Hit NameLength (aa)HSP LengthHSP ScoreHSP Significance
YGL142C (GPI10)61660529460.0
Scas_669.1159659816660.0
KLLA0E14762g60159516440.0
CAGL0F07843g61259716430.0
Kwal_23.347861858614900.0
ADL281C59559714790.0
Scas_714.365143541221e-06
KLLA0D19404g5532411193e-06
CAGL0K09548g4962431175e-06
Kwal_23.63175451771032e-04
AAR043C537184960.002
Sklu_1475.2508290920.005
KLLA0C06567g530136890.011
KLLA0C08591g541134880.015
ABL185C552197850.032
Scas_606.6571132850.034
Kwal_47.18842508170840.043
YOR149C (SMP3)516272780.21
Kwal_23.447655239740.63
CAGL0M10769g56251692.9
AFR395C52892674.7
AFR002C123043675.8
Sklu_1894.355146665.8
CAGL0K08206g116957658.2
BLASTP 2.2.26 [Sep-21-2011]

Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, 
Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), 
"Gapped BLAST and PSI-BLAST: a new generation of protein database search
programs",  Nucleic Acids Res. 25:3389-3402.

Reference for compositional score matrix adjustment: Altschul, Stephen F., 
John C. Wootton, E. Michael Gertz, Richa Agarwala, Aleksandr Morgulis,
Alejandro A. Schaffer, and Yi-Kuo Yu (2005) "Protein database searches
using compositionally adjusted substitution matrices", FEBS J. 272:5101-5109.

Query= YGL142C
         (605 letters)

Database: blastdb 
           34,618 sequences; 16,596,109 total letters

Searching..................................................done

                                                                 Score    E
Sequences producing significant alignments:                      (bits) Value

YGL142C (GPI10) [1845] chr7 complement(236272..238122) Protein i...  1139   0.0  
Scas_669.11                                                           646   0.0  
KLLA0E14762g 1319163..1320968 similar to sp|P30777 Saccharomyces...   637   0.0  
CAGL0F07843g 766285..768123 similar to sp|P30777 Saccharomyces c...   637   0.0  
Kwal_23.3478                                                          578   0.0  
ADL281C [1460] [Homologous to ScYGL142C (GPI10) - SH] (207452..2...   574   0.0  
Scas_714.36                                                            52   1e-06
KLLA0D19404g 1632929..1634590 similar to sp|P53868 Saccharomyces...    50   3e-06
CAGL0K09548g complement(940088..941578) similar to sp|Q04174 Sac...    50   5e-06
Kwal_23.6317                                                           44   2e-04
AAR043C [229] [Homologous to ScYNR030W (ECM39) - SH] (418301..41...    42   0.002
Sklu_1475.2 YOR149C, Contig c1475 982-2508 reverse complement          40   0.005
KLLA0C06567g complement(573595..575187) similar to sp|Q04174 Sac...    39   0.011
KLLA0C08591g complement(752256..753881) similar to sp|P53730 Sac...    39   0.015
ABL185C [407] [Homologous to ScYNL219C (ALG9) - SH] (60000..6165...    37   0.032
Scas_606.6                                                             37   0.034
Kwal_47.18842                                                          37   0.043
YOR149C (SMP3) [4948] chr15 complement(609838..611388) Protein r...    35   0.21 
Kwal_23.4476                                                           33   0.63 
CAGL0M10769g 1074047..1075735 similar to sp|P53730 Saccharomyces...    31   2.9  
AFR395C [3587] [Homologous to ScYOR149C (SMP3) - SH] (1145381..1...    30   4.7  
AFR002C [3194] [Homologous to ScYAL002W (VPS8) - SH] (438503..44...    30   5.8  
Sklu_1894.3 YNL219C, Contig c1894 4461-6116 reverse complement         30   5.8  
CAGL0K08206g 814575..818084 similar to sp|P53120 Saccharomyces c...    30   8.2  

>YGL142C (GPI10) [1845] chr7 complement(236272..238122) Protein
           involved in glycosylphosphatidylinositol (GPI)
           synthesis, transfers the third core mannose to the GPI
           core structure [1851 bp, 616 aa]
          Length = 616

 Score = 1139 bits (2946), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 568/605 (93%), Positives = 568/605 (93%)

Query: 1   MAHEVHRIKPKLGRTQIFWVFLAFRVLNAVLTRTFFQADEFWQALEPAHWKAFKYGELTW 60
           MAHEVHRIKPKLGRTQIFWVFLAFRVLNAVLTRTFFQADEFWQALEPAHWKAFKYGELTW
Sbjct: 1   MAHEVHRIKPKLGRTQIFWVFLAFRVLNAVLTRTFFQADEFWQALEPAHWKAFKYGELTW 60

Query: 61  EWKFGVRSYLFPMIFELTYRLVXXXXXXXXXXXXXXXXXXXXXXXXXXPKYELSWQVAED 120
           EWKFGVRSYLFPMIFELTYRLV                          PKYELSWQVAED
Sbjct: 61  EWKFGVRSYLFPMIFELTYRLVSLSSILLHYALLLLSTIGSDLLILLLPKYELSWQVAED 120

Query: 121 LKRLPFDVTRSFEYYGVIYAPKIVMAVLASIGEYYIVRFVQKLYLLTLDXXXXXXXXXXX 180
           LKRLPFDVTRSFEYYGVIYAPKIVMAVLASIGEYYIVRFVQKLYLLTLD           
Sbjct: 121 LKRLPFDVTRSFEYYGVIYAPKIVMAVLASIGEYYIVRFVQKLYLLTLDKRNEKEEEERR 180

Query: 181 SGLSEITKFALLLSLTNFFNCFFITRTFINSFEMILTSIALYYWDWTGGQMIKESSFTKS 240
           SGLSEITKFALLLSLTNFFNCFFITRTFINSFEMILTSIALYYWDWTGGQMIKESSFTKS
Sbjct: 181 SGLSEITKFALLLSLTNFFNCFFITRTFINSFEMILTSIALYYWDWTGGQMIKESSFTKS 240

Query: 241 LIFAFLACLQRPSSGLIWVIPSISLILNLVGKKQYHLLFITFSKVLRSFFLVFTANAIID 300
           LIFAFLACLQRPSSGLIWVIPSISLILNLVGKKQYHLLFITFSKVLRSFFLVFTANAIID
Sbjct: 241 LIFAFLACLQRPSSGLIWVIPSISLILNLVGKKQYHLLFITFSKVLRSFFLVFTANAIID 300

Query: 301 MYFYEKVTFPFFRFLKFNFTTPLSKFYGVAPWHFHFFQSLPIVLGASIPAFAFGLFFPLS 360
           MYFYEKVTFPFFRFLKFNFTTPLSKFYGVAPWHFHFFQSLPIVLGASIPAFAFGLFFPLS
Sbjct: 301 MYFYEKVTFPFFRFLKFNFTTPLSKFYGVAPWHFHFFQSLPIVLGASIPAFAFGLFFPLS 360

Query: 361 KRSFPKKYLNPFFQVKLTILLNLLVYSTLPHKEFRFIFPLQPLFILISSFGLLRLDRDYW 420
           KRSFPKKYLNPFFQVKLTILLNLLVYSTLPHKEFRFIFPLQPLFILISSFGLLRLDRDYW
Sbjct: 361 KRSFPKKYLNPFFQVKLTILLNLLVYSTLPHKEFRFIFPLQPLFILISSFGLLRLDRDYW 420

