHGLHSNVS--------TDLVYIMEQIYKAQKNYPHEQIVV------K 227
            +P K  HLVVL HGL  N S         D       +++       E+IVV      +
Sbjct: 3   ASPSKDYHLVVLVHGLWGNGSHFDYISNSIDTSLKTHDVFQPGGKLAGEEIVVYTTCLNE 62

Query: 228 GYRGNVCQTEKGVKYLGTRLAEYI---IQDLYDESIRKISFVGHSLGGLIQAFAIAYIYE 284
           GY+     T  G+   G R+A+ I   I+ L   S+ K S VG+SLGGLI  +A+  +Y+
Sbjct: 63  GYK-----TYDGIDVCGLRVAKEIEDQIETL--GSVIKFSLVGYSLGGLIARYALGILYK 115

Query: 285 VYPWFFKK--VNPINFITLASPLLGIVT--DNPA--YIKVLLSFGVIGKTGQDLGLENDV 338
                FKK  +  INF T  +P +G+     N A      ++ F V+G +G+ + L++ V
Sbjct: 116 --KQLFKKHDIELINFTTFCTPHVGVYAPGKNIAVNLFNTIVPF-VLGNSGKQMFLKDQV 172

Query: 339 EVGKXX----XXXXXXXXXXXXXRRFKRRTVYANAINDGIVPLYTASL 382
                                  + FK + +YAN IND     +T+ +
Sbjct: 173 RSAGNLPLVYLMSMENSVFYKALQEFKYKALYANVINDKRTAWWTSGI 220

>ADR202C [1943] [Homologous to ScYOR059C - SH] (1060157..1061488)
           [1332 bp, 443 aa]
          Length = 443

 Score = 64.3 bits (155), Expect = 1e-10,   Method: Compositional matrix adjust.
 Identities = 67/229 (29%), Positives = 97/229 (42%), Gaps = 35/229 (15%)

Query: 187 KKHLVVLTHGLHSNVSTDLVYIMEQIYKAQKNYPHEQIVVKGYRGN-VCQTEKGVKYLG- 244
           KKHL VL HGL    S      M  I  A      +  V    R N   +T  G++ +G 
Sbjct: 4   KKHLFVLVHGLWGTHSH-----MNSIKTAFSEALGDDAVFYVPRSNGYVKTLHGIELVGY 58

Query: 245 ---TRLAEYIIQDLYDESIRKISFVGHSLGGLIQAFAIAYIYEVYPWFFKKVNPINFITL 301
                L E++ Q    +   +ISF+G+S+GGL+  F I  I+      F  + P+ F+T 
Sbjct: 59  QTVVELTEFV-QARDPQKFDRISFIGYSMGGLVSRFVIGTIFTECRVIFGHMRPVLFMTF 117

Query: 302 ASPLLGIVTDNP-----------AYIKVLLSFG--VIGKTGQDLGL--ENDVEVGKXXXX 346
           A+P LG+    P           A + V    G   +G++G+ L L  END  + +    
Sbjct: 118 ATPHLGVQFYQPRNPQAKSTVMGAVLPVARFVGSHFLGRSGRQLFLAYENDDTLVRMTEG 177

Query: 347 XXXXXXXXXXXRRFKRRTVYANAINDGIVPLYTASLL----FLDYNDIL 391
                       RF+ R   AN  ND  V  YTA +     FL+ N+ L
Sbjct: 178 VYLEQLA-----RFRHRVCLANVKNDRTVAFYTAFITDCDPFLETNNQL 221

>KLLA0F16709g 1539612..1541207 weakly similar to ca|CA1159|IPF13423
           Candida albicans unknown function, start by similarity
          Length = 531

 Score = 62.8 bits (151), Expect = 5e-10,   Method: Compositional matrix adjust.
 Identities = 55/220 (25%), Positives = 99/220 (45%), Gaps = 18/220 (8%)

