Hit NameLength (aa)HSP LengthHSP ScoreHSP Significance
YGL143C (MRF1)41340619660.0
Scas_618.1340736112471e-171
KLLA0E14850g39636612411e-170
Sklu_1484.339936212211e-167
ADL284C42236111931e-163
Kwal_23.346740036411901e-162
CAGL0E04928g40536210891e-147
Scas_590.1116371092e-06
AGR281C176371088e-06
Kwal_56.23313158371042e-05
YLR281C155371042e-05
KLLA0C04642g168371033e-05
Sklu_2044.512340987e-05
CAGL0F05027g18739991e-04
KLLA0A10219g47575663.4
BLASTP 2.2.26 [Sep-21-2011]

Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, 
Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), 
"Gapped BLAST and PSI-BLAST: a new generation of protein database search
programs",  Nucleic Acids Res. 25:3389-3402.

Reference for compositional score matrix adjustment: Altschul, Stephen F., 
John C. Wootton, E. Michael Gertz, Richa Agarwala, Aleksandr Morgulis,
Alejandro A. Schaffer, and Yi-Kuo Yu (2005) "Protein database searches
using compositionally adjusted substitution matrices", FEBS J. 272:5101-5109.

Query= YGL143C
         (406 letters)

Database: blastdb 
           34,618 sequences; 16,596,109 total letters

Searching..................................................done

                                                                 Score    E
Sequences producing significant alignments:                      (bits) Value

YGL143C (MRF1) [1844] chr7 complement(234720..235961) Mitochondr...   761   0.0  
Scas_618.13                                                           484   e-171
KLLA0E14850g 1324910..1326100 gi|1172907|sp|P41767|RF1M_KLULA Kl...   482   e-170
Sklu_1484.3 YGL143C, Contig c1484 4090-5289                           474   e-167
ADL284C [1457] [Homologous to ScYGL143C (MRF1) - SH] (203883..20...   464   e-163
Kwal_23.3467                                                          462   e-162
CAGL0E04928g 476972..478189 similar to sp|P30775 Saccharomyces c...   424   e-147
Scas_590.1                                                             47   2e-06
AGR281C [4592] [Homologous to ScYLR281C - SH] (1270719..1271249)...    46   8e-06
Kwal_56.23313                                                          45   2e-05
YLR281C (YLR281C) [3672] chr12 complement(704495..704962) Protei...    45   2e-05
KLLA0C04642g complement(427221..427727) some similarities with s...    44   3e-05
Sklu_2044.5 YLR281C, Contig c2044 6176-6547                            42   7e-05
CAGL0F05027g complement(512367..512930) similar to tr|Q05863 Sac...    43   1e-04
KLLA0A10219g 896931..898358 similar to sp|P38889 Saccharomyces c...    30   3.4  

>YGL143C (MRF1) [1844] chr7 complement(234720..235961) Mitochondrial
           peptide chain release factor, directs termination of
           translation in response to termination codons UAA and
           UAG [1242 bp, 413 aa]
          Length = 413

 Score =  761 bits (1966), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 372/406 (91%), Positives = 372/406 (91%)

Query: 1   MWLSKFQFPSRSIFKGVFLGHKLPLLVRLXXXXXXXXXXXXIPTQYTELSPLLVKQAEKY 60
           MWLSKFQFPSRSIFKGVFLGHKLPLLVRL            IPTQYTELSPLLVKQAEKY
Sbjct: 1   MWLSKFQFPSRSIFKGVFLGHKLPLLVRLTSTTTNSKSNGSIPTQYTELSPLLVKQAEKY 60

Query: 61  EAELKDLDKDLSCGIHFDVNKQKHYAKLSALTDTFIEYKEKLNELKSLQEMIVSDPSLRA 120
           EAELKDLDKDLSCGIHFDVNKQKHYAKLSALTDTFIEYKEKLNELKSLQEMIVSDPSLRA
Sbjct: 61  EAELKDLDKDLSCGIHFDVNKQKHYAKLSALTDTFIEYKEKLNELKSLQEMIVSDPSLRA 120