Query: 421 KRLSGLKSLLWLVPFVSVFIALLLDTFHESGSIEVMKFLHEEPEIDSLGFIMPCHSTPGQ 480
           KRLSGLKSLLWLVPFVSVFIALLLDTFHESGSIEVMKFLHEEPEIDSLGFIMPCHSTPGQ
Sbjct: 421 KRLSGLKSLLWLVPFVSVFIALLLDTFHESGSIEVMKFLHEEPEIDSLGFIMPCHSTPGQ 480

Query: 481 SYLHRSDIQDLWSITCNPPLHLLGDPEAYSKLETYMDESDHLYDDISAFIYKNFPPPFRK 540
           SYLHRSDIQDLWSITCNPPLHLLGDPEAYSKLETYMDESDHLYDDISAFIYKNFPPPFRK
Sbjct: 481 SYLHRSDIQDLWSITCNPPLHLLGDPEAYSKLETYMDESDHLYDDISAFIYKNFPPPFRK 540

Query: 541 DLRSPGKTYSHEWPTYLVVFEHMENAFLKDFLKDSSYIEYNRFFNSLAHWDSRRSGDIII 600
           DLRSPGKTYSHEWPTYLVVFEHMENAFLKDFLKDSSYIEYNRFFNSLAHWDSRRSGDIII
Sbjct: 541 DLRSPGKTYSHEWPTYLVVFEHMENAFLKDFLKDSSYIEYNRFFNSLAHWDSRRSGDIII 600

Query: 601 YYKLP 605
           YYKLP
Sbjct: 601 YYKLP 605

>Scas_669.11
          Length = 596

 Score =  646 bits (1666), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 323/598 (54%), Positives = 413/598 (69%), Gaps = 9/598 (1%)

Query: 11  KLGRTQIFWVFLAFRVLNAVLTRTFFQADEFWQALEPAHWKAFKYGELTWEWKFGVRSYL 70
           KL    +F   L FR+ NA+LTRTFFQADEFWQALEPAH  AF YGELTW+WKF +RSY 
Sbjct: 3   KLDNGSLFRAILVFRIANALLTRTFFQADEFWQALEPAHLMAFGYGELTWDWKFAIRSYA 62

Query: 71  FPMIFELTYRLVXXXXXXXXXXXXXXXXXXXXXXXXXXPKYELSWQVAEDLKRLPFDVTR 130
           FP IFELTYRLV                          P  E    V +DL  LP D+  
Sbjct: 63  FPFIFELTYRLVRLVVFMSRWLMELLSELASELLLLLFPSNEFVRLVVDDLVVLPSDMAN 122

Query: 131 SFEYYGVIYAPKIVMAVLASIGEYYIVRFVQKLYLLTLDXXXXXXXXXXXSG-LSEITKF 189
           S EY GVIY PK+VM ++A+ GEYY ++ +QKLYL+T              G L  ITK 
Sbjct: 123 SLEYIGVIYGPKVVMTLIAATGEYYTIKLIQKLYLITSKSSKENDDEGGKGGSLQGITKI 182

Query: 190 ALLLSLTNFFNCFFITRTFINSFEMILTSIALYYWDWTGGQMIKESSFTKSLIFAFLACL 249
           A +LSLTNFFNC+ ITR+FINSFEM  T++ALY+WDWTGG  I+ S FTKSL+ A   CL
Sbjct: 183 ATVLSLTNFFNCYLITRSFINSFEMTTTAVALYFWDWTGGLTIESSEFTKSLVIAMFTCL 242

Query: 250 QRPSSGLIWVIPSISLILNLVGK-KQYHLLFITFSKVLRSFFLVFTANAIIDMYFYEKVT 308
           QRP++  IW++    LI N++ +   +   FI   K++  F  VF  N  ID YFY ++T
Sbjct: 243 QRPTNAFIWIVLGSLLITNMIKRGTDFKAYFILLRKIVLCFMAVFLLNVSIDFYFYGEIT 302

Query: 309 FPFFRFLKFNFTTPLSKFYGVAPWHFHFFQSLPIVLGASIPAFAFGLFFPLSKRSFPKKY 368
            P   F+KFN T+PL+ FYG +PWHFH FQS+PI+LG ++  F  G+F  LS + F    
Sbjct: 303 IPLINFIKFNVTSPLANFYGSSPWHFHLFQSVPIILGYNLLFFVPGMFCHLSHKKFTSFA 362

Query: 369 LNPFFQVKLTILLNLLVYSTLPHKEFRFIFPLQPLFILISSFGLLRLDRDYWKRLSGLKS 428
            NPFFQ+K+ ILLN+LV+S   HKEFRFI+PLQP F+ +S F L +L    + R++    
Sbjct: 363 TNPFFQIKMIILLNVLVFSLTTHKEFRFIYPLQPFFMTVSVFALHKLKWYQYSRMT---- 418

Query: 429 LLWLVPFVSVFIALLLDTFHESGSIEVMKFLHEEP-EIDSLGFIMPCHSTPGQSYLHRSD 487
             W++P  SV ++LL+ +F ESGSIEVMKFLH EP ++ S+GFIMPCHSTP QSYLHR D
Sbjct: 419 --WILPLASVVLSLLVSSFQESGSIEVMKFLHNEPFDLKSVGFIMPCHSTPWQSYLHRQD 476

Query: 488 IQDLWSITCNPPLHLLGDPEAYSKLETYMDESDHLYDDISAFIYKNFPPPFRKDLRSPGK 547
           I DLW+ITC PPLHLLGD +A SKL++YMDESDHLY + + F+Y+NFPP F+K+LRSPGK
Sbjct: 477 IPDLWAITCEPPLHLLGDADATSKLQSYMDESDHLYANPARFLYENFPPVFKKELRSPGK 536

Query: 548 TYSHEWPTYLVVFEHMENAFLKDFLKDSSYIEYNRFFNSLAHWDSRRSGDIIIYYKLP 605
            Y+HEWP YL++FE +++  ++++LKDSSY+EY RFFNS +HWDSRR+GDI++YYK P
Sbjct: 537 VYTHEWPEYLIIFEQLDDLIMREYLKDSSYVEYTRFFNSWSHWDSRRAGDIVVYYKRP 594

>KLLA0E14762g 1319163..1320968 similar to sp|P30777 Saccharomyces
           cerevisiae YGL142c GPI10 required for Glycosyl
           Phosphatdyl Inositol synthesis singleton, hypothetical
           start
          Length = 601

 Score =  637 bits (1644), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 306/595 (51%), Positives = 410/595 (68%), Gaps = 7/595 (1%)

Query: 16  QIFWVFLAFRVLNAVLTRTFFQADEFWQALEPAHWKAFKYGELTWEWKFGVRSYLFPMIF 75
           ++F V L  R + A+LTRTFFQADEFWQ+LEPAH+ AF YGELTWEW FG+RSY FP+IF
Sbjct: 9   RLFKVILVIRCVQALLTRTFFQADEFWQSLEPAHYMAFGYGELTWEWSFGLRSYAFPLIF 68

Query: 76  ELTYRLVXXXXXXXXXXXXXXXXXXXXXXXXXXPKYELSWQVAEDLKRLPFDVTRSFEYY 135
           ++ Y LV                          P  E  W++ ++++  P ++    EY 
Sbjct: 69  QIGYTLVKYAAISCELIVQTATDWVLLFVANVIPNSEFGWEMVQEMRSFPEEIRGFIEYQ 128

