Hit NameLength (aa)HSP LengthHSP ScoreHSP Significance
YGL141W (HUL5)91089542330.0
CAGL0F07821g92191716600.0
Scas_669.1295865814930.0
Kwal_23.348190891313771e-176
ADL280W93360710921e-134
KLLA0E14740g9066219561e-115
Scas_717.6032593483612e-34
KLLA0B01804g32423593575e-34
CAGL0K06303g32473513504e-33
Kwal_47.1838932293533486e-33
KLLA0E13607g8193403438e-33
ADL055C8173483341e-31
YDR457W (TOM1)32683503352e-31
Kwal_47.173027873493303e-31
YER125W (RSP5)8093403261e-30
AER304C32583543282e-30
Scas_627.28353483181e-29
CAGL0K02255g8223403118e-29
Kwal_34.160648493512662e-23
AEL068W8393572618e-23
KLLA0E22660g8063512492e-21
YJR036C (HUL4)8923562242e-18
Scas_668.2114284382144e-17
Kwal_26.786914494342073e-16
CAGL0I01672g8583602054e-16
KLLA0B13585g14674232039e-16
Sklu_2101.24114081934e-15
YKL010C (UFD4)14834331922e-14
Scas_549.38423621902e-14
ABR013W14241731474e-09
CAGL0M10175g14764451376e-08
Scas_481.541659685.2
BLASTP 2.2.26 [Sep-21-2011]

Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, 
Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), 
"Gapped BLAST and PSI-BLAST: a new generation of protein database search
programs",  Nucleic Acids Res. 25:3389-3402.

Reference for compositional score matrix adjustment: Altschul, Stephen F., 
John C. Wootton, E. Michael Gertz, Richa Agarwala, Aleksandr Morgulis,
Alejandro A. Schaffer, and Yi-Kuo Yu (2005) "Protein database searches
using compositionally adjusted substitution matrices", FEBS J. 272:5101-5109.

Query= YGL141W
         (895 letters)

Database: blastdb 
           34,618 sequences; 16,596,109 total letters

Searching..................................................done

                                                                 Score    E
Sequences producing significant alignments:                      (bits) Value

YGL141W (HUL5) [1846] chr7 (238356..241088) Putative ubiquitin-p...  1635   0.0  
CAGL0F07821g complement(762977..765742) similar to sp|P53119 Sac...   644   0.0  
Scas_669.12                                                           579   0.0  
Kwal_23.3481                                                          535   e-176
ADL280W [1461] [Homologous to ScYGL141W (HUL5) - SH] complement(...   425   e-134
KLLA0E14740g complement(1316238..1318958) similar to sp|P53119 S...   372   e-115
Scas_717.60                                                           143   2e-34
KLLA0B01804g 144223..153951 similar to sgd|S0002865 Saccharomyce...   142   5e-34
CAGL0K06303g 610605..620348 similar to tr|Q03280 Saccharomyces c...   139   4e-33
Kwal_47.18389                                                         138   6e-33
KLLA0E13607g 1198133..1200592 similar to sp|P39940 Saccharomyces...   136   8e-33
ADL055C [1686] [Homologous to ScYER125W (RSP5) - SH] (584035..58...   133   1e-31
YDR457W (TOM1) [1275] chr4 (1369778..1379584) Protein required f...   133   2e-31
Kwal_47.17302                                                         131   3e-31
YER125W (RSP5) [1555] chr5 (410185..412614) Essential ubiquitin-...   130   1e-30
AER304C [2806] [Homologous to ScYDR457W (TOM1) - SH] (1194908..1...   130   2e-30
Scas_627.2                                                            127   1e-29
CAGL0K02255g complement(199719..202187) highly similar to sp|P39...   124   8e-29
Kwal_34.16064                                                         107   2e-23
AEL068W [2438] [Homologous to ScYJR036C (HUL4) - SH] complement(...   105   8e-23
KLLA0E22660g 2011000..2013420 similar to sp|P40985 Saccharomyces...   100   2e-21
YJR036C (HUL4) [2932] chr10 complement(500627..503305) Putative ...    91   2e-18
Scas_668.21                                                            87   4e-17
Kwal_26.7869                                                           84   3e-16
CAGL0I01672g 138747..141323 similar to sp|P40985 Saccharomyces c...    84   4e-16
KLLA0B13585g 1186427..1190830 similar to sp|P33202 Saccharomyces...    83   9e-16
Sklu_2101.2 YGL141W, Contig c2101 1350-2581                            79   4e-15
YKL010C (UFD4) [3246] chr11 complement(421067..425518) Ubiquitin...    79   2e-14
Scas_549.3                                                             78   2e-14
ABR013W [604] [Homologous to ScYKL010C (UFD4) - SH] complement(4...    61   4e-09
CAGL0M10175g complement(1014414..1018844) similar to sp|P33202 S...    57   6e-08
Scas_481.5                                                             31   5.2  

>YGL141W (HUL5) [1846] chr7 (238356..241088) Putative
           ubiquitin-protein ligase, associated with 26S proteasome
           [2733 bp, 910 aa]
          Length = 910

 Score = 1635 bits (4233), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 809/895 (90%), Positives = 809/895 (90%)

Query: 1   MLNFTGQTRRRNVNLGNRTRNSXXXXXXXXXXXXXXXXXXXLKEDASKTIQKSIRRHFSN 60
           MLNFTGQTRRRNVNLGNRTRNS                   LKEDASKTIQKSIRRHFSN
Sbjct: 1   MLNFTGQTRRRNVNLGNRTRNSKKDLLEKAKRERERRAQDKLKEDASKTIQKSIRRHFSN 60

Query: 61  VRLFKNTFTSSQLVHMIPAYGGKLIYYISQYDLQQLLKLSHNFLSSYPNSLGNRQLLSLL 120
           VRLFKNTFTSSQLVHMIPAYGGKLIYYISQYDLQQLLKLSHNFLSSYPNSLGNRQLLSLL
Sbjct: 61  VRLFKNTFTSSQLVHMIPAYGGKLIYYISQYDLQQLLKLSHNFLSSYPNSLGNRQLLSLL 120

Query: 121 KLYQDDALVAETLSDLNMDCPTVDEFLDSLSVYLCRASFLSYSSASKLADVIEAWEVMHX 180
           KLYQDDALVAETLSDLNMDCPTVDEFLDSLSVYLCRASFLSYSSASKLADVIEAWEVMH 
Sbjct: 121 KLYQDDALVAETLSDLNMDCPTVDEFLDSLSVYLCRASFLSYSSASKLADVIEAWEVMHS 180