Query: 121 EAEQEYAELVPQYETTSSRLVNKLLPPHPFADKPSLLELRPGVGGIEAMIFTQNLLDMYI 180
           EAEQEYAELVPQYETTSSRLVNKLLPPHPFADKPSLLELRPGVGGIEAMIFTQNLLDMYI
Sbjct: 121 EAEQEYAELVPQYETTSSRLVNKLLPPHPFADKPSLLELRPGVGGIEAMIFTQNLLDMYI 180

Query: 181 GYANYRKWKYRIISKNENESGSGIIDAILSIEEAGSYDRLRFEAGVHRVQRIPSTETKGR 240
           GYANYRKWKYRIISKNENESGSGIIDAILSIEEAGSYDRLRFEAGVHRVQRIPSTETKGR
Sbjct: 181 GYANYRKWKYRIISKNENESGSGIIDAILSIEEAGSYDRLRFEAGVHRVQRIPSTETKGR 240

Query: 241 THTSTAAVVVLPQIGDESAKSIDAYERTFKPGEIRVDIMRASGKGGQHVNTTDSAVRLTH 300
           THTSTAAVVVLPQIGDESAKSIDAYERTFKPGEIRVDIMRASGKGGQHVNTTDSAVRLTH
Sbjct: 241 THTSTAAVVVLPQIGDESAKSIDAYERTFKPGEIRVDIMRASGKGGQHVNTTDSAVRLTH 300

Query: 301 IPSGIVVSMQDERSQHKNKAKAFTIXXXXXXXXXXXXXXXXXXXXXXSQVSSTNRSDKIR 360
           IPSGIVVSMQDERSQHKNKAKAFTI                      SQVSSTNRSDKIR
Sbjct: 301 IPSGIVVSMQDERSQHKNKAKAFTILRARLAEKERLEKEEKERKARKSQVSSTNRSDKIR 360

Query: 361 TYNFPQNRITDHRCGFTLLDLPGVLSGERLDEVIEAMSKYDSTERA 406
           TYNFPQNRITDHRCGFTLLDLPGVLSGERLDEVIEAMSKYDSTERA
Sbjct: 361 TYNFPQNRITDHRCGFTLLDLPGVLSGERLDEVIEAMSKYDSTERA 406

>Scas_618.13
          Length = 407

 Score =  484 bits (1247), Expect = e-171,   Method: Compositional matrix adjust.
 Identities = 228/361 (63%), Positives = 282/361 (78%)

Query: 46  YTELSPLLVKQAEKYEAELKDLDKDLSCGIHFDVNKQKHYAKLSALTDTFIEYKEKLNEL 105
           + EL P L+ +A +Y  EL +L+K LS G  FDV +QK +A L+++ D F  Y+ +L+  
Sbjct: 43  HVELQPALISKATEYMKELAELNKQLSQGETFDVAQQKRFAHLASIEDAFQTYQTQLSNY 102

Query: 106 KSLQEMIVSDPSLRAEAEQEYAELVPQYETTSSRLVNKLLPPHPFADKPSLLELRPGVGG 165
           KSLQE+  SDPSL+ EA+ E  ELVPQ   T + L ++L+PPHPFADK  +LELRPGVGG
Sbjct: 103 KSLQELAQSDPSLKEEAQLELTELVPQLSQTMNELQSRLIPPHPFADKACILELRPGVGG 162

Query: 166 IEAMIFTQNLLDMYIGYANYRKWKYRIISKNENESGSGIIDAILSIEEAGSYDRLRFEAG 225
            EAMIFTQ+LL+MYIGYA+  KWKYRI++++ENESG G++DAIL+I+E GSYD+LRFE+G
Sbjct: 163 TEAMIFTQDLLNMYIGYAHSHKWKYRILAQDENESGDGLVDAILNIDEPGSYDKLRFESG 222