Query: 136 GVIYAPKIVMAVLASIGEYYIVRFVQKLYLLTLDXXXXXXXXXXXSGLSEITKFALLLSL 195
           GVIYAPK++MAVLA+IGE++++   +KLY LT+D              S +  F L+ ++
Sbjct: 129 GVIYAPKLIMAVLAAIGEFHVILLAEKLYKLTMDKSDDSKGSDKKH--STVINFTLVATV 186

Query: 196 TNFFNCFFITRTFINSFEMILTSIALYYWDWTGGQMIKESSFTKSLIFAFLACLQRPSSG 255
           +NFFNCFFITR+FINSFEMILTS++LYYWDWT G+ I+   F KSLI      LQRP++ 
Sbjct: 187 SNFFNCFFITRSFINSFEMILTSVSLYYWDWTSGEHIESFDFLKSLIIGTFTVLQRPTNA 246

Query: 256 LIWVIPSISLILNLVGKKQYHLLFITFSKVLRSFFLVFTANAIIDMYFYEKVTFPFFRFL 315
            IW+I    +ILNLV  K++  LF    KV+ + F+  + N  ID YFY  +T P  +F+
Sbjct: 247 FIWLILGGYMILNLVLSKRWRKLFSLLIKVICASFISISTNLCIDYYFYGYITIPVLKFI 306

Query: 316 KFNFTTPLSKFYGVAPWHFHFFQSLPIVLGASIPAFAFGLFFPLSKRSFPKKYLNPFFQV 375
           KFN T+ LSKFYGVAPW+FH FQSLPIV G S+P      F  L+K+ F    +NPF Q+
Sbjct: 307 KFNCTSSLSKFYGVAPWNFHVFQSLPIVAGYSLPLLIHSFFCSLTKKRFLSPLVNPFLQI 366

Query: 376 KLTILLNLLVYSTLPHKEFRFIFPLQPLFILISSFGLLRLDRDYW-----KRLSGLKSLL 430
           K  +LLN+++YS +PHKEFRFI+PLQP FI++S F  + L + Y      + +     ++
Sbjct: 367 KTVVLLNVILYSLIPHKEFRFIYPLQPFFIILSVFDGIWLLQKYGSTATTRTMEFFSQVM 426

Query: 431 WLVPFVSVFIALLLDTFHESGSIEVMKFLHEEPEIDSLGFIMPCHSTPGQSYLHRSDIQD 490
           W++P VS+  ++LL T HESG++ VM +LH    IDS+GFIMPCHSTP QS+ HR+D+++
Sbjct: 427 WILPVVSMVASMLLSTLHESGTVAVMDYLHSIRNIDSIGFIMPCHSTPWQSHFHRNDVKE 486

Query: 491 LWSITCNPPLHLLGDPEAYSKLETYMDESDHLYDDISAFIYKNFPPPFRKDLRSPGKTYS 550
           LW+ITC+PPLHLL DP+A +KL  YMDESD+LYD+IS F+Y++FPP FRK LRSPGK Y+
Sbjct: 487 LWAITCSPPLHLLTDPDANAKLPFYMDESDYLYDNISKFMYQHFPPVFRKSLRSPGKQYT 546

Query: 551 HEWPTYLVVFEHMENAFLKDFLKDSSYIEYNRFFNSLAHWDSRRSGDIIIYYKLP 605
           +EWP YLV+FE +++ F+ D+L DS YIE  RFFNSL HWD RRSGDIIIY+K+P
Sbjct: 547 YEWPEYLVIFEDLDSQFMNDYLVDSMYIEETRFFNSLVHWDKRRSGDIIIYHKMP 601

>CAGL0F07843g 766285..768123 similar to sp|P30777 Saccharomyces
           cerevisiae YGL142c GPI10 required for Glycosyl
           Phosphatdyl Inositol synthesis, hypothetical start
          Length = 612

 Score =  637 bits (1643), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 312/597 (52%), Positives = 414/597 (69%), Gaps = 17/597 (2%)

Query: 15  TQIFWVFLAFRVLNAVLTRTFFQADEFWQALEPAHWKAFKYGELTWEWKFGVRSYLFPMI 74
           + IF V + FRV+N++LTRT+FQADEFWQ+LEPAH+KAF YGELTWEWK G+RSY FPM+
Sbjct: 23  SAIFPVLVGFRVINSLLTRTYFQADEFWQSLEPAHYKAFGYGELTWEWKVGLRSYAFPML 82

Query: 75  FELTYRLVXXXXXXXXXXXXXXXXXXXXXXXXXXPKYELSWQVAEDLKRLPFDVTRSFEY 134
           FE+ YRLV                          P+ +L+ +VA DL  +P + + + EY
Sbjct: 83  FEIIYRLVKLLAIASKEALSIICSIGAGLMLLCFPQSKLATEVARDLLTIPNEYSETVEY 142

Query: 135 YGVIYAPKIVMAVLASIGEYYIVRFVQKLYLLTLDXXXXXXXXXXXSGLSEITKFALLLS 194
           YGVIYAPK+ MA+LA+ GEY+ ++ +QK+YL T+              LS ITK ALLL+
Sbjct: 143 YGVIYAPKLFMALLAATGEYFTIKLIQKVYLKTVSKNDDQL-----PKLSNITKIALLLT 197

Query: 195 LTNFFNCFFITRTFINSFEMILTSIALYYWDWTGGQMIKESSFTKSLIFAFLACLQRPSS 254
           LTNFFNCFFITRTFINSFEMILTSIALY WDW+GG  I   SFTKSL FA  AC+QRPS+
Sbjct: 198 LTNFFNCFFITRTFINSFEMILTSIALYNWDWSGGIEINTRSFTKSLFFAMFACIQRPSN 257

Query: 255 GLIWVIPSISLILNLVGKKQYHLLFITFSKVLRSFFLVFTANAIIDMYFYEKVTFPFFRF 314
            +IW++    L +NL+ ++ Y L+   ++K+L  F +    N +ID YFY ++ FP F+F
Sbjct: 258 AIIWIVLGFFLTINLLLRRDYTLIGRLYAKILVVFTITMLVNVVIDFYFYNQIIFPVFKF 317

Query: 315 LKFNFTTPLSKFYGVAPWHFHFFQSLPIVLGASIPAFAFGLFFPLSKRSFPKKYL--NPF 372
           + FNFT+ LS+FYGVAPWHFH  QSLPI+LG S+P F +GLF   S  S  K  +     
Sbjct: 318 INFNFTSILSEFYGVAPWHFHLLQSLPIMLGYSLPLFIYGLF---SNDSTTKNNIRFGAL 374

Query: 373 FQVKLTILLNLLVYSTLPHKEFRFIFPLQPLFILISSFGLLRLDRDYWKRLSGLKSLLWL 432
            Q+K  ++LN++ YS L HKEFRFI+PLQPLF L+S+ G L+L     +    LK  +W+
Sbjct: 375 RQIKFVLILNIIFYSYLKHKEFRFIYPLQPLFCLLSALGALKLAGKV-QNYRYLKEYVWI 433

Query: 433 VPFVSVFIALLLDTFHESGSIEVMKFLHEEPEIDSLGFIMPCHSTPGQSYLHRSDIQDLW 492
           +P +S+ +++ + TF ESG I+VMK LH E +IDS+GF+MPCHSTP QSYLHR+DI+ LW
Sbjct: 434 IPLMSMIVSIFITTFQESGVIQVMKDLHNEKDIDSVGFVMPCHSTPWQSYLHRNDIRQLW 493