Query: 187 KKHLVVLTHGL-----HSNVSTDLVYIMEQIYKAQKNYPHEQIVVKGYRGNVCQTEKGVK 241
           K HLVVL HGL     H N   + +  +       K+     +V + +     +T  G+ 
Sbjct: 14  KIHLVVLVHGLWGNRSHMNEICNYLLSLNDSSAGHKSLNEMIVVHQTHLNEGYKTYDGID 73

Query: 242 YLGTRLAEYI---IQDLYDESIRKISFVGHSLGGLIQAFAIAYIYEVYPWFFKKVNPINF 298
             G R+++ I   I     + + K S +G+SLGGLI  +A+  +Y+   +    +  +NF
Sbjct: 74  VCGIRVSKEIKDQINHYGSDHVVKFSLIGYSLGGLICRYALGVLYQAQTFKKNDIELVNF 133

Query: 299 ITLASPLLGIVT--DNPA--YIKVLLSFGVIGKTGQDLGLENDVE-VGKXXXXXXXXXXX 353
           IT  +P +G++   +N A     +++   V+G +G+ + L++                  
Sbjct: 134 ITFCTPHVGVLAPGNNVAVNLFNIIVPL-VLGNSGKQMFLKDKYNGYPLLYVMSSPSSVF 192

Query: 354 XXXXRRFKRRTVYANAINDGIVPLYTASLL----FLDYND 389
               ++FK R +YAN IND     +T+ +     F D N+
Sbjct: 193 YKALKQFKYRALYANIINDKRTAWWTSGISKNDPFFDVNE 232

>Kwal_27.10102
          Length = 258

 Score = 59.7 bits (143), Expect = 1e-09,   Method: Compositional matrix adjust.
 Identities = 57/220 (25%), Positives = 99/220 (45%), Gaps = 26/220 (11%)

Query: 182 TTPQKKKHLVVLTHGLHSNVSTDLVY----IMEQIYKAQKNYPHEQIVV------KGYRG 231
           +T +K  HLVVL HGL  N S  L Y    + E     +     E++VV      +GY+ 
Sbjct: 8   STGKKPCHLVVLVHGLWGNRS-HLDYMSNALKESFESREDTCSKEELVVYTPHLNEGYK- 65

Query: 232 NVCQTEKGVKYLGTRLAEYIIQDLYD-ESIRKISFVGHSLGGLIQAFAIAYIYEVYPWFF 290
               T  G+   G R+A  I + +    S+ K S  G+SLGGLI  +A+  +++   +  
Sbjct: 66  ----TYDGIDVCGVRVASEIEEQIVSLGSVTKFSICGYSLGGLISRYALGVLHKRQLFKK 121

Query: 291 KKVNPINFITLASPLLGIVTDNPAYIKVLLSFG----VIGKTGQDLGLEN----DVEVGK 342
           + +  +NF T  +P +G+       + V L       V+G +G+ + L++      E+  
Sbjct: 122 RDIQLVNFTTFCTPHVGVYAPGKN-VAVRLYNAIVPLVLGSSGKQMFLKDKPKFSGELPL 180

Query: 343 XXXXXXXXXXXXXXXRRFKRRTVYANAINDGIVPLYTASL 382
                          + F+ +++YAN IND     +T+ +
Sbjct: 181 ILSMSLENSIFYKALQEFQTKSLYANVINDKRTAWWTSGI 220

>Sklu_2232.4 YOR059C, Contig c2232 3289-4626
          Length = 445

 Score = 60.5 bits (145), Expect = 2e-09,   Method: Compositional matrix adjust.
 Identities = 62/212 (29%), Positives = 91/212 (42%), Gaps = 26/212 (12%)