Query: 226 VHRVQRIPSTETKGRTHTSTAAVVVLPQIGDESAKSIDAYERTFKPGEIRVDIMRASGKG 285
           VHRVQRIP+TETKGRTHTSTAAVVVLPQ+GD+S ++I+AYERTFKP EIR+D+MRA GKG
Sbjct: 223 VHRVQRIPATETKGRTHTSTAAVVVLPQMGDDSDRAINAYERTFKPDEIRIDVMRARGKG 282

Query: 286 GQHVNTTDSAVRLTHIPSGIVVSMQDERSQHKNKAKAFTIXXXXXXXXXXXXXXXXXXXX 345
           GQHVNTTDSAVRLTH P+GIVVSMQDERSQ KNKAKAFTI                    
Sbjct: 283 GQHVNTTDSAVRLTHFPTGIVVSMQDERSQQKNKAKAFTILRARLAEREQKLKEEKERDA 342

Query: 346 XXSQVSSTNRSDKIRTYNFPQNRITDHRCGFTLLDLPGVLSGERLDEVIEAMSKYDSTER 405
              QV++T+RSDKIRTYN+PQNR+TDHRCG TL  L  ++ GERL EVI+AM ++D  ER
Sbjct: 343 RKEQVTTTDRSDKIRTYNYPQNRVTDHRCGLTLYALDAIMKGERLGEVIDAMRQFDDRER 402

Query: 406 A 406
           A
Sbjct: 403 A 403

>KLLA0E14850g 1324910..1326100 gi|1172907|sp|P41767|RF1M_KLULA
           Kluyveromyces lactis Peptide chain release factor 1,
           mitochondrial precursor (MRF-1), start by similarity
          Length = 396

 Score =  482 bits (1241), Expect = e-170,   Method: Compositional matrix adjust.
 Identities = 230/366 (62%), Positives = 287/366 (78%), Gaps = 5/366 (1%)

Query: 44  TQYTELSPL---LVKQAEKYEAELKDLDKDLSCGIHFDVNKQKHYAKLSALTDTFIEYKE 100
           ++  E  PL   L+ +AE Y  EL++L+  LS G  FD+ KQK++AKLS + D++ +Y+E
Sbjct: 24  SEAVEFRPLHSSLISRAELYVNELRELEDLLSQGGSFDLEKQKNFAKLSTIVDSYSKYRE 83

Query: 101 KLNELKSLQEMIVSDPSLRAEAEQEYAELVPQYETTSSRLVNKLLPPHPFADKPSLLELR 160
           ++N+ K LQE++  DPSLR EAE + A L+P    T   L+NKLLPPHPFADKPS+LELR
Sbjct: 84  EVNQYKELQEILELDPSLREEAEADIAALLPDLNKTGDSLLNKLLPPHPFADKPSILELR 143

Query: 161 PGVGGIEAMIFTQNLLDMYIGYANYRKWKYRIISKNENESGSGIIDAILSIEEAGSYDRL 220
           PGVGG EAMIFTQ+LL+MYI YANY KWK+ +ISK EN SGSG+++AIL+I+E GSYD+L
Sbjct: 144 PGVGGSEAMIFTQDLLNMYINYANYHKWKWNLISKTENASGSGVLEAILNIDEPGSYDKL 203

Query: 221 RFEAGVHRVQRIPSTETKGRTHTSTAAVVVLPQIGDESAKSIDAYERTFKPGEIRVDIMR 280
           +FEAGVHRVQR+P+TE+KGRTHTSTAAV+VLP++G+ES    DAYERTFKP EIR+D+MR
Sbjct: 204 KFEAGVHRVQRVPATESKGRTHTSTAAVIVLPKMGEESES--DAYERTFKPDEIRIDVMR 261

Query: 281 ASGKGGQHVNTTDSAVRLTHIPSGIVVSMQDERSQHKNKAKAFTIXXXXXXXXXXXXXXX 340
           ASGKGGQHVNTTDSAVRLTH PSGIV+SMQ+ERSQH+NKAKAF I               
Sbjct: 262 ASGKGGQHVNTTDSAVRLTHYPSGIVISMQEERSQHRNKAKAFAILRARLAEKERLEKEE 321