Query: 493 SITCNPPLHLLGDPEAYSKLETYMDESDHLYDDISAFIYKNFPP-PFRKDLRSPGKTYS- 550
           +I+C PPLHLLG   A  +L+TYMDESD+LY++IS FI KNFP      D+ +     S 
Sbjct: 494 AISCEPPLHLLGKNNASIELQTYMDESDYLYENISGFIKKNFPKFTNSMDMENVNNNASM 553

Query: 551 ----HEWPTYLVVFEHMENAFLKDFLKDSSYIEYNRFFNSLAHWDSRRSGDIIIYYK 603
               HEWP +L++FE ++N F+  +L DS Y++YN+ FNS +HWDSRR+GD+IIYYK
Sbjct: 554 PQFPHEWPQFLIIFEQLDNEFMSRYLLDSGYVKYNKIFNSYSHWDSRRNGDLIIYYK 610

>Kwal_23.3478
          Length = 618

 Score =  578 bits (1490), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 287/586 (48%), Positives = 380/586 (64%), Gaps = 8/586 (1%)

Query: 20  VFLAFRVLNAVLTRTFFQADEFWQALEPAHWKAFKYGELTWEWKFGVRSYLFPMIFELTY 79
           V + FRVL+++   ++FQ DEFWQ LEPAH +AF YG+LTWEW +G+RSY FP IFE+ Y
Sbjct: 35  VLIIFRVLSSLFVVSYFQPDEFWQTLEPAHHQAFGYGKLTWEWDYGLRSYAFPFIFEILY 94

Query: 80  RLVXXXXXXXXXXXXXXXXXXXXXXXXXXPKYELSWQVAEDLKRLPFDVTRSFEYYGVIY 139
           RLV                          P  EL+W +  +++  P ++    EYYGVI 
Sbjct: 95  RLVSVVSTIAEQIVAITVDCFVFTVSRIIPGSELAWSMVNEMQHFPQEIKSFLEYYGVII 154

Query: 140 APKIVMAVLASIGEYYIVRFVQKLYLLTLDXXXXXXXXXXXSGLSEITKFALLLSLTNFF 199
           APK++MA++ ++GE Y   F++KLY  T +             L ++   A LLS TNFF
Sbjct: 155 APKVMMALIGAVGEMYAFAFIEKLY--TREFSGDEKNKMQSGKLVKMA--ACLLSTTNFF 210

Query: 200 NCFFITRTFINSFEMILTSIALYYWDWTGGQMIKESSFTKSLIFAFLACLQRPSSGLIWV 259
           N F ITRTF N+ EM LT  ALY+WDWTGG  +   +FT SL      CLQRP++ LIWV
Sbjct: 211 NNFMITRTFANTLEMDLTCAALYFWDWTGGACVSGRNFTISLYCGIFLCLQRPTNALIWV 270

Query: 260 IPSISLILNLVGKKQYHLLFITFSKVLRSFFLVFTANAIIDMYFYEKVTFPFFRFLKFNF 319
              + L+LNL  +K +  L +   K+L  F  V   N  ID YFY ++ FP FRF+KFN+
Sbjct: 271 PLGLFLVLNLTARKDFKNLTVLVRKLLLVFLQVLAVNLAIDFYFYRELIFPVFRFIKFNY 330

Query: 320 TTPLSKFYGVAPWHFHFFQSLPIVLGASIPAFAFGLFFPLSKRSFPKKYLNP-FFQVKLT 378
           T+ LS FYG APWHFH  QSLP++LG S P F +G F   SK    ++ LN    Q ++ 
Sbjct: 331 TSALSSFYGTAPWHFHLLQSLPLILGWSTPLFLYGFF--CSKTEKGREGLNSSMLQARIV 388

Query: 379 ILLNLLVYSTLPHKEFRFIFPLQPLFILISSFGLLRLDRDYWKRLSG-LKSLLWLVPFVS 437
           +++N++ +S + HKEFRF++ L P F+L SS  L        K  +G LK L+W  PF S
Sbjct: 389 VIINIIAFSLISHKEFRFLYILHPFFLLFSSIALGPKIPTLEKMSNGPLKYLVWAPPFFS 448

Query: 438 VFIALLLDTFHESGSIEVMKFLHEEPEIDSLGFIMPCHSTPGQSYLHRSDIQDLWSITCN 497
           +  +LL+ ++HE+G  EV K+LH  P I S+GFIMPCHSTP QSY+HR+DIQD+WSITC 
Sbjct: 449 IIASLLVSSYHETGVTEVTKYLHHIPRIHSVGFIMPCHSTPWQSYIHRNDIQDIWSITCE 508

Query: 498 PPLHLLGDPEAYSKLETYMDESDHLYDDISAFIYKNFPPPFRKDLRSPGKTYSHEWPTYL 557
           PPL LL DP+A   L +YMDESD LYD++  FIY+N PP FRK+LRSP K YSHEWP YL
Sbjct: 509 PPLFLLEDPDAEKLLASYMDESDLLYDNVPKFIYQNMPPVFRKELRSPSKEYSHEWPEYL 568

Query: 558 VVFEHMENAFLKDFLKDSSYIEYNRFFNSLAHWDSRRSGDIIIYYK 603
           ++F+ +++ F+KDFLKDS+Y E  RFFN+ +HWDSRRSGDII+Y K
Sbjct: 569 IIFQQLDDTFMKDFLKDSAYSEEARFFNTWSHWDSRRSGDIIVYRK 614

>ADL281C [1460] [Homologous to ScYGL142C (GPI10) - SH]
           (207452..209239) [1788 bp, 595 aa]
          Length = 595

 Score =  574 bits (1479), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 283/597 (47%), Positives = 392/597 (65%), Gaps = 16/597 (2%)

Query: 14  RTQIFWVFLAFRVLNAVLTRTFFQADEFWQALEPAHWKAFKYGELTWEWKFGVRSYLFPM 73
           RT   W     R++NA+  R+FFQADE+WQ+LEPAH KAF YG LTWEW+ G+RSY FPM
Sbjct: 8   RTLFLW-----RLINALSIRSFFQADEYWQSLEPAHVKAFGYGGLTWEWQHGLRSYAFPM 62

Query: 74  IFELTYRLVXXXXXXXXXXXXXXXXXXXXXXXXXXPKYELSWQVAEDLKRLPFDVTRSFE 133
           +FE++Y  V                          P         + +  LP       E
Sbjct: 63  LFEMSY-YVAWILGVATRMALQGLAHATALCGAVVPSGAAGVAAMKAVWELPEAAQELVE 121

Query: 134 YYGVIYAPKIVMAVLASIGEYYIVRFVQKLYLLTLDXXXXXXXXXXXSGLSEITKFALLL 193
           YYGV+Y P++VMA +A+ GE+Y V  V+KLYL   D              + +++ AL+L
Sbjct: 122 YYGVLYGPRVVMAAVAACGEFYSVLLVRKLYLRVADKGDDQK-----GDAAPVSRLALML 176

Query: 194 SLTNFFNCFFITRTFINSFEMILTSIALYYWDWTGGQMIKESSFTKSLIFAFLACLQRPS 253
           ++TNFFNCFF TRTFINSFEM LT++ALY+WDW+GG  +    F+ SL  A  ACLQRP+
Sbjct: 177 TMTNFFNCFFATRTFINSFEMTLTAVALYHWDWSGGLDVGSLGFSASLAVAAFACLQRPT 236