Query: 181 XXXXXXXXXXXXXYEKRPFALQFYCILAERNLLPQLINTNPILWDNMAKTYSHCSKGGQK 240
                        YEKRPFALQFYCILAERNLLPQLINTNPILWDNMAKTYSHCSKGGQK
Sbjct: 181 SASISIFSISIGSYEKRPFALQFYCILAERNLLPQLINTNPILWDNMAKTYSHCSKGGQK 240

Query: 241 NIAKLLIPNFNNHIAPSVLRSDNDYVLKFYEKAFIDEVIATTANYVSDEDHVKNLMCYIA 300
           NIAKLLIPNFNNHIAPSVLRSDNDYVLKFYEKAFIDEVIATTANYVSDEDHVKNLMCYIA
Sbjct: 241 NIAKLLIPNFNNHIAPSVLRSDNDYVLKFYEKAFIDEVIATTANYVSDEDHVKNLMCYIA 300

Query: 301 SSPNQSCKNSVLITLLSNKDFVRRLSWEFFHTKFNASKTEAHPLFSVLAQLIDMHLLIST 360
           SSPNQSCKNSVLITLLSNKDFVRRLSWEFFHTKFNASKTEAHPLFSVLAQLIDMHLLIST
Sbjct: 301 SSPNQSCKNSVLITLLSNKDFVRRLSWEFFHTKFNASKTEAHPLFSVLAQLIDMHLLIST 360

Query: 361 DRELLDYNSVIPIEELKKFTSTLKDFTFRQYWELPKSERNPMLKEAVPLLSKVYERDSRL 420
           DRELLDYNSVIPIEELKKFTSTLKDFTFRQYWELPKSERNPMLKEAVPLLSKVYERDSRL
Sbjct: 361 DRELLDYNSVIPIEELKKFTSTLKDFTFRQYWELPKSERNPMLKEAVPLLSKVYERDSRL 420

Query: 421 HFLSTENNPTYWENSEKQFLNLRFYEELQEYEDLYRXXXXXXXXXXXXXXXXLDKERPPX 480
           HFLSTENNPTYWENSEKQFLNLRFYEELQEYEDLYR                LDKERPP 
Sbjct: 421 HFLSTENNPTYWENSEKQFLNLRFYEELQEYEDLYREHLEEESDEDMEKEIDLDKERPPL 480

Query: 481 XXXXXXXXXXXXXXXXXXXXXEILLELPFFIPFEERVDLFYMFIALDKKRLSLDDDHNLI 540
                                EILLELPFFIPFEERVDLFYMFIALDKKRLSLDDDHNLI
Sbjct: 481 KSLLLNKMKKRLKSSLRFRKLEILLELPFFIPFEERVDLFYMFIALDKKRLSLDDDHNLI 540

Query: 541 NMFTPWASTGMRKQSAIISRDNVLEDAFNAFNSIGERFKASLDVTFINEFGEEAGIDGGG 600
           NMFTPWASTGMRKQSAIISRDNVLEDAFNAFNSIGERFKASLDVTFINEFGEEAGIDGGG
Sbjct: 541 NMFTPWASTGMRKQSAIISRDNVLEDAFNAFNSIGERFKASLDVTFINEFGEEAGIDGGG 600

Query: 601 ITKEFLTTVSDEGFKDPKHELFRTNDRYELYPSVVYDATKLKYIWFLGKVVGKCLYEHVL 660
           ITKEFLTTVSDEGFKDPKHELFRTNDRYELYPSVVYDATKLKYIWFLGKVVGKCLYEHVL
Sbjct: 601 ITKEFLTTVSDEGFKDPKHELFRTNDRYELYPSVVYDATKLKYIWFLGKVVGKCLYEHVL 660

Query: 661 IDVSFADFFLKKLLNYSNGFLSSFSDLGSYDSVLYNNLIKLLNMTTDEIKSLDLTFEIDE 720
           IDVSFADFFLKKLLNYSNGFLSSFSDLGSYDSVLYNNLIKLLNMTTDEIKSLDLTFEIDE
Sbjct: 661 IDVSFADFFLKKLLNYSNGFLSSFSDLGSYDSVLYNNLIKLLNMTTDEIKSLDLTFEIDE 720

Query: 721 PESSAKVVDLIPNGSKTYVTKDNVLLYVTKVTDYKLNKRCFKPVSAFHGGLSVIIAPHWM 780
           PESSAKVVDLIPNGSKTYVTKDNVLLYVTKVTDYKLNKRCFKPVSAFHGGLSVIIAPHWM
Sbjct: 721 PESSAKVVDLIPNGSKTYVTKDNVLLYVTKVTDYKLNKRCFKPVSAFHGGLSVIIAPHWM 780

Query: 781 EMFNSIELQMLISGERDNIDLDDLKSNTEYGGYKEEDQTIVDFWEVXXXXXXXXXXXXXX 840
           EMFNSIELQMLISGERDNIDLDDLKSNTEYGGYKEEDQTIVDFWEV              
Sbjct: 781 EMFNSIELQMLISGERDNIDLDDLKSNTEYGGYKEEDQTIVDFWEVLNEFKFEEKLNFLK 840

Query: 841 XVTSVPQAPLQGFKALDPKFGIRNAGTEKYRLPTASTCVNLLKLPDYRNKTILRE 895
            VTSVPQAPLQGFKALDPKFGIRNAGTEKYRLPTASTCVNLLKLPDYRNKTILRE
Sbjct: 841 FVTSVPQAPLQGFKALDPKFGIRNAGTEKYRLPTASTCVNLLKLPDYRNKTILRE 895

>CAGL0F07821g complement(762977..765742) similar to sp|P53119
           Saccharomyces cerevisiae YGL141w HUL5 ubiquitin-protein
           ligase, start by similarity
          Length = 921

 Score =  644 bits (1660), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 378/917 (41%), Positives = 533/917 (58%), Gaps = 33/917 (3%)

Query: 1   MLNFTGQTRRRNVNLGNRTRNSXXXXXXXXXXXXXXXXXXXLKEDASKTIQKSIRRHFSN 60
           MLNFTGQTR+RNVNLG + + +                    +E ++  IQ+ IR+  S 
Sbjct: 1   MLNFTGQTRKRNVNLGRKQQTTKKEILQRAKLERDRRAEEKKQEASAAYIQRQIRKFLSC 60