Query: 188 KHLVVLTHGLHSNVSTDLVYIMEQIYKA-QKNYPHEQIVVKGYRGN-VCQTEKGVKYLGT 245
           KHL VL HGL  N        M+ I     K +  E ++    + N   +T  G++ +G 
Sbjct: 4   KHLFVLVHGLWGNYKH-----MDSIKGVFSKTFGDENVIFFAPKQNGYFKTFDGIEIVGY 58

Query: 246 R----LAEYIIQDLYDESIRKISFVGHSLGGLIQAFAIAYIYEVYPWFFKKVNPINFITL 301
           R    L E+I +      I KISF+G+S+GGLI  F I  +       F+ +N   FIT 
Sbjct: 59  RTLLELCEFI-RKYGVGKITKISFIGYSMGGLISRFIIGKMETECQELFEGINRQLFITF 117

Query: 302 ASPLLGI----------VTDNPAYIKVLLSF---GVIGKTGQDLGLENDVEVGKXXXXXX 348
           A+P LG+           T +  ++  +LSF    V+G++G+ L +  D           
Sbjct: 118 ATPHLGVEFYLPKEKPLQTRSRRFLHSVLSFLGSTVLGRSGRQLFIR-DKHSWDSTLVKL 176

Query: 349 XXXXXXXXXRRFKRRTVYANAINDGIVPLYTA 380
                      FK R   AN  ND  V  YT+
Sbjct: 177 SSDEYLLGLSAFKYRICIANVKNDRTVAFYTS 208

>KLLA0F16423g complement(1516717..1518096) similar to sgd|S0005585
           Saccharomyces cerevisiae YOR059c, start by similarity
          Length = 459

 Score = 60.5 bits (145), Expect = 2e-09,   Method: Compositional matrix adjust.
 Identities = 53/214 (24%), Positives = 94/214 (43%), Gaps = 21/214 (9%)

Query: 183 TPQKKKHLVVLTHGLHSNVSTDLVYIMEQIYKAQKNYPHEQIVVKGYRGNVCQTEKGVKY 242
           T  KKKHL +L HGL  N    +  I E + K   +   + ++ K       +T  G++ 
Sbjct: 2   TETKKKHLFILVHGLWGN-HKHMNSIKEMLEKTLDDID-DIVIFKPENSGYLKTLHGIRV 59

Query: 243 LGTRLAEYIIQDLYD---ESIRKISFVGHSLGGLIQAFAIAYIYEVYPWFFKKVNPINFI 299
           +   + + I + + +   E   ++S +G+S+GGL+  F I  +       F+ + P+ F+
Sbjct: 60  VSYNVLDEICKFVLNYGPEKFDRVSMIGYSMGGLVSRFIIGKMVTECRDIFQHMEPMIFM 119

Query: 300 TLASPLLGIVTDNPA-----YI------KVLLSFG--VIGKTGQDLGLENDVEVGKXXXX 346
           T A+P LG+    P+     Y+       VL   G  ++G++G ++ + N  +       
Sbjct: 120 TFATPHLGVNFYLPSDKTRRYVSRKILTSVLSGLGRTILGRSGAEIFISNKDD---RILV 176

Query: 347 XXXXXXXXXXXRRFKRRTVYANAINDGIVPLYTA 380
                       RF  R  +AN  ND  V  YT+
Sbjct: 177 DLSQGEYLYGLSRFHHRVCFANVKNDRTVAFYTS 210

>Scas_632.22
          Length = 944

 Score = 33.1 bits (74), Expect = 0.83,   Method: Compositional matrix adjust.
 Identities = 15/57 (26%), Positives = 33/57 (57%), Gaps = 2/57 (3%)

Query: 163 KLTVNRLTTLDLWNLPVQITTPQKKKHLVVLTHGLHSNVSTDLVYIMEQIYKAQKNY 219
           ++T ++  T D   +P+Q+      K L++    +HS++S+ +  IME++ K  K++
Sbjct: 495 EVTYSQFLTSDF--IPIQVQGADALKTLIICNESIHSSISSQVPLIMERLLKLSKSF 549