Query: 341 XXXXXXXSQVSSTNRSDKIRTYNFPQNRITDHRCGFTLLDLPGVLSGERLDEVIEAMSKY 400
                   QVS+T+RSDKIRTYN+PQNRITDHRCGFTL D+ GV+ GERLD+VI+AM  +
Sbjct: 322 KERNARKDQVSTTDRSDKIRTYNYPQNRITDHRCGFTLYDIEGVMKGERLDDVIDAMDAF 381

Query: 401 DSTERA 406
            S ++A
Sbjct: 382 SSEQKA 387

>Sklu_1484.3 YGL143C, Contig c1484 4090-5289
          Length = 399

 Score =  474 bits (1221), Expect = e-167,   Method: Compositional matrix adjust.
 Identities = 234/362 (64%), Positives = 283/362 (78%)

Query: 45  QYTELSPLLVKQAEKYEAELKDLDKDLSCGIHFDVNKQKHYAKLSALTDTFIEYKEKLNE 104
           ++ EL PLL+K+AEK+  EL  L+  LS G  FDV +QK +A+LS++ DTF  YK+ L+ 
Sbjct: 27  EFKELHPLLIKRAEKHVDELNKLEGLLSKGSSFDVERQKKFAELSSIVDTFQNYKDGLDN 86

Query: 105 LKSLQEMIVSDPSLRAEAEQEYAELVPQYETTSSRLVNKLLPPHPFADKPSLLELRPGVG 164
            K L++MI  DPSL  EA  E  E++P    +SS L+NKLLPPHPFADKP +LELRPGVG
Sbjct: 87  YKDLKDMIQQDPSLEKEARIELEEIMPALIKSSSSLLNKLLPPHPFADKPCILELRPGVG 146

Query: 165 GIEAMIFTQNLLDMYIGYANYRKWKYRIISKNENESGSGIIDAILSIEEAGSYDRLRFEA 224
           G EAMIF Q+LL MYI YA+ ++WKY I SK+ENESGSGI+DAILSI+E GSY++LRFEA
Sbjct: 147 GTEAMIFAQDLLHMYINYAHTKRWKYHITSKSENESGSGILDAILSIDEPGSYNKLRFEA 206

Query: 225 GVHRVQRIPSTETKGRTHTSTAAVVVLPQIGDESAKSIDAYERTFKPGEIRVDIMRASGK 284
           GVHRVQRIP+TETKGRTHTSTAAV+VLPQ+G+ES K  DAYERTFKP EIR+D+MRA GK
Sbjct: 207 GVHRVQRIPATETKGRTHTSTAAVIVLPQMGEESEKEADAYERTFKPDEIRIDVMRARGK 266

Query: 285 GGQHVNTTDSAVRLTHIPSGIVVSMQDERSQHKNKAKAFTIXXXXXXXXXXXXXXXXXXX 344
           GGQHVNTTDSAVRLTH PSGIV+SMQ+ERSQHKNKAKAF I                   
Sbjct: 267 GGQHVNTTDSAVRLTHFPSGIVISMQNERSQHKNKAKAFAILRAKLAERERKEKEESARA 326

Query: 345 XXXSQVSSTNRSDKIRTYNFPQNRITDHRCGFTLLDLPGVLSGERLDEVIEAMSKYDSTE 404
               QV++T+RSDKIRTYNFPQNRITDHRCGF L ++ GV++GERLD+VIEAM +Y+   
Sbjct: 327 ARKGQVTTTDRSDKIRTYNFPQNRITDHRCGFNLHNIDGVMAGERLDDVIEAMERYEGAT 386

Query: 405 RA 406
           ++
Sbjct: 387 KS 388

>ADL284C [1457] [Homologous to ScYGL143C (MRF1) - SH]
           (203883..205151) [1269 bp, 422 aa]
          Length = 422