Query: 254 SGLIWVIPSISLILNLVGKKQYHLLFITFSKVLRSFFLVFTANAIIDMYFYEKVTFPFFR 313
           + LIW +  + L+LNLV  +++ LL    +KV  +  L   AN  ID YFY  V  P  R
Sbjct: 237 NVLIWAVLGLFLVLNLVRSRRWQLLLTLVAKVAAAGALAVCANIAIDYYFYGGVLLPLLR 296

Query: 314 FLKFNFTTPLSKFYGVAPWHFHFFQSLPIVLGASIPAFAFGLFFPLSKRSFPKKYLNPFF 373
           F++FN TTPL+ FYG APWHFH  QS+P+++G ++P F   L     +R       +P  
Sbjct: 297 FIEFNVTTPLAAFYGRAPWHFHLLQSVPLIVGYALPFFVGALLTHNFRRGNAGLLGSPIM 356

Query: 374 QVKLTILLNLLVYSTLPHKEFRFIFPLQPLFILISSFGLLRLDRDYWKR----LSGLKSL 429
           Q+K  ++LN+ +YS + HKEFRF++PLQPLF+ +S+  +    + +  R    L  ++SL
Sbjct: 357 QIKCVVVLNIALYSCIDHKEFRFLYPLQPLFLSLSALEMHTWLQHHHARGTAWLKRVQSL 416

Query: 430 LWLVPFVSVFIALLLDTFHESGSIEVMKFLHEE-PEIDSLGFIMPCHSTPGQSYLHRSDI 488
           L+++P +S+  AL+L+T HE+G + VM +LH   P  +S+GFIMPCHSTP QS+LHR+D+
Sbjct: 417 LYVLPVLSITAALVLNTAHEAGVVSVMDYLHSAVPSAESIGFIMPCHSTPWQSHLHRNDL 476

Query: 489 QDLWSITCNPPLHLLGDPEAYSKLETYMDESDHLYDDISAFIYKNFPPPFRKDLRSPGKT 548
             LW+I+C PPL LL   +A  +L TYMDESDHLY++I  FI+KNFPP FR+DLRSPG+ 
Sbjct: 477 GKLWAISCQPPLDLLHQEDAGDQLLTYMDESDHLYENIPEFIHKNFPPVFRRDLRSPGRQ 536

Query: 549 YSHEWPTYLVVFEHMENAFLKDFLKDSSYIEYNRFFNSLAHWDSRRSGDIIIYYKLP 605
           Y++EWP +LVVFEHM+ AF+K++LKDS+Y+E  RFFN+L+HWDSRR+GD+I+Y+K P
Sbjct: 537 YAYEWPEFLVVFEHMDEAFMKEYLKDSNYVEVKRFFNTLSHWDSRRAGDVIVYHKSP 593

>Scas_714.36
          Length = 514

 Score = 51.6 bits (122), Expect = 1e-06,   Method: Compositional matrix adjust.
 Identities = 87/354 (24%), Positives = 154/354 (43%), Gaps = 47/354 (13%)

Query: 125 PFDVTRSFEYYGVIYAP-----KIVMAVLASIGEYYIVRFVQKL--YLLTLDXXXXXXXX 177
           P D  RS+    + Y P     + V+ V   +   Y  R VQ L  Y++T          
Sbjct: 54  PTDAARSYVPLYLTYGPLFSLLRYVLHVNNPMWILYCAR-VQNLILYIITFKWSLPYLVP 112

Query: 178 XXXSGLSEITKFALLLSLTNFFNCFFITRTFINSFEMILTSIALYYWDWTGGQMIKESSF 237
              S L +I+  A LL +T++    + T TF NS E  L  I L        +M ++ ++
Sbjct: 113 NCESSL-DISSKAELLMMTSYVTWSYQTHTFSNSIETNLLLIVLSLLQILLSKMSEKKNY 171

Query: 238 TKSLIFAFLACL------QRPSSGLIWVIPSISLILNLVGKKQYHLLFITFSKVLRSFFL 291
           ++  +   L  L       R +     ++P + L       K +   F+  S    S  L
Sbjct: 172 SQVRVSLLLGGLISLGIFNRMTFPAFIMLPFLKLFFRFYRHKSHWSSFLVLS---LSILL 228

Query: 292 VFTANAIIDMYFYEK---VTFPFFRFLKFNFTTPLSKFYGVAPWHFHFFQSLPIVLGASI 348
             +   ++D   YE    V  P+   LK+NF     + +G+ PW+ H   +LP +LG  I
Sbjct: 229 TTSLCILLDTAIYESNEWVITPWNN-LKYNFDISNLESHGLHPWYTHILVNLPQLLGPMI 287

Query: 349 PAFAFGLFFPL----SKRSFPKKYLNPFFQVKLTILLNLLVYSTLPHKEFRFIFPLQPLF 404
                 +F PL    +  + P           L+I+ +++  S   H+EFRF+ PL PL 
Sbjct: 288 ------IFLPLILLKTSTTIP----------TLSIMSSMVTLSYFKHQEFRFLTPLVPLL 331

Query: 405 IL-ISSFGLLRLDRDYWKRLSGLKSLLWLVPFVSVFIALLLDTFHESGSIEVMK 457
           ++ +++     + +  +KR   +  LLW++   ++  A+++  FH+SG I+ + 
Sbjct: 332 LIQLAACIPNSIQQSSFKR--SVIRLLWVL--FNIIFAVIVGVFHQSGVIQSLS 381

>KLLA0D19404g 1632929..1634590 similar to sp|P53868 Saccharomyces
           cerevisiae YNL219c ALG9 mannosyltransferase singleton,
           start by similarity
          Length = 553

 Score = 50.4 bits (119), Expect = 3e-06,   Method: Compositional matrix adjust.
 Identities = 62/241 (25%), Positives = 106/241 (43%), Gaps = 27/241 (11%)

Query: 233 KESSFTKSLIFAFLACLQRPSSGLIWVIPSISLILNLVGKKQYHLLFITFSKVLRS---F 289
            E  F KS+ F FL  +      L W    I ++ N++     H    T    + S   F
Sbjct: 169 NELPFVKSISFVFLGGI------LGWPFSLILVVTNVIHYTATHRFMDTLRAGVSSSFVF 222

Query: 290 FLVFTANAIIDMYFYEKVTFPFFRFLKFNFTTPLS----KFYGVAPWHFHFFQSLPIVLG 345
            ++ +  A ID +FY K++   F  + +N  +         +GV PW++ + Q+L  +L 
Sbjct: 223 AIISSIVAAIDSFFYGKLSVVPFNIVMYNIISANEDSGPNIFGVEPWYY-YIQNL--LLN 279

Query: 346 ASIPAFAFGLFFPLSKRSFPKKYLNPFFQVKLTILLNLLVYSTLPHKEFRFIFPLQPLFI 405
             I    FG+        F +  + P     L I LN  V+   PHKE RF++P+  +  
Sbjct: 280 FPITTLFFGVI------GFTQLSIWPL-SGSLFIWLN--VFLAQPHKEERFLYPIYGIIS 330

Query: 406 LISSFGLLRLDRDY-WKRLSGL-KSLLWLVPFVSVFIALLLDTFHESGSIEVMKFLHEEP 463
           L+++ GL  +     WK+L  L + +++ V  +     +L  T + +  I+V   L E  
Sbjct: 331 LLAAVGLFNITVSIRWKKLRKLVRGIVFFVTLLQAASRILALTNNYTSPIQVYSHLPEST 390

Query: 464 E 464
           E
Sbjct: 391 E 391

>CAGL0K09548g complement(940088..941578) similar to sp|Q04174
           Saccharomyces cerevisiae YOR149c SMP3 protein kinase C
           pathway protein, hypothetical start
          Length = 496