Query: 61  VRLFKNTFTSSQLVHMIPAYGGKLIYYISQYDLQQLLKLSHNFLSSYPNSLGNRQLLSLL 120
            +      TS ++VH++P  G KL+ Y+  ++L  +L +S +FL+ +  +LGN +LL++ 
Sbjct: 61  KKTALLNLTSPKVVHLVPLLGSKLLIYLGTHELLHILNVSKHFLTQFGTALGNWKLLNIY 120

Query: 121 KLYQDDALVAETLSDLNMDCPTVDEFLDSLSVYLCRASFLSYSSA---SKLADVIEAWEV 177
               D  +    ++ LN+  P +D  +D+   ++     L  +S      +A V+ AW+V
Sbjct: 121 SDCHDVNIANMCINCLNIGIPLIDGIIDANIKFISSNEVLRGTSGLHIDVIAPVLSAWKV 180

Query: 178 MHXXXXXXXXXXXXXXYEKRPFALQFYCILAERNLLPQL-INTNPILWDNMAKTYSHCSK 236
                             +    L FY  L   +LLP + +N + +L +NM+  YS    
Sbjct: 181 QFSQNYRRVFEITESQCVQFEEVLHFYEGLVLNDLLPMVELNGSSVLLENMSYLYSKLKH 240

Query: 237 GGQK--NIAKLLIPNFNNHIAPSVLRSDNDYVLKFYEKAFID---EVIATTANYVSDEDH 291
             Q   NI +  + N         +R    YV + Y+K FI    + I    N+ SD   
Sbjct: 241 ANQHLYNIIRQCVTNVRYEPVNIRMRG---YVTEIYQKDFIYSYLDSINIHTNFSSD--- 294

Query: 292 VKNLMCYIASSPNQSCKNSVLITLLSNKDFVRRLSWEFFHTKFNASK------TEAHPLF 345
              L+ +I ++P+++ ++SV ++LLS ++FV  L   F  ++F   +         +P F
Sbjct: 295 ---LLNFIENAPSEAERDSVYVSLLSRENFVENLLNIF--SRFQDPEQTYWDDITHYPAF 349

Query: 346 SVLAQLIDMHLLISTDRELLDYNSVIPIEELKKFTSTLKDFTFRQYWELPKSERNPMLKE 405
            +L QLI +HL +STD ELL   + I +E+L  FT  +KD  F   W  P ++      E
Sbjct: 350 KLLCQLIKVHLWLSTDHELLYNRNRIKLEQLVLFTDGIKDMVFNDMWTKPTNDSFLYTNE 409

Query: 406 AVPLLSKVYERDSRLHFLSTEN-NPTYWENSEKQFLNLRFYEELQEYEDLYRX-XXXXXX 463
           A+PLL  +Y RDSR+ F  + N +  YW      FL    Y+++Q+YED YR        
Sbjct: 410 ALPLLKIIYLRDSRMKFCKSSNGDKEYWTVYNTDFLKTAIYKQIQDYEDYYRSYKDNYDD 469

Query: 464 XXXXXXXXXLDKERPPXXXXXXXXXXXXXXX---XXXXXXXEILLELPFFIPFEERVDLF 520
                     DKE                            +ILLE PF++PFE+RV++F
Sbjct: 470 LYDSDDEDNNDKEINDIMNLKANYLVNMEVKPNNIKQFRKLKILLEAPFYVPFEQRVEMF 529

Query: 521 YMFIALDKKRLSLDDDHNLI-NMFTPWASTGMRKQSAIISRDNVLEDAFNAFNSIGERFK 579
           Y  I LDK+RL+LDDD +L+ ++      +  R+Q+  ISRDNVLEDA+++FN  GERFK
Sbjct: 530 YTLIELDKRRLNLDDDSSLMMDVLNALGPSLSRRQAVNISRDNVLEDAYSSFNPAGERFK 589

Query: 580 ASLDVTFINEFGEEAGIDGGGITKEFLTTVSDEGFKDPKHELFRTNDRYELYPSVVYDAT 639
             L VTF NEFG EAGIDGGGITKEFLT+V++EGFK+ K++LF TN  YELYPS   +AT
Sbjct: 590 GKLSVTFTNEFGPEAGIDGGGITKEFLTSVTEEGFKNDKYKLFDTNQNYELYPSSEVNAT 649

Query: 640 KLKYIWFLGKVVGKCLYEHVLIDVSFADFFLKKLLNYSNGFLSSFSDLGSYDSVLYNNLI 699
           K+KY +FLGKV+GKC+Y+ VLID+ F DF LKKLLN SN ++S F DL S D  LY NL+
Sbjct: 650 KMKYYYFLGKVLGKCIYDRVLIDIHFTDFLLKKLLNSSNHYISYFDDLQSLDESLYQNLV 709

Query: 700 KLLNMTTDEIKSLDLTFEIDEPESSA-KVVDLIPNGSKTYVTKDNVLLYVTKVTDYKLNK 758
           KLL M+  +++SL+L FE+D+  +   +V +LIPNGSKT VTK+NVL Y+  + D+KLN+
Sbjct: 710 KLLAMSASDLESLELHFEVDDLSTGKNRVTELIPNGSKTVVTKNNVLQYLVLIADFKLNR 769

Query: 759 RCFKPVSAFHGGLSVIIAPHWMEMFNSIELQMLISGERDNIDLDDLKSNTEYGGYKEEDQ 818
              K V+A H GLSV+IAPHW EMFNS ELQ LISGE  +I+L+DLKSNT YGG+ +   
Sbjct: 770 SLNKQVAALHRGLSVMIAPHWFEMFNSSELQKLISGEGKDINLEDLKSNTIYGGFSDTSL 829

Query: 819 TIVDFWEVXXXXXXXXXXXXXXXVTSVPQAPLQGFKALDPKFGIRNAGTEKYRLPTASTC 878
           TI  FW++               VTSVPQAPLQGF AL+PKFGIRN+G E+ RLPTA+TC
Sbjct: 830 TIQYFWQILEEFEPQQRLDLLKFVTSVPQAPLQGFGALEPKFGIRNSGPERDRLPTAATC 889

Query: 879 VNLLKLPDYRNKTILRE 895
           VNLLKLPDY +K +LR+
Sbjct: 890 VNLLKLPDYADKELLRQ 906

>Scas_669.12
          Length = 958

 Score =  579 bits (1493), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 324/658 (49%), Positives = 420/658 (63%), Gaps = 33/658 (5%)

Query: 262 DNDYVLKFYEKAFIDEVIATTANYVSDEDHVKNLMCYIASSPNQSCKNSVLITLLSNKDF 321
           D  ++   +E  FID  +    +Y   E H      ++  +   + K SVL+  LSNK  
Sbjct: 295 DAYHIKNLFESKFIDTFLEKRPSY-EHEVHFMGWYKFLQLADMCNKKTSVLLNFLSNKS- 352