 Score =  464 bits (1193), Expect = e-163,   Method: Compositional matrix adjust.
 Identities = 218/361 (60%), Positives = 278/361 (77%), Gaps = 2/361 (0%)

Query: 46  YTELSPLLVKQAEKYEAELKDLDKDLSCGIHFDVNKQKHYAKLSALTDTFIEYKEKLNEL 105
           + EL P L+K+A  Y AEL+ L+K LS G  FDV KQK Y+KLS++ DTF  Y++ ++  
Sbjct: 53  FRELHPSLIKRATGYAAELETLEKLLSKGESFDVEKQKKYSKLSSIVDTFRAYQDNVHMY 112

Query: 106 KSLQEMIVSDPSLRAEAEQEYAELVPQYETTSSRLVNKLLPPHPFADKPSLLELRPGVGG 165
           + LQ+MI  D SLR EA+ E  EL P    ++  L++KLLPPHPFA+KP ++ELRPGVGG
Sbjct: 113 RELQDMIAQDASLRTEAQAELDELAPTLARSADTLLDKLLPPHPFAEKPCIVELRPGVGG 172

Query: 166 IEAMIFTQNLLDMYIGYANYRKWKYRIISKNENESGSGIIDAILSIEEAGSYDRLRFEAG 225
           IEAMIFTQ+LL+MYIGYA + +WK+ + S  EN +G+G+ +AILSI+E GSYDR++FE+G
Sbjct: 173 IEAMIFTQDLLNMYIGYAQHHRWKWSVTSATENTTGAGLSEAILSIDEPGSYDRVKFESG 232

Query: 226 VHRVQRIPSTETKGRTHTSTAAVVVLPQIGDESAKSIDAYERTFKPGEIRVDIMRASGKG 285
           VHRVQRIP+TE+KGRTHTSTAAVVVLP++ +E+    DAYERTFKPGEIR+D+MRASGKG
Sbjct: 233 VHRVQRIPATESKGRTHTSTAAVVVLPKMAEEAES--DAYERTFKPGEIRIDVMRASGKG 290

Query: 286 GQHVNTTDSAVRLTHIPSGIVVSMQDERSQHKNKAKAFTIXXXXXXXXXXXXXXXXXXXX 345
           GQHVNTTDSAVR+TH PSGI + MQ+ERSQH+NKAKAF I                    
Sbjct: 291 GQHVNTTDSAVRITHFPSGIAIHMQEERSQHRNKAKAFQILRAKLADLERKEREARERSA 350

Query: 346 XXSQVSSTNRSDKIRTYNFPQNRITDHRCGFTLLDLPGVLSGERLDEVIEAMSKYDSTER 405
              QVSST+RSDKIRTYNFPQNR+TDHRC  +L  L  V++GERLDE+I++M++YDS ++
Sbjct: 351 RKDQVSSTDRSDKIRTYNFPQNRVTDHRCAVSLHALAEVVTGERLDELIDSMARYDSEQK 410

Query: 406 A 406
           A
Sbjct: 411 A 411

>Kwal_23.3467
          Length = 400

 Score =  462 bits (1190), Expect = e-162,   Method: Compositional matrix adjust.
 Identities = 228/364 (62%), Positives = 287/364 (78%), Gaps = 1/364 (0%)

Query: 44  TQYTELSPLLVKQAEKYEAELKDLDKDLS-CGIHFDVNKQKHYAKLSALTDTFIEYKEKL 102
           T++ EL PLL+K+AEKY  EL+ L++ ++  G  FDV +QK ++KLSA+ D+F  Y  ++
Sbjct: 26  TEFKELHPLLLKRAEKYVEELQKLEEWMAKGGGSFDVERQKKFSKLSAVVDSFRIYSREV 85