>CAGL0M01496g complement(171045..173900) similar to tr|Q04175
           Saccharomyces cerevisiae YDR395w SXM1, start by
           similarity
          Length = 951

 Score = 33.1 bits (74), Expect = 0.98,   Method: Compositional matrix adjust.
 Identities = 15/43 (34%), Positives = 25/43 (58%)

Query: 177 LPVQITTPQKKKHLVVLTHGLHSNVSTDLVYIMEQIYKAQKNY 219
           LP+Q+      K LVVL   +H ++S+ +  IME++ K  K +
Sbjct: 508 LPIQVEAADALKSLVVLNPNIHGHISSQVPGIMEKLLKLSKEF 550

>Scas_662.1
          Length = 599

 Score = 31.2 bits (69), Expect = 3.1,   Method: Compositional matrix adjust.
 Identities = 16/32 (50%), Positives = 22/32 (68%), Gaps = 1/32 (3%)

Query: 443 NGSEIPKVSFFESASSILLPPLPERAYIMDPD 474
           NGS IPK S F  + S+L PPL +R ++ +PD
Sbjct: 73  NGSIIPK-SRFNRSPSLLFPPLRKRLHLDNPD 103

>YDR039C (ENA2) [892] chr4 complement(531302..534577) Member of the
           Na[+]-transporting ATPases family in the superfamily of
           P-type ATPases [3276 bp, 1091 aa]
          Length = 1091

 Score = 30.8 bits (68), Expect = 4.2,   Method: Compositional matrix adjust.
 Identities = 24/99 (24%), Positives = 44/99 (44%), Gaps = 25/99 (25%)

Query: 236 TEKGVKYLGTRLAEYIIQDLYDESIRKISFVGHSLGG--------------------LIQ 275
           TE+  +++GT L E + Q   DES+R++  VG +  G                    ++ 
Sbjct: 22  TEEAAEFIGTSLTEGLTQ---DESLRRLKAVGENTLGDDTKIDYKAMVLHQVCNAMIMVL 78

Query: 276 AFAIAYIYEVYPWFFKKVNPINFITLASPLLGIVTDNPA 314
             ++A  + V  W    V  I+F+   + L+G+V +  A
Sbjct: 79  VISMAISFAVRDWITGGV--ISFVIAVNVLIGLVQEYKA 115

>YDR038C (ENA5) [891] chr4 complement(527417..530692) Member of the
           Na[+]-transporting ATPases family in the superfamily of
           P-type ATPases [3276 bp, 1091 aa]
          Length = 1091

 Score = 30.8 bits (68), Expect = 4.2,   Method: Compositional matrix adjust.
 Identities = 24/99 (24%), Positives = 44/99 (44%), Gaps = 25/99 (25%)

Query: 236 TEKGVKYLGTRLAEYIIQDLYDESIRKISFVGHSLGG--------------------LIQ 275
           TE+  +++GT L E + Q   DES+R++  VG +  G                    ++ 
Sbjct: 22  TEEAAEFIGTSLTEGLTQ---DESLRRLKAVGENTLGDDTKIDYKAMVLHQVCNAMIMVL 78

Query: 276 AFAIAYIYEVYPWFFKKVNPINFITLASPLLGIVTDNPA 314
             ++A  + V  W    V  I+F+   + L+G+V +  A
Sbjct: 79  VISMAISFAVRDWITGGV--ISFVIAVNVLIGLVQEYKA 115

>KLLA0B04224g complement(382676..383515) no similarity, hypothetical
           start
          Length = 279

 Score = 30.0 bits (66), Expect = 5.3,   Method: Compositional matrix adjust.
 Identities = 18/63 (28%), Positives = 29/63 (46%)