 Score = 49.7 bits (117), Expect = 5e-06,   Method: Compositional matrix adjust.
 Identities = 57/243 (23%), Positives = 109/243 (44%), Gaps = 48/243 (19%)

Query: 227 TGGQMIKESSFTKSLIFAFLACLQRPSSGLIWVIPSISLILNLVGKKQYHLLFITFSKVL 286
           + G +I   +FT+    AFL            ++PSI + L ++ +K   ++ I  S  L
Sbjct: 172 STGFLISVGTFTRISFPAFL------------LLPSIQVFLKVLYRKWIQMVVIAVSMTL 219

Query: 287 RSFFLVFTANAIIDMYFYE--KVTFPFFRFLKFNFTTPLSKFYGVAPWHFHFFQSLPIVL 344
            +  +V+      D + YE  ++     + + +N        +G+ P + H   ++P++L
Sbjct: 220 STSIIVY-----FDTFMYESDEIIIAPLKNVVYNLNVDNLAKHGLHPRYTHLLVNIPLIL 274

Query: 345 GASIPAFAFGLFFPLSKRSFPKKYLN-PFFQVKLTILLNLLVYSTLPHKEFRFIFPLQPL 403
           G  +          L  R+    +LN P     L+I+ +L   S L H+E RF+ P+ PL
Sbjct: 275 GPGL----------LMIRNTKNDFLNLPL----LSIISSLFFLSALRHQELRFLLPVVPL 320

Query: 404 F-ILISSFGLLRLDRDYWKRLSGLKSLLWLVPFVSVFIALLLDTFHESGSIEVMKFLHEE 462
           F  L++ F      R Y  R       +WLV   +  + +++  FH+ G I ++  ++ E
Sbjct: 321 FSTLLTRFRY----RPYLFR-------IWLV--FNAAMCIIMGIFHQGGVIPMISNINAE 367

Query: 463 PEI 465
            ++
Sbjct: 368 QDL 370

>Kwal_23.6317
          Length = 545

 Score = 44.3 bits (103), Expect = 2e-04,   Method: Compositional matrix adjust.
 Identities = 49/177 (27%), Positives = 85/177 (48%), Gaps = 11/177 (6%)

Query: 259 VIPSISLILNLVGKKQYHLLFITFSKVLRSFFLVFTANAIIDMYFYEKVTFPFFRFLKFN 318
           V  +  + L+L+  K+Y L  I  +  L +  +  TA+  +D YF+   TFP      FN
Sbjct: 209 VALTAGVALSLMHYKKYGLRKIVKTSALGAM-VGATASIFVDSYFWRTWTFPEMDAFLFN 267

Query: 319 FTTPLSKFYGVAPWHFHFFQSLPIVLGASIPAFAFGLFFPLSKRSFPKKYLNPFFQVKLT 378
                S  +G  P++ +    LP++    IP     L F +  R+ P++ L    +  + 
Sbjct: 268 VIDGKSAKWGTLPFYSYLTTMLPMLF---IPPTVLVLDF-MGFRAAPQE-LKVLTEASI- 321

Query: 379 ILLNLLVYSTLPHKEFRFIFPLQPLFILISSFGLLRLDRDYWKRLSGLKSLLWLVPF 435
              ++LV S  PHKE+RFI    P   L++S+G  R+ +   +R+ G+  L  ++ F
Sbjct: 322 --FHILVLSFQPHKEWRFIVYSIPALTLLASYGASRIFK--MQRVKGVNILKLIIIF 374

>AAR043C [229] [Homologous to ScYNR030W (ECM39) - SH]
           (418301..419914) [1614 bp, 537 aa]
          Length = 537

 Score = 41.6 bits (96), Expect = 0.002,   Method: Compositional matrix adjust.
 Identities = 47/184 (25%), Positives = 76/184 (41%), Gaps = 21/184 (11%)

Query: 269 LVGKKQYHLLFITFSKVLRSFFLVFTANAIIDMYFYEKVTFPFFRFLKFNFTTPLSKFYG 328
           LV +K   +  I F  +     L  +A   ID YF+ +   P      FN     S  +G
Sbjct: 212 LVARKVSVMEIIRFGIIGSGVGLGLSAT--IDSYFWGRSCVPEMDAFVFNVIGGQSAKWG 269

Query: 329 VAPWHFHFFQSLPIVLGASIPAFAFGLFFPLSKRSFPKKYL----NPFFQVKLTILLNLL 384
             P   +F + LP             LFFP     F    +     PF  V    L++++
Sbjct: 270 TEPLLAYFTRYLP------------RLFFPPMVTVFCIAGVRIASTPFRIVFAASLIHIM 317

Query: 385 VYSTLPHKEFRFIFPLQPLFILISSFGLLRL-DRDYWKRLSG--LKSLLWLVPFVSVFIA 441
           + S  PHKE+RFI    P   L+ S G   L     W++ +G  ++ L+ + P + +  +
Sbjct: 318 LLSLQPHKEWRFIIYSVPAITLLGSMGAAYLFSLANWRQANGFSMRILILISPLLMLMHS 377

Query: 442 LLLD 445
           +L+ 
Sbjct: 378 VLMS 381

>Sklu_1475.2 YOR149C, Contig c1475 982-2508 reverse complement
          Length = 508

 Score = 40.0 bits (92), Expect = 0.005,   Method: Compositional matrix adjust.
 Identities = 67/290 (23%), Positives = 119/290 (41%), Gaps = 35/290 (12%)

Query: 205 TRTFINSFE--MILTSIALYYWDWTGGQMIKESSFTKSLIFAFLACL---QRPSSGLIWV 259
           T TF NS E  ++L +++L+       +  K   +  S++  F  CL    R +     +
Sbjct: 134 THTFSNSLETVILLITLSLFKTLIQDSRDSKYQHYRTSVLIGFFICLGIFNRITFPAFIL 193

Query: 260 IPSISLILNLVGKKQYHLLFITFSKVLRSFFLVFTANAIIDMYFYEKVTFPFFRFLKFNF 319
           +P I  +           +   FS  L S+  V     + D   Y   T+       F++
Sbjct: 194 LPCIPTMHKFYWHHWRSSMVCLFSFGLTSYLFV-----VADTRLYNSNTWCVAPLNNFSY 248

Query: 320 TTPLSKF--YGVAPWHFHFFQSLPIVLGASIPAFAFGLFFPLSKRSFPKKYLNPFFQVKL 377
               S    +G+ P + H   ++P +LG   PA  F  FF  S+R    K   P     L
Sbjct: 249 NMDESNLATHGLHPRYTHILFNVPQILG---PALIF--FF--SRR---YKLALPL----L 294

Query: 378 TILLNLLVYSTLPHKEFRFIFPLQPLFILISSFGLLRLDRDY-WKRLSGLKSLLWLVPFV 436
           + +  L++ S   H+E RF+ PL PLF +  S  L   D+   W+ +      LWL+   
Sbjct: 295 SCISGLVILSLFKHQELRFLVPLLPLFCI--SMNLSNFDKVIKWEHVIK----LWLL--F 346

Query: 437 SVFIALLLDTFHESGSIEVMKFLHEEPEIDSLGFIMPCHSTPGQSYLHRS 486
           ++   +++   H+ G I  +  L    +   +      +S P   Y++++
Sbjct: 347 NICSGIIMGGLHQRGVILAIDHLRTSSDTAGVHVWWKTYSPPTWMYMNKN 396