Query: 322 VRRLSWEFFHTKFNASKTEAHPLFSVLAQLIDMHLLISTDRELLDYNSVIPIEELKKFTS 381
              L +E F +     ++++   F +L +L+D+ LL+STD +LL  +S I + +L  FT 
Sbjct: 353 ---LMFELFTS---IDQSDSKMAFQLLIELMDLWLLVSTDFDLLSDSSKISMNQLISFTK 406

Query: 382 TLKDFTFRQYWELPKSERNPMLKEAVPLLSKVYERDSRLHFLSTENN------------- 428
           +LKD  F   W+L K +R+   + A+ LL+K+Y RDSR+HF++ + N             
Sbjct: 407 SLKDLVFHNLWDLSKDDRSENFETALHLLNKLYLRDSRIHFVTKKRNHDEKGHEIKDPNI 466

Query: 429 ---PTYWENSEKQFLNLRFYEELQEYEDLYRXXXXXXXXXXXXXX------XXLDKERPP 479
                +W   ++ FL +  Y+ L  Y+D YR                      + K    
Sbjct: 467 TTSKDFWATDDQNFLKINIYKILSNYDDAYRSKAELNEDNNEEEAGMENENNTMKKRSLK 526

Query: 480 XXXXXXXXXXXXXXXXXXXXXXEILLELPFFIPFEERVDLFYMFIALDKKRLSLDD-DHN 538
                                  ILL +PFF+PF ERVDLFY  IALDK+RL+LDD D N
Sbjct: 527 LEVFEEMSRNQTRNETKQLRKLSILLRVPFFLPFNERVDLFYTLIALDKQRLNLDDPDRN 586

Query: 539 LI-NMFTPWASTGMRKQSAIISRDNVLEDAFNAFNSIGERFKASLDVTFINEFGEEAGID 597
           ++  +  PW S GM +Q+A+ISR++VLEDAFN++N IGERFK+ L VTF+NEFG EAGID
Sbjct: 587 MMFELAMPWMSNGMGRQTAVISREHVLEDAFNSYNKIGERFKSRLSVTFVNEFGPEAGID 646

Query: 598 GGGITKEFLTTVSDEGFKDPKHELFRTNDRYELYPSVVYDATKLKYIWFLGKVVGKCLYE 657
           GGGITKEFLT+VS+EGFK  +++LF TND+YELYPS      KLKY+WF+GK+VGKCLYE
Sbjct: 647 GGGITKEFLTSVSEEGFKKSEYKLFETNDQYELYPSTDVTPEKLKYLWFMGKIVGKCLYE 706

Query: 658 HVLIDVSFADFFLKKLLNYSNGFLSSFSDLGSYDSVLYNNLIKLLNMTTDEIKSLDLTFE 717
           HVLIDVSFA+FFLKKLLNYSN F  SF DL S DS LY NL KLL MT +EI+SL LTFE
Sbjct: 707 HVLIDVSFANFFLKKLLNYSNNFQLSFDDLSSLDSSLYMNLTKLLAMTDEEIQSLGLTFE 766

Query: 718 IDEPESSAKVVDLIPNGSKTYVTKDNVLLYVTKVTDYKLNKRCFKPVSAFHGGLSVIIAP 777
           +    +  K ++LIPNGS   VTK+NVL Y+TKV++YKLN   F+   +FHGGLS +I P
Sbjct: 767 M-TSSTKDKPIELIPNGSHIPVTKENVLQYLTKVSNYKLNVSMFRQCVSFHGGLSTMILP 825

Query: 778 HWMEMFNSIELQMLISGERDNIDLDDLKSNTEYGGYKEEDQTIVDFWEVXXXXXXXXXXX 837
            W+EMFNSIELQMLISG   +IDLDDLK+N EYGG+  +D+TIV  WE+           
Sbjct: 826 TWVEMFNSIELQMLISGGGKDIDLDDLKNNVEYGGFSSDDKTIVALWEIMAECNTEERLA 885

Query: 838 XXXXVTSVPQAPLQGFKALDPKFGIRNAGTEKYRLPTASTCVNLLKLPDYRNKTILRE 895
               VTSVPQAPLQGF+AL+P+FGIRNAGTE  RLPTASTCVNLLKLPDY++K +LRE
Sbjct: 886 FIKFVTSVPQAPLQGFQALEPRFGIRNAGTELDRLPTASTCVNLLKLPDYQDKELLRE 943

 Score = 55.8 bits (133), Expect = 1e-07,   Method: Compositional matrix adjust.
 Identities = 30/90 (33%), Positives = 44/90 (48%), Gaps = 3/90 (3%)

Query: 1  MLNFTGQTRRRNVNLGNRTRNSXXXXXXXXXXXXXXXXXXXLKEDASKTIQKSIRRHFSN 60
          M+NFTGQTRRRNVNLG R   +                    + +A+  IQ  IR H + 
Sbjct: 1  MMNFTGQTRRRNVNLGTRPLTTKKDLLLRAQLEREKRAKDRTRINAATKIQSFIRMHLTC 60

Query: 61 VRLFKNTFTSSQL---VHMIPAYGGKLIYY 87
           + F +    S +   +H+ PAYG +++ Y
Sbjct: 61 QQFFAHDIWISDMEHSIHIFPAYGPRILNY 90

>Kwal_23.3481
          Length = 908

 Score =  535 bits (1377), Expect = e-176,   Method: Compositional matrix adjust.
 Identities = 341/913 (37%), Positives = 500/913 (54%), Gaps = 40/913 (4%)

Query: 1   MLNFTGQTRRRNVNLGNRTRNSXXXXXXXXXXXXXXXXXXXLKEDASKTIQKSIRRH--- 57
           MLNFTGQT+RRNVNLGN++  +                     E+ +  IQ +IRR+   
Sbjct: 1   MLNFTGQTKRRNVNLGNKSGRTKQELLNEARKERERRALIRRNEENAVIIQSAIRRYESS 60

Query: 58  FSNVRLFKNTFTSSQLVHMIPAYGGKLIYYISQYDLQQLLKLSHNFLSSYPNSLGNRQLL 117
            S+   F N         +I AY     + + +   Q++L    N      N    R L 
Sbjct: 61  KSSYTAFINNLDQDIARSLIIAYPVSTFHTLGEEVTQRVLNCVTNEGQYVLNLRITRLLS 120