Query: 103 NELKSLQEMIVSDPSLRAEAEQEYAELVPQYETTSSRLVNKLLPPHPFADKPSLLELRPG 162
           +  K LQ+M+  DPSLR EAE E  ++ PQ E T+S L+ +LLPPHPFAD+P +LE+RPG
Sbjct: 86  STFKELQDMVKDDPSLRDEAELELVQIKPQLEKTASSLLTQLLPPHPFADRPCILEIRPG 145

Query: 163 VGGIEAMIFTQNLLDMYIGYANYRKWKYRIISKNENESGSGIIDAILSIEEAGSYDRLRF 222
           VGGIEAMIF Q+LL+MYI +A+ ++WKY +IS +ENESGSGI+DAILSI+E GSY+ LRF
Sbjct: 146 VGGIEAMIFAQDLLNMYINFAHIKRWKYHLISSSENESGSGIVDAILSIDEPGSYEMLRF 205

Query: 223 EAGVHRVQRIPSTETKGRTHTSTAAVVVLPQIGDESAKSIDAYERTFKPGEIRVDIMRAS 282
           E+GVHRVQRIP+TETKGRTHTSTAAVVVLPQ+ ++S K  D+YERTFKP EIR+D+MRA 
Sbjct: 206 ESGVHRVQRIPATETKGRTHTSTAAVVVLPQMAEDSEKEADSYERTFKPDEIRIDVMRAR 265

Query: 283 GKGGQHVNTTDSAVRLTHIPSGIVVSMQDERSQHKNKAKAFTIXXXXXXXXXXXXXXXXX 342
           GKGGQHVNTTDSAVRLTH PSGIV++MQ+ERSQHKNKAKAF I                 
Sbjct: 266 GKGGQHVNTTDSAVRLTHYPSGIVINMQNERSQHKNKAKAFAILRARLAEAERKEKEEKA 325

Query: 343 XXXXXSQVSSTNRSDKIRTYNFPQNRITDHRCGFTLLDLPGVLSGERLDEVIEAMSKYDS 402
                 QV++T+RSDKIRTYNFPQNR+TDHRCGF L D+ G+++GERL++VI AMS YDS
Sbjct: 326 RALRKGQVTTTDRSDKIRTYNFPQNRVTDHRCGFNLHDMEGIMAGERLEDVISAMSVYDS 385

Query: 403 TERA 406
             RA
Sbjct: 386 DSRA 389

>CAGL0E04928g 476972..478189 similar to sp|P30775 Saccharomyces
           cerevisiae YGL143c MRF1 peptide chain release factor,
           hypothetical start
          Length = 405

 Score =  424 bits (1089), Expect = e-147,   Method: Compositional matrix adjust.
 Identities = 209/362 (57%), Positives = 271/362 (74%), Gaps = 3/362 (0%)

Query: 45  QYTELSPLLVKQAEKYEAELKDLDKDLSCGIHFDVNKQKHYAKLSALTDTFIEYKEKLNE 104
           ++ EL+PLL+K+      EL +L+K +S G  +D + Q+ Y  L +L D +  YKE+L  
Sbjct: 38  EFQELNPLLLKRVSGVSKELAELEKQISNG--YDEDVQRKYNSLMSLQDVYDRYKEQLGN 95

Query: 105 LKSLQEMIVSDPSLRAEAEQEYAELVPQYETTSSRLVNKLLPPHPFADKPSLLELRPGVG 164
            + L+EMI  D SL  EA  E  ELVP  + T+  L+++L+PPHPFA+K  +LELRPGVG
Sbjct: 96  YRELKEMIDVDKSLAEEAAAELHELVPNLKKTTQDLLHRLIPPHPFAEKACMLELRPGVG 155

Query: 165 GIEAMIFTQNLLDMYIGYANYRKWKYRIISKNENESGSGIIDAILSIEEAGSYDRLRFEA 224
           G EAMIF ++LL+MYIGYA+ +KWK+ I+S  ENE+GSGI+DA+L+I+E G+Y+ L++EA
Sbjct: 156 GSEAMIFAKDLLNMYIGYAHNKKWKHHIVSIRENEAGSGIMDAVLAIDEPGTYNILKYEA 215