>KLLA0C06567g complement(573595..575187) similar to sp|Q04174
           Saccharomyces cerevisiae YOR149c SMP3 protein kinase C
           pathway protein singleton, start by similarity
          Length = 530

 Score = 38.9 bits (89), Expect = 0.011,   Method: Compositional matrix adjust.
 Identities = 35/136 (25%), Positives = 67/136 (49%), Gaps = 21/136 (15%)

Query: 327 YGVAPWHFHFFQSLPIVLGASIPAFAFGLFFPLSKRSFPKKYLNPFFQVKLTILLNLLVY 386
           +G+ P + H   +LP++ G  I  F       +S+++  K          L+ +  +L+ 
Sbjct: 285 HGLHPRYTHLLINLPLICGPIILLF-------ISQKAVLK-------LPALSCISGILML 330

Query: 387 STLPHKEFRFIFPLQPLFILISSFGLLRLDRDYWKRLSGLKSLLWLVPFVSVFIALLLDT 446
           S   H+E RFI P+ PL  L +S  L   D  +++  + + S  WLV   ++ + L++  
Sbjct: 331 SLFRHQELRFIIPVLPL--LCASMNLDNFDT-FFQAETIITS--WLV--FNIVMGLIMGV 383

Query: 447 FHESGSIEVMKFLHEE 462
           FH++G I ++ +   E
Sbjct: 384 FHQAGIIPLISYFSGE 399

>KLLA0C08591g complement(752256..753881) similar to sp|P53730
           Saccharomyces cerevisiae YNR030w ECM39 involved in cell
           wall biogenesis and architecture singleton, start by
           similarity
          Length = 541

 Score = 38.5 bits (88), Expect = 0.015,   Method: Compositional matrix adjust.
 Identities = 37/134 (27%), Positives = 59/134 (44%), Gaps = 12/134 (8%)

Query: 280 ITFSKVLRSFFLVFTANAI----IDMYFYEKVTFPFFRFLKFNFTTPLSKFYGVAPWHFH 335
           I+ + ++R+ F+   A       +D YF+ ++T P      FN     S  +G  P+  +
Sbjct: 219 ISLTSIVRTGFIGAGAGIFLSIQVDSYFWNRLTVPEIEAFIFNVVHGESSKWGTQPFFAY 278

Query: 336 FFQSLPIVLGASIPAFAFGLFFPLSKRSFPKKYLNPFFQVKLTILLNLLVYSTLPHKEFR 395
               LP++    IP  A  L   L  +  P    N F  V +    ++LV S  PHKE+R
Sbjct: 279 LTGYLPMMF---IPPTAL-LLNHLGFKIGP----NSFRVVGIAAYFHVLVMSLQPHKEWR 330

Query: 396 FIFPLQPLFILISS 409
           FI    P   L+ +
Sbjct: 331 FIIYSNPPITLLGA 344

>ABL185C [407] [Homologous to ScYNL219C (ALG9) - SH] (60000..61658)
           [1659 bp, 552 aa]
          Length = 552

 Score = 37.4 bits (85), Expect = 0.032,   Method: Compositional matrix adjust.
 Identities = 46/197 (23%), Positives = 83/197 (42%), Gaps = 27/197 (13%)

Query: 233 KESSFTKSLIFAFLACLQRPSSGLIWVIPSISLILNLVGKKQYHLLFIT----FSKVLRS 288
           KE  F  +L + FLA L      L W    +  +  ++     H + +T    FS VL  
Sbjct: 168 KEKPFVSALFYLFLAGL------LGWPFVLVLGLPLVLHYVLSHRMIVTLRTGFSSVL-V 220

Query: 289 FFLVFTANAIIDMYFYEKVTFPFFRFLKFNFTTPLSK----FYGVAPWHFHFFQSLPIVL 344
             ++     ++D  FY ++T   +  +K+N     +      +G  PW+++ F     +L
Sbjct: 221 LSMILGCVFVVDSIFYRRLTLVPWNIVKYNVLGTSADSGPHIFGTEPWYYYVFSL---LL 277

Query: 345 GASIPAFAFGLFFPLSKRSFPKKYLNPFFQVKLTILLNLLVYSTLPHKEFRFIFPLQPLF 404
              +P   F +   L    +P         V  ++   L+V+   PHKE RF++P+    
Sbjct: 278 NLPLPTLIFAIVALLHTNLWP---------VWCSLFAWLVVFIAQPHKEERFMYPIYAFV 328

Query: 405 ILISSFGLLRLDRDYWK 421
            L SS G  ++ +  W+
Sbjct: 329 TLASSIGFTKVSKLLWR 345

>Scas_606.6
          Length = 571

 Score = 37.4 bits (85), Expect = 0.034,   Method: Compositional matrix adjust.
 Identities = 33/132 (25%), Positives = 56/132 (42%), Gaps = 26/132 (19%)

Query: 290 FLVFTANAIIDMYFYEKVTFPFFRFLKFNFTTPLSK----FYGVAPWHFHFFQ-----SL 340
           F++ T   ++D  FY K T   +  L +N     ++     +GV  W ++         L
Sbjct: 227 FIITTIVIVVDSVFYGKFTPVSWNILFYNVINATNESGPNIFGVESWDYYILNLTINFPL 286

Query: 341 PIVLGASIPAFAFGLFFPLSKRSFPKKYLNPFFQVKLTILLNLLVYSTLPHKEFRFIFPL 400
           P++  + I  F   L+              P +   LT ++   ++   PHKE RF++P+
Sbjct: 287 PVLFASLIGIFHLSLW--------------PLWTSLLTWMI---IFINQPHKEERFLYPI 329

Query: 401 QPLFILISSFGL 412
            PL  L  S GL
Sbjct: 330 YPLISLCGSVGL 341

>Kwal_47.18842
          Length = 508

 Score = 37.0 bits (84), Expect = 0.043,   Method: Compositional matrix adjust.
 Identities = 41/170 (24%), Positives = 73/170 (42%), Gaps = 21/170 (12%)

Query: 315 LKFNFTTPLSKFYGVAPWHFHFFQSLPIVLGASIPAFAFGLFFPLSKRSFPKKYLNPFFQ 374
           L +N        +G+ P + H   ++P +LG         L F +S+R    + +N  F 
Sbjct: 246 LAYNLKNSNLAEHGLHPRYTHLLLNVPQMLGPL-------LIFFVSRR----QRINLSF- 293

Query: 375 VKLTILLNLLVYSTLPHKEFRFIFPLQPLFILISSFGLLRLDRDYWKRLSGLKSLLWLVP 434
             L  +  ++V S   H+E RF+ PL PLF +  S  L   D+    +L       WL  
Sbjct: 294 --LACISGIIVLSMFQHQELRFLIPLLPLFCV--SVDLSNFDKFVSSQLVNKA---WLA- 345

Query: 435 FVSVFIALLLDTFHESGSIEVMKFLHEEPEIDSLGFIMPCHSTPGQSYLH 484
             +V   +++ + H+ G + V++ L    E   +      +S P   Y++
Sbjct: 346 -FNVIFGVIMGSLHQRGVVTVIEELARPGEKIGVNLWWKTYSPPTWMYMN 394

>YOR149C (SMP3) [4948] chr15 complement(609838..611388) Protein
           required for addition of the fourth mannose in
           glycosylphosphotidylinositol biosynthesis, functions in
           the protein kinase C pathway and required for plasmid
           maintenance [1551 bp, 516 aa]
          Length = 516