Query: 118 SLLKLYQDDALVAETLSDLNMDCPTVDEFLDSLSVYLCRASF-LSYSSASKLADVIEAWE 176
            L      +  +   LS L    P   E++ S+   L  A++  S +  S +  ++  + 
Sbjct: 121 ELGSRECSETFINTVLSKLVPINPPKAEYVQSIIKLLTSATYEFSAAILSHIVQLVHDFN 180

Query: 177 VMHXXXXXXXXXXXXXXYEKRPFALQFYCILAERNLLPQLIN---TNPILWDNMAKTYSH 233
           +                 +      QF  +L+ +   PQ ++   ++  L DN+A  Y+ 
Sbjct: 181 IWESQLLTLLFSIPIEDSKVASNIRQFLQLLS-KTCPPQDLSEDTSSRHLVDNLAYIYTA 239

Query: 234 CSKGGQKNIAKLLIPNFNNHIAP--SVLRSDNDYVLKFYEKAFIDEVIATTANYVSDEDH 291
                +  +A  ++ +    + P   ++  D  +    Y ++F+D V+ ++++   D+  
Sbjct: 240 AVDSAKPKLADAVLKS----LKPFRGLVLGDCPHFSGLYTRSFVDVVMRSSSDGFYDK-- 293

Query: 292 VKNLMCYIASSPNQSCKNSVLITLLSNKDFVRRLSWEFFHTKFNASKTEAHPLFSVL-AQ 350
              +   I+ +P+   KN+VLI LL+       LS  +       S+  + P  ++L  +
Sbjct: 294 ---MSDLISQAPDVDRKNNVLIALLAKPG---ALSQAYNQAIDKNSEMASKPKNALLLVE 347

Query: 351 LIDMHLLISTDRELLDYNSVIPIEELKKFTSTLKDFTFRQYWELPKSERNPMLKEA-VPL 409
           +++++L +++D E+L      P++ L+K T  LK+  F   W+  +S R  +L +  +  
Sbjct: 348 MLNLYLSVASDYEILHNVETFPLQYLQKATVFLKNVCFENLWD--ESGRQEVLADCYLST 405

Query: 410 LSKVYERDSRLHFLSTENNPTYWENSEKQFLNLRFYEELQEYEDLYRXXXXXXXXXXXXX 469
           L K++ RDSRLHF S  N   +W   ++ FLN+     +++YE  YR             
Sbjct: 406 LKKIHLRDSRLHFCSQNNKIDFWSVLDEGFLNVNITNYIKDYESFYRDHLNAVENENDEK 465

Query: 470 XXXLDKERPPXXX---XXXXXXXXXXXXXXXXXXXEILLELPFFIPFEERVDLFYMFIAL 526
                 +R                            IL   PF+IPF++RVD  Y+ I+L
Sbjct: 466 GYEDSMKRSDLRRDFLSAAQVSFSNRPTTRQYRKLNILFNAPFYIPFQQRVDWLYLLISL 525

Query: 527 DKKRLSLDDDHNLINMFTPWASTGMR----KQSAIISRDNVLEDAFNAFNSIGERFKASL 582
           D +RL L  +  L ++F+PW    MR    KQ+A ISR+N+LEDAF A+N IGE FK+ L
Sbjct: 526 DHQRLDLSQN-GLGSVFSPW---NMRPNFDKQNATISRENLLEDAFAAYNPIGESFKSKL 581

Query: 583 DVTFINEFGEEAGIDGGGITKEFLTTVSDEGFKDPKHELFRTNDRYELYP-SVVYDATKL 641
            +TF+NEFG EAGIDGGGITKEFLT+++D+ FKD K++LF+ N  +E+YP S + D+  +
Sbjct: 582 SITFVNEFGPEAGIDGGGITKEFLTSITDKAFKDDKYQLFKHNKNHEIYPASNLNDSANV 641

Query: 642 KYIWFLGKVVGKCLYEHVLIDVSFADFFLKKLLNYSNGFLSSFSDLGSYDSVLYNNLIKL 701
            Y+WFLGKV+GKCLY+HVL+DV+FADFFLKKLLN++N   SSF DL S D  LY+NL KL
Sbjct: 642 NYVWFLGKVLGKCLYDHVLVDVTFADFFLKKLLNFNNSN-SSFDDLASLDPDLYSNLAKL 700

Query: 702 LNMTTDEIKSLDLTFEIDEPESSAKVVDLIPNGSKTYVTKDNVLLYVTKVTDYKLNKRCF 761
           L M +DE+++L L FEI + E + + V+L+PNGS   V K NVL ++  V+D+KLNK+  
Sbjct: 701 LVMNSDELQALGLLFEITD-EDTHRTVELVPNGSSLRVDKSNVLHFLLAVSDFKLNKKLR 759

Query: 762 KPVSAFHGGLSVIIAPHWMEMFNSIELQMLISGERDNIDLDDLKSNTEYGGYKEEDQTIV 821
               AF GGL  +I PHW+EMFNS ELQMLISG   +IDL+DL++NTEYG Y  + QTI 
Sbjct: 760 VGTRAFTGGLYTMIPPHWIEMFNSAELQMLISGGGKDIDLEDLQNNTEYGDYTYKHQTIK 819

Query: 822 DFWEVXXXXXXXXXXXXXXXVTSVPQAPLQGFKALDPKFGIRNAGTEKYRLPTASTCVNL 881
           DFWE+               VTSVP+APLQGF +L P+FGIRNAG +  RLPTASTCVNL
Sbjct: 820 DFWEILAECSPEDRLKFVKFVTSVPRAPLQGFGSLSPRFGIRNAGQDTSRLPTASTCVNL 879

Query: 882 LKLPDYRNKTILR 894
           LKLPDYRNK ILR
Sbjct: 880 LKLPDYRNKEILR 892

>ADL280W [1461] [Homologous to ScYGL141W (HUL5) - SH]
           complement(209353..212154) [2802 bp, 933 aa]
          Length = 933

 Score =  425 bits (1092), Expect = e-134,   Method: Compositional matrix adjust.
 Identities = 257/607 (42%), Positives = 348/607 (57%), Gaps = 25/607 (4%)

Query: 300 ASSPNQSCKNSVLITLLSNKDFVRRLSWEFFHTKFNASKTEAHPLFSVLAQLIDMHLLIS 359
           A SP Q+    +L+ ++++ D ++RL  E    K + + T A   FS+L + +D++L   
Sbjct: 326 APSPRQA--EVLLLGIVADADAMQRLVQE---CKTSGAVTSAS--FSLLTECLDIYLSYV 378