Query: 49  KVRNMNPLSYRAAYLMGPFMLYCDVKTAQYHHSQKIVASVDYPKFEPNVQTQQDFVAELS 108
           KV+N +P+      +  PF++Y  +K+A Y  S K     D    E N +   D V+   
Sbjct: 80  KVKNKDPIILMIILITVPFLIYKIMKSAAYLLSAKNTKDFDTTNIELNTEVTGDEVSTKP 139

Query: 109 VHN 111
            H+
Sbjct: 140 SHH 142

>KLLA0C06589g 575605..578454 similar to sgd|S0002803 Saccharomyces
           cerevisiae YDR395w SXM1 putative beta-karyopherin, start
           by similarity
          Length = 949

 Score = 30.4 bits (67), Expect = 5.7,   Method: Compositional matrix adjust.
 Identities = 14/44 (31%), Positives = 25/44 (56%)

Query: 176 NLPVQITTPQKKKHLVVLTHGLHSNVSTDLVYIMEQIYKAQKNY 219
           +LP+QI +    K LV+    +HS++ +    IME++ K  K +
Sbjct: 511 SLPIQIVSADALKTLVISNPDIHSHIKSQAPQIMERLLKLSKEF 554

>AFL179C [3016] [Homologous to ScYNR008W (LRO1) - SH]
           (101798..103735) [1938 bp, 645 aa]
          Length = 645

 Score = 30.0 bits (66), Expect = 7.3,   Method: Compositional matrix adjust.
 Identities = 20/73 (27%), Positives = 37/73 (50%), Gaps = 10/73 (13%)

Query: 252 IQDLYDESIRKISFVGHSLGGLIQAFAIAYIY---EVY-----PWFFKKVNPINFITLAS 303
           ++ +YD +  K   VGHS+G  I  + + ++    E+Y      W  K ++  +F+ +A 
Sbjct: 291 VEMMYDATGEKSVLVGHSMGSQIIFYFLKWVEAEGELYGNGGPGWVEKHID--SFVNVAG 348

Query: 304 PLLGIVTDNPAYI 316
            LLG+    PA +
Sbjct: 349 TLLGVPKAMPALL 361

>Scas_707.2
          Length = 594

 Score = 29.6 bits (65), Expect = 9.8,   Method: Compositional matrix adjust.
 Identities = 23/71 (32%), Positives = 33/71 (46%), Gaps = 10/71 (14%)

Query: 598 VEPIQSVTEGKKKYRKAENIPQEYGWLNKVETNGVFDEGPTGMISTVGEIVEALAKRGFS 657
           VEPI+ V+E   + R A +  Q      K++ +  +     G+  T  EI+  L K   S
Sbjct: 273 VEPIEVVSEHNGQSRMAPDFNQR-----KMDVSVAYINSALGLEQTPAEIIACLKKMSLS 327

Query: 658 AVIDRRNASED 668
           AV     ASED
Sbjct: 328 AV-----ASED 333

  Database: blastdb
    Posted date:  Apr 3, 2006  3:33 PM
  Number of letters in database: 16,596,109
  Number of sequences in database:  34,618
  
Lambda     K      H
   0.318    0.136    0.402 

Gapped
Lambda     K      H
   0.267   0.0410    0.140 

Matrix: BLOSUM62
Gap Penalties: Existence: 11, Extension: 1
Number of Sequences: 34618
Number of Hits to DB: 22,165,839
Number of extensions: 982699
Number of successful extensions: 2801
Number of sequences better than 10.0: 47
Number of HSP's gapped: 2769
Number of HSP's successfully gapped: 53
Length of query: 673
Length of database: 16,596,109
Length adjustment: 108
Effective length of query: 565
Effective length of database: 12,857,365
Effective search space: 7264411225
Effective search space used: 7264411225
Neighboring words threshold: 11
Window for multiple hits: 40
X1: 16 ( 7.3 bits)
X2: 38 (14.6 bits)
X3: 64 (24.7 bits)
S1: 41 (21.7 bits)
S2: 65 (29.6 bits)