Query: 225 GVHRVQRIPSTETKGRTHTSTAAVVVLPQIGDESAKSIDAYERTFKPGEIRVDIMRASGK 284
           GVHRVQRIP+TE+KGRTHTSTAAVVVLPQ+GDE  K +DA+ER+FKP EIR+D+ RASGK
Sbjct: 216 GVHRVQRIPATESKGRTHTSTAAVVVLPQLGDE-GKDLDAFERSFKPEEIRIDVKRASGK 274

Query: 285 GGQHVNTTDSAVRLTHIPSGIVVSMQDERSQHKNKAKAFTIXXXXXXXXXXXXXXXXXXX 344
           GGQHVNTT+SAVRLTHIP+GI++ MQDERSQH+NKAKAF+I                   
Sbjct: 275 GGQHVNTTESAVRLTHIPTGIMIHMQDERSQHRNKAKAFSILRSKLAELEQQQKAEKERQ 334

Query: 345 XXXSQVSSTNRSDKIRTYNFPQNRITDHRCGFTLLDLPGVLSGERLDEVIEAMSKYDSTE 404
               QV++ +RSDKIRTYNF QNRITDHRCG  L DL GV+SGERLD+VI A+  +D   
Sbjct: 335 VRKEQVTTMDRSDKIRTYNFSQNRITDHRCGLNLYDLEGVISGERLDDVINAVRSFDDNI 394

Query: 405 RA 406
           +A
Sbjct: 395 QA 396

>Scas_590.1
          Length = 116

 Score = 46.6 bits (109), Expect = 2e-06,   Method: Compositional matrix adjust.
 Identities = 18/37 (48%), Positives = 28/37 (75%)

Query: 283 GKGGQHVNTTDSAVRLTHIPSGIVVSMQDERSQHKNK 319
           G GGQ +N  +S V+L H+P+GI+VS Q+ RS+ +N+
Sbjct: 3   GAGGQKINKCNSKVQLKHVPTGIIVSCQETRSRDQNR 39

>AGR281C [4592] [Homologous to ScYLR281C - SH] (1270719..1271249)
           [531 bp, 176 aa]
          Length = 176

 Score = 46.2 bits (108), Expect = 8e-06,   Method: Compositional matrix adjust.
 Identities = 18/37 (48%), Positives = 26/37 (70%)

Query: 283 GKGGQHVNTTDSAVRLTHIPSGIVVSMQDERSQHKNK 319
           G GGQ +N  +S V+L H+PSGIV+  Q  RS+ +N+
Sbjct: 63  GPGGQKINKCNSKVQLRHVPSGIVIECQATRSREQNR 99

>Kwal_56.23313
          Length = 158

 Score = 44.7 bits (104), Expect = 2e-05,   Method: Compositional matrix adjust.
 Identities = 18/37 (48%), Positives = 27/37 (72%)

Query: 283 GKGGQHVNTTDSAVRLTHIPSGIVVSMQDERSQHKNK 319
           G GGQ +N  +S V+L H+P+GIVV  Q+ RS+ +N+
Sbjct: 49  GPGGQKINKCNSKVQLRHLPTGIVVECQETRSRDQNR 85

>YLR281C (YLR281C) [3672] chr12 complement(704495..704962) Protein
           containing a peptidyl-tRNA hydrolase domain, which
           contain peptidyl-tRNA hydrolase activity [468 bp, 155
           aa]
          Length = 155

 Score = 44.7 bits (104), Expect = 2e-05,   Method: Compositional matrix adjust.
 Identities = 18/37 (48%), Positives = 26/37 (70%)

Query: 283 GKGGQHVNTTDSAVRLTHIPSGIVVSMQDERSQHKNK 319
           G GGQ +N  +S V+L H P+GIVV  Q+ RS+ +N+
Sbjct: 47  GPGGQKINKCNSKVQLRHEPTGIVVECQETRSREQNR 83