Query: 360 TDRELLDYNSVIPIEELKKFTSTLKDFTFRQYWELPKSERNPMLKEAVPLLSKVYERDSR 419
            D  LL   S  P+E+L  F + ++D   +        E N M + A+ LL K+Y RD R
Sbjct: 379 NDTVLLGPKSNFPLEDLVVFCNLVRDAISQALRAEHDYEVNKM-RRALSLLQKLYIRDRR 437

Query: 420 LHFLSTENNPTYW-------ENSEKQFLNLRFYEELQEYEDLYRXXXXXXXXXXXXXXXX 472
            +FLS      +W       +N +   L L F E  +E  DL+                 
Sbjct: 438 TNFLSAAKGDDFWVIADTTVKNCDITSLLLYFDEFYREQLDLFLAQGRARHEVPSGDLVA 497

Query: 473 LDKERPPXXXXXXXXXXXXXXXXXXXXXXEILLELPFFIPFEERVDLFYMFIALDKKRLS 532
            + +                         E++L  PF +PF ERV  F   I  D++RL 
Sbjct: 498 WEND-IKVKFFSEKSSKHASWGSLALRKFELVLRAPFLLPFRERVAYFETLIHHDRRRLQ 556

Query: 533 ---LDDDHNLINMFTPWASTGMRKQSAIISRDNVLEDAFNAFNSIGERFKASLDVTFINE 589
                    L +++ P +    R+Q AIISR+N+LEDA+ A+N +GE FK  L VTFINE
Sbjct: 557 GRHTGPALRLPDLYFPSS----RRQRAIISRNNILEDAYEAYNPLGEDFKDQLAVTFINE 612

Query: 590 FGEEAGIDGGGITKEFLTTVSDEGFKDPKHELFRTNDRYELYPS-VVYDATKLKYIWFLG 648
           FG EAGIDGGGITKEFLT+VSDEGF   K+ LF+ N  YELYPS       +L+Y+ FLG
Sbjct: 613 FGPEAGIDGGGITKEFLTSVSDEGFNKDKYRLFKANSVYELYPSDAATSPQQLQYLHFLG 672

Query: 649 KVVGKCLYEHVLIDVSFADFFLKKLLNYSNGFLSSFSDLGSYDSVLYNNLIKLLNMTTDE 708
           KV+GKCLYE VLIDV FADFFL KLL+ S     SF +L S+D  LY+NL KL +M+T E
Sbjct: 673 KVLGKCLYEKVLIDVHFADFFLHKLLSTSKNMACSFDNLPSFDRELYDNLNKLFDMSTAE 732

Query: 709 IKSLDLTFEIDEPESSAKVVDLIPNGSKTYVTKDNVLLYVTKVTDYKLNKRCFKPVSAFH 768
           ++ LDL  EI + E++ K+V+L+P GS+  VT  NV  Y   V  Y++N +  +    F 
Sbjct: 733 LQLLDLRMEIVD-ENTMKIVELVPGGSQIPVTTTNVRQYALAVASYRMNSQLARATFYFQ 791

Query: 769 GGLSVIIAPHWMEMFNSIELQMLISGERDNIDLDDLKSNTEYGGYKEEDQTIVDFWEVXX 828
            G++VII PHW+ +F+S EL  LISG   +IDL DL++N  YGGY E D TI   W++  
Sbjct: 792 TGMAVIIPPHWIAIFSSSELSKLISGGGRDIDLADLRANVTYGGYVESDPTIQHLWQLLL 851

Query: 829 XXXXXXXXXXXXXVTSVPQAPLQGFKALDPKFGIRNAGTEKYRLPTASTCVNLLKLPDYR 888
                         TSVP+APL GF+ L+PKFGIRNAGT+  RLPTASTCVNLLKLPDY+
Sbjct: 852 EFTPEQRCKFIKFATSVPRAPLLGFQMLNPKFGIRNAGTDYNRLPTASTCVNLLKLPDYQ 911

Query: 889 NKTILRE 895
           +K +LRE
Sbjct: 912 DKDLLRE 918

 Score = 36.2 bits (82), Expect = 0.14,   Method: Compositional matrix adjust.
 Identities = 21/90 (23%), Positives = 40/90 (44%), Gaps = 3/90 (3%)

Query: 1  MLNFTGQTRRRNVNLGNRTRNSXXXXXXXXXXXXXXXXXXXLKEDASKTIQKSIRRHFSN 60
          MLNF+G T+RRNVNLG+  + +                     ++++  IQ+  RR  + 
Sbjct: 1  MLNFSGSTKRRNVNLGSSKKINKSELIEKARLERERRAQEKRIQESTLCIQRCARRWTAR 60

Query: 61 VRLFKN---TFTSSQLVHMIPAYGGKLIYY 87
           R+  +            ++ A+G  +++Y
Sbjct: 61 RRVLGSLDGVAAREYGTQILVAFGAGILHY 90

>KLLA0E14740g complement(1316238..1318958) similar to sp|P53119
           Saccharomyces cerevisiae YGL141w HUL5 ubiquitin-protein
           ligase (E3), start by similarity
          Length = 906

 Score =  372 bits (956), Expect = e-115,   Method: Compositional matrix adjust.
 Identities = 236/621 (38%), Positives = 334/621 (53%), Gaps = 48/621 (7%)

Query: 293 KNLMCYIASSPNQSCKNSVLITLLSN----KDFVRRLSWEFFHTKFNASKTEAHPLFSVL 348
           K +  +++  P+   +NS+L+++L+N     D +  L  +      NA        FSV 
Sbjct: 301 KGIHFFLSQLPSMQ-RNSILMSILTNTHIRNDLLELLCDDSVAANLNA--------FSVC 351

Query: 349 AQLIDMHLLISTDRELLDYNSVIPIEELKKFT---------STLKDFTFRQYWELPKSER 399
           +Q+++ ++ +S D +L  + ++I  + L+  +         S L   TF     +P  E 
Sbjct: 352 SQMLNFYIPLSPDDQL--FKTIITRDRLQALSINIAKLLISSILGSDTF-----IPSQE- 403

Query: 400 NPMLKEAVPLLSKVYERDSRLHFLSTENNPTYWENSEKQFLNLRFYEELQEYEDLYRXXX 459
              L   + L+  +   DSR+ FL  +   T+W+   ++  NL   +E+ E+E  YR   
Sbjct: 404 ---LDTFIELMWNLIYLDSRVQFLK-KGTSTFWDLVPEEMHNLNIKKEILEFEQYYRAYL 459

Query: 460 XXXXXXXXXXXXXLDKER----PPXXXXXXXXXXXXXXXXXXXXXXEILLELPFFIPFEE 515
                         DK++                            E+L + PF I F E
Sbjct: 460 VRFEEMDLNEDEMFDKKKFIDQNIKGQYLDDLKSKRRGSSSKIRKLELLFKFPFMIKFFE 519

Query: 516 RVDLFYMFIALDKKRLSLDDDHNLINMFTPWASTGMRKQSAIISRDNVLEDAFNAFNSIG 575
           RVD F   I  DK R+     ++   +F      G  +  + I R++ LEDA+NA+ ++G
Sbjct: 520 RVDYFNDLIEADKIRIY--SRNSFFGVFP-----GENRLRSTIRREHALEDAYNAYGAVG 572

Query: 576 ERFKASLDVTFINEFGEEAGIDGGGITKEFLTTVSDEGFKDPKHELFRTNDRYELYPSVV 635
           E FK  L + F+NEFG EAGIDGGGITKEFL T+  EGF +   +LF T    +LYPS  
Sbjct: 573 EMFKEKLGIQFVNEFGPEAGIDGGGITKEFLQTLVQEGFINQPFKLFDTTSFNKLYPSKN 632

Query: 636 YDATKLKYIWFLGKVVGKCLYEHVLIDVSFADFFLKKLLNYSNGFLSSFSDLGSYDSVLY 695
                LKYI F+GK++GKCLYE++L+DV  ADFFLKK+LN  N     F+DL S D   Y
Sbjct: 633 VSPQNLKYISFMGKILGKCLYENILVDVELADFFLKKILNVENNMNVPFNDLYSLDPEYY 692

Query: 696 NNLIKLLNMTTDEIKSLDLTFEI-DEPESSAKVVDLIPNGSKTYVTKDNVLLYVTKVTDY 754
            NL+KLL M+ +E+  +DL FE+ D P  + K + LI +G  T VT+ NV  Y+T+++ Y
Sbjct: 693 RNLMKLLEMSENELAYMDLYFEVPDAP--NGKRIPLIKDGLSTKVTQKNVFEYITRISHY 750

Query: 755 KLNKRCFKPVSAFHGGLSVIIAPHWMEMFNSIELQMLISGERDNIDLDDLKSNTEYGGYK 814
           KLN + +   S F  GLS +I  HW+ MF S EL+ LISG   + DL+DLK NT YGG+ 
Sbjct: 751 KLNLQLYTVTSRFITGLSYMIPAHWLRMFTSYELKTLISGSEKDFDLEDLKKNTSYGGFS 810

Query: 815 EEDQTIVDFWEVXXXXXXXXXXXXXXXVTSVPQAPLQGFKALDPKFGIRNAGTEKYRLPT 874
           E   TI  FW+V               V SVP APL+GF +L+P FGIRNAG E  RLPT
Sbjct: 811 ESSVTIQHFWQVLSSFTPEERRKFLKFVFSVPTAPLKGFHSLNPLFGIRNAGDETDRLPT 870

Query: 875 ASTCVNLLKLPDYRNKTILRE 895
           ASTC+NLLKLPDY+N   LRE
Sbjct: 871 ASTCINLLKLPDYQNYHTLRE 891

 Score = 39.7 bits (91), Expect = 0.013,   Method: Compositional matrix adjust.
 Identities = 26/93 (27%), Positives = 41/93 (44%), Gaps = 5/93 (5%)

Query: 1  MLNFTGQTRRRNVNLGNRT-RNSXXXXXXXXXXXXXXXXXXXLKEDASKTIQKSIRRHFS 59
          M+NF GQ  RRNVN+G+R  R +                    + +A  TIQ+ +R+  S
Sbjct: 1  MMNFNGQVTRRNVNMGSRAPRKTRDTILKNAELERARRQRERAEINAVLTIQRYMRKRIS 60

Query: 60 N----VRLFKNTFTSSQLVHMIPAYGGKLIYYI 88
          N     RL K + T      ++  +  +L  Y+
Sbjct: 61 NNLIFHRLVKQSLTDKTAASILKVFSKRLYAYL 93

>Scas_717.60
          Length = 3259

 Score =  143 bits (361), Expect = 2e-34,   Method: Compositional matrix adjust.
 Identities = 110/348 (31%), Positives = 167/348 (47%), Gaps = 22/348 (6%)

Query: 558  ISRDNVLEDAFNA-FNSIGERFKAS-LDVTFINEFGEEAGIDGGGITKEFLTTVSDEGFK 615
            + RD V  D++ A F    E  K S L++TF  E    +G+D GG+T+E+   +S + F 
Sbjct: 2906 VRRDQVFLDSYRALFFKKDEEIKDSKLEITFKGE----SGVDAGGLTREWYQVLSRQMF- 2960

Query: 616  DPKHELFR--TNDRYELYPSVV--YDATKLKYIWFLGKVVGKCLYEHVLIDVSFADFFLK 671
            +P + LF    +D+   +P+     +   L +  F+G V+GK + +   +D  F+    K
Sbjct: 2961 NPDYALFLPVASDKTTFHPNRTSGINPEHLSFFKFIGMVIGKAIRDQCFLDCHFSREVYK 3020

Query: 672  KLLNYSNGFLSSFSDLGSYDSVLYNNLIKLLNMTTDEIKSLDLTFEIDEPESSAKVVDLI 731
             +L    G   S  D+ S D   Y +L+ +L     +I     + E+D+     K +DLI
Sbjct: 3021 NIL----GKPVSLRDMESLDPDYYKSLVWILENDITDIIEETFSVELDD-YGEHKTIDLI 3075

Query: 732  PNGSKTYVTKDNVLLYVTKVTDYKLNKRCFKPVSAFHGGLSVIIAPHWMEMFNSIELQML 791
             NG+   VT++N   YV K+ +YKLN    + +  F  G   +I  + + +F+  EL++L
Sbjct: 3076 ENGANIPVTEENKQEYVKKIVEYKLNTSVKEQMDNFLRGFYALIPLNLISIFDEQELELL 3135

Query: 792  ISGERDNIDLDDLKSNTEYGGYKEEDQTIVDFWEVXXXXXXXXXXXXXXXVTSVPQAPLQ 851
            ISG  D ID+DD K+NT Y  Y   D+ I  FW                 VT   + PL 
Sbjct: 3136 ISGLPD-IDVDDWKNNTNYVNYTISDREIGYFWRAVRSFDGEERAKLLQFVTGTSKVPLN 3194

Query: 852  GFKALDP-----KFGIRNAGTEKYRLPTASTCVNLLKLPDYRNKTILR 894
            GFK L       KF I        RLP++ TC N L LP Y +   LR
Sbjct: 3195 GFKELGGVNGVCKFSIHKDYGSTERLPSSHTCFNQLNLPAYNSYETLR 3242

>KLLA0B01804g 144223..153951 similar to sgd|S0002865 Saccharomyces
            cerevisiae YDR457w TOM1 E3 ubiqitin ligase required for
            G2/M transition, start by similarity
          Length = 3242

 Score =  142 bits (357), Expect = 5e-34,   Method: Compositional matrix adjust.
 Identities = 113/359 (31%), Positives = 167/359 (46%), Gaps = 24/359 (6%)

Query: 548  STGMRKQSAIISRDNVLEDAFNA--FNSIGERFKASLDVTFINEFGEEAGIDGGGITKEF 605
            +T  +K S  + RD V  D++ A  F S  E     LD+TF      EAG+D GG+T+E+
Sbjct: 2879 TTTRQKLSITVLRDQVFLDSYRALFFKSNDEIKNCKLDITF----KGEAGVDEGGVTREW 2934

Query: 606  LTTVSDEGFKDPKHELF----RTNDRYELYPSVVYDATKLKYIWFLGKVVGKCLYEHVLI 661
               +S + F +P + LF      N ++    +   +   L +  F+G ++GK + ++  +
Sbjct: 2935 YQVLSRQMF-NPDYALFIPVGTDNTKFRPNRTSGINPEHLSFFKFVGMIIGKAISDNCFL 2993

Query: 662  DVSFADFFLKKLLNYSNGFLSSFSDLGSYDSVLYNNLIKLLNMTTDEIKSLDLTFEIDEP 721
            D  F+    K +L    G   S  D+ S D   Y +L  +L    D    +D TF +D  
Sbjct: 2994 DCHFSREVYKNIL----GKPVSLKDMESLDLEYYKSLNWMLE--NDITYVIDETFSVDTD 3047

Query: 722  E-SSAKVVDLIPNGSKTYVTKDNVLLYVTKVTDYKLNKRCFKPVSAFHGGLSVIIAPHWM 780
            +    K +DLIPNG    VT++N   YV K+ +YKL +     +     G   +I    +
Sbjct: 3048 DYGEHKTIDLIPNGRNIPVTEENKKEYVQKIVEYKLQESVKDHMQNLLQGFYAVIDKDLI 3107

Query: 781  EMFNSIELQMLISGERDNIDLDDLKSNTEYGGYKEEDQTIVDFWEVXXXXXXXXXXXXXX 840
             +F+  EL++LISG  D ID+DD K+NT Y  Y    + I  FW                
Sbjct: 3108 SIFDEQELELLISGLPD-IDVDDWKNNTTYVNYTPTCKQINYFWRAVRSFDKEERAKLLQ 3166

Query: 841  XVTSVPQAPLQGFKAL-----DPKFGIRNAGTEKYRLPTASTCVNLLKLPDYRNKTILR 894
             VT   + PL GFK L     D KF I        RLP++ TC N L LP Y +   LR
Sbjct: 3167 FVTGTSKLPLNGFKDLSGINGDSKFSIHRDYGSTERLPSSHTCFNQLDLPAYDSYEQLR 3225

>CAGL0K06303g 610605..620348 similar to tr|Q03280 Saccharomyces
            cerevisiae YDR457w ubiqitin ligase, start by similarity
          Length = 3247

 Score =  139 bits (350), Expect = 4e-33,   Method: Compositional matrix adjust.
 Identities = 109/351 (31%), Positives = 171/351 (48%), Gaps = 28/351 (7%)

Query: 558  ISRDNVLEDAFNA--FNSIGERFKASLDVTFINEFGEEAGIDGGGITKEFLTTVSDEGFK 615
            + RD V  D++ A  F S  E   + L++TF  E    +G+D GG+T+E+   +S + F 
Sbjct: 2894 VRRDQVFLDSYRALFFKSNEEIKNSRLEITFKGE----SGVDAGGVTREWYQVLSRQMF- 2948

Query: 616  DPKHELFR--TNDRYELYPSVV--YDATKLKYIWFLGKVVGKCLYEHVLIDVSFADFFLK 671
            +P + LF    +D+    P+     +   L +  F+G V+GK + +   +D  F+    K
Sbjct: 2949 NPGYALFTPVASDKTTFRPNRASGVNPEHLSFFKFVGMVIGKAIRDQCFLDCHFSREVYK 3008

Query: 672  KLLNYSNGFLSSFSDLGSYDSVLYNNLIKLL-NMTTDEIKSLDLTFEIDEPE-SSAKVVD 729
             +L    G   +  D+ S D   Y +L+ +L N  TD I+    TF ++  +    K++D
Sbjct: 3009 SIL----GKPVALKDMESLDLDYYKSLVWILENDITDIIEE---TFSVETDDYGEHKIID 3061

Query: 730  LIPNGSKTYVTKDNVLLYVTKVTDYKLNKRCFKPVSAFHGGLSVIIAPHWMEMFNSIELQ 789
            LI NG    VT+ N   YV K+ +YKL+    + +  F  G   +I    + +F+  EL+
Sbjct: 3062 LIDNGRNVSVTESNKQDYVRKIVEYKLHTSVKEQMDNFLSGFYALIPKDVISIFDEQELE 3121

Query: 790  MLISGERDNIDLDDLKSNTEYGGYKEEDQTIVDFWEVXXXXXXXXXXXXXXXVTSVPQAP 849
            +LISG  D ID+DD K+NT Y  Y E  + +  FW                 VT   + P
Sbjct: 3122 LLISGLPD-IDVDDWKNNTTYVNYTESCKQVSYFWRAVRSFDAEEKAKLLQFVTGTSKVP 3180

Query: 850  LQGFKALDPKFGI------RNAGTEKYRLPTASTCVNLLKLPDYRNKTILR 894
            L GFK L    G+      R+ G+ + RLP++ TC N L LP Y +   LR
Sbjct: 3181 LNGFKELSGVSGVCKFSIHRDYGSTE-RLPSSHTCFNQLNLPAYASYDTLR 3230

>Kwal_47.18389
          Length = 3229

 Score =  138 bits (348), Expect = 6e-33,   Method: Compositional matrix adjust.
 Identities = 109/353 (30%), Positives = 165/353 (46%), Gaps = 22/353 (6%)

Query: 553  KQSAIISRDNVLEDAFNA--FNSIGERFKASLDVTFINEFGEEAGIDGGGITKEFLTTVS 610