 Score = 34.7 bits (78), Expect = 0.21,   Method: Compositional matrix adjust.
 Identities = 67/272 (24%), Positives = 109/272 (40%), Gaps = 37/272 (13%)

Query: 193 LSLTNFFNCFFITRTFINSFEMI-LTSIALYYWDWTGGQMIKESSFTKSLIFAFL---AC 248
           L LT++    + T TF NS E + L S      D    + I+ S+F  S+I   +     
Sbjct: 126 LLLTSYVTWTYQTHTFSNSIETLALISTLTVMEDMVNEKNIQRSNFKNSVILGLIFSFGV 185

Query: 249 LQRPSSGLIWVIPSISLILNLVGKKQYHLLFITFSKVLRSFFLVFTANAIIDMYFYEK-- 306
             R +      +P + L       K Y + + +FS +L SF        +ID   Y    
Sbjct: 186 FNRVTFPAFIFLPCLILFW-----KFYRVHWKSFSLLLLSFSFSSCLFVLIDTNIYNNGK 240

Query: 307 --VTFPFFRFLKFNFTTPLSKFYGVAPWHFHFFQSLPIVLGASIPAFAFGLF--FPLSKR 362
             V  P    LK+N      + +G+ P + H   +LP ++G   P     +F  + L K 
Sbjct: 241 GFVITPLNN-LKYNLNVQNLQVHGLHPRYTHLLVNLPQIVG---PVLLLAIFSGYKLDKL 296

Query: 363 SFPKKYLNPFFQVKLTILLNLLVYSTLPHKEFRFIFPLQPLFILISSFGLLRLDRDYWKR 422
           S               I+  LL  S   H+E RF+ PL PL +   ++  L       K 
Sbjct: 297 S------------TYAIISGLLFLSFFQHQELRFLVPLVPLLVTNLNWTPLSSTLVNKKI 344

Query: 423 LSGLKSLLWLVPFVSVFIALLLDTFHESGSIE 454
             G     WL+   ++ +A ++   H++G I+
Sbjct: 345 FKG----TWLL--FNIIMAFIMGISHQAGIIQ 370

>Kwal_23.4476
          Length = 552

 Score = 33.1 bits (74), Expect = 0.63,   Method: Compositional matrix adjust.
 Identities = 17/39 (43%), Positives = 23/39 (58%), Gaps = 4/39 (10%)

Query: 390 PHKEFRFIFPLQPLFILISSFGLLRLDRDYWKRLSGLKS 428
           PHKE RF++P+  L  L +S G   +    WKRL  LK+
Sbjct: 315 PHKEERFLYPVYALVTLAASVGFANI----WKRLERLKA 349

>CAGL0M10769g 1074047..1075735 similar to sp|P53730 Saccharomyces
           cerevisiae YNR030w involved in cell wall biogenesis and
           architecture, start by similarity
          Length = 562

 Score = 31.2 bits (69), Expect = 2.9,   Method: Compositional matrix adjust.
 Identities = 19/51 (37%), Positives = 26/51 (50%)

Query: 375 VKLTILLNLLVYSTLPHKEFRFIFPLQPLFILISSFGLLRLDRDYWKRLSG 425
           V L    ++L  ST PHKE+RFI    P  I++ S G   L  ++  R  G
Sbjct: 318 VTLAGYFHILAMSTQPHKEWRFIIYSVPPIIMLGSAGAAYLWENFKVRTMG 368

>AFR395C [3587] [Homologous to ScYOR149C (SMP3) - SH]
           (1145381..1146967) [1587 bp, 528 aa]
          Length = 528

 Score = 30.4 bits (67), Expect = 4.7,   Method: Compositional matrix adjust.
 Identities = 23/92 (25%), Positives = 37/92 (40%), Gaps = 18/92 (19%)

Query: 377 LTILLNLLVYSTLPHKEFRFIFPLQPLFILISSFGLLR-----LDRDYWKRLSGLKSLLW 431
           L+ +  +   S   H+E RF+ P  PLF++      LR     L    W   +GL     
Sbjct: 321 LSCVSGVATLSLFKHQEARFLLPDVPLFLMSVDLTKLRTVSLTLTLKLWLAFNGL----- 375

Query: 432 LVPFVSVFIALLLDTFHESGSIEVMKFLHEEP 463
                   + +++   H+ G I  +  L EEP
Sbjct: 376 --------MVVIMGVGHQRGVITALHQLREEP 399

>AFR002C [3194] [Homologous to ScYAL002W (VPS8) - SH]
           (438503..442195) [3693 bp, 1230 aa]
          Length = 1230

 Score = 30.4 bits (67), Expect = 5.8,   Method: Compositional matrix adjust.
 Identities = 16/43 (37%), Positives = 22/43 (51%), Gaps = 6/43 (13%)

Query: 460 HEEPEIDSLGFIMPCHS------TPGQSYLHRSDIQDLWSITC 496
           H+   I+ LGF+   H+      T GQ +LHR     LW +TC
Sbjct: 165 HQGYTINGLGFLPERHTGVVISDTRGQVWLHRGSRGKLWQLTC 207

>Sklu_1894.3 YNL219C, Contig c1894 4461-6116 reverse complement
          Length = 551

 Score = 30.0 bits (66), Expect = 5.8,   Method: Compositional matrix adjust.
 Identities = 19/46 (41%), Positives = 26/46 (56%), Gaps = 4/46 (8%)

Query: 390 PHKEFRFIFPLQPLFILISSFGLLRLDRDYWKRLSGLKSLLWLVPF 435
           PHKE RF++P+     L +S GL+    +  K+L   KSLL L  F
Sbjct: 314 PHKEERFLYPIYSTLTLSASVGLV----NCLKKLPRWKSLLQLTKF 355

>CAGL0K08206g 814575..818084 similar to sp|P53120 Saccharomyces
           cerevisiae YGL140c, start by similarity
          Length = 1169

 Score = 29.6 bits (65), Expect = 8.2,   Method: Compositional matrix adjust.
 Identities = 20/57 (35%), Positives = 27/57 (47%), Gaps = 4/57 (7%)

Query: 302 YFYEKVTFPFFRFLKFNFTTPLSKFYGVAPWHFHFFQSLPIVLGASIPAFAFGLFFP 358
           +FY  + FP F  + F F  PLS+  GV    F    S P  LG ++  F   + FP
Sbjct: 149 HFYFGIVFPLFLVVHFTFMAPLSETPGVIANSF----STPFYLGIAMSIFFNLILFP 201

  Database: blastdb
    Posted date:  Apr 3, 2006  3:33 PM
  Number of letters in database: 16,596,109
  Number of sequences in database:  34,618
  
Lambda     K      H
   0.330    0.144    0.462 

Gapped
Lambda     K      H
   0.267   0.0410    0.140 

Matrix: BLOSUM62
Gap Penalties: Existence: 11, Extension: 1
Number of Sequences: 34618
Number of Hits to DB: 19,405,311
Number of extensions: 848228
Number of successful extensions: 2432
Number of sequences better than 10.0: 31
Number of HSP's gapped: 2441
Number of HSP's successfully gapped: 32
Length of query: 605
Length of database: 16,596,109
Length adjustment: 107
Effective length of query: 498
Effective length of database: 12,891,983
Effective search space: 6420207534
Effective search space used: 6420207534
Neighboring words threshold: 11
Window for multiple hits: 40
X1: 15 ( 7.1 bits)
X2: 38 (14.6 bits)
X3: 64 (24.7 bits)
S1: 40 (21.8 bits)
S2: 64 (29.3 bits)