>KLLA0C04642g complement(427221..427727) some similarities with
           sgd|S0004271 Saccharomyces cerevisiae YLR281c,
           hypothetical start
          Length = 168

 Score = 44.3 bits (103), Expect = 3e-05,   Method: Compositional matrix adjust.
 Identities = 18/37 (48%), Positives = 26/37 (70%)

Query: 283 GKGGQHVNTTDSAVRLTHIPSGIVVSMQDERSQHKNK 319
           G GGQ +N  +S V+L H+P+GIVV  Q  RS+ +N+
Sbjct: 58  GPGGQKINKCNSKVQLRHVPTGIVVDCQATRSRDQNR 94

>Sklu_2044.5 YLR281C, Contig c2044 6176-6547
          Length = 123

 Score = 42.4 bits (98), Expect = 7e-05,   Method: Composition-based stats.
 Identities = 19/40 (47%), Positives = 28/40 (70%)

Query: 283 GKGGQHVNTTDSAVRLTHIPSGIVVSMQDERSQHKNKAKA 322
           G GGQ +N  +S V+L H+P+GIVV  Q+ RS+ +N+  A
Sbjct: 15  GPGGQKINKCNSKVQLKHLPTGIVVECQETRSRDQNRTIA 54

>CAGL0F05027g complement(512367..512930) similar to tr|Q05863
           Saccharomyces cerevisiae YLR281c, hypothetical start
          Length = 187

 Score = 42.7 bits (99), Expect = 1e-04,   Method: Compositional matrix adjust.
 Identities = 17/39 (43%), Positives = 27/39 (69%)

Query: 281 ASGKGGQHVNTTDSAVRLTHIPSGIVVSMQDERSQHKNK 319
            +G GGQ +N  +S V++ H+PS IVV+ Q  RS+ +N+
Sbjct: 59  GTGPGGQKINKCNSKVQIKHVPSNIVVTCQATRSRDQNR 97

>KLLA0A10219g 896931..898358 similar to sp|P38889 Saccharomyces
           cerevisiae YHR206w SKN7 transcription factor with, start
           by similarity
          Length = 475

 Score = 30.0 bits (66), Expect = 3.4,   Method: Compositional matrix adjust.
 Identities = 20/75 (26%), Positives = 37/75 (49%), Gaps = 10/75 (13%)

Query: 171 FTQNLLDMYIGYANY-------RKWKYRIISKNENESGSGIIDAILSIEEAGSYDRLRFE 223
           FT ++L  +  ++N+        K+ +  + + +NE   GI +A    E    Y R   E
Sbjct: 77  FTTDILPKHFKHSNFASFVRQLNKYDFHKVKRKKNEVSEGIQNAW---EFNHQYFRRHDE 133

Query: 224 AGVHRVQRIPSTETK 238
           AG+  ++R PS++ K
Sbjct: 134 AGLDNIRRKPSSQKK 148

  Database: blastdb
    Posted date:  Apr 3, 2006  3:33 PM
  Number of letters in database: 16,596,109
  Number of sequences in database:  34,618
  
Lambda     K      H
   0.316    0.133    0.375 

Gapped
Lambda     K      H
   0.267   0.0410    0.140 

Matrix: BLOSUM62
Gap Penalties: Existence: 11, Extension: 1
Number of Sequences: 34618
Number of Hits to DB: 11,790,902
Number of extensions: 461393
Number of successful extensions: 1660
Number of sequences better than 10.0: 37
Number of HSP's gapped: 1675
Number of HSP's successfully gapped: 37
Length of query: 406
Length of database: 16,596,109
Length adjustment: 104
Effective length of query: 302
Effective length of database: 12,995,837
Effective search space: 3924742774
Effective search space used: 3924742774
Neighboring words threshold: 11
Window for multiple hits: 40
X1: 16 ( 7.3 bits)
X2: 38 (14.6 bits)
X3: 64 (24.7 bits)
S1: 41 (21.6 bits)
S2: 63 (28.9 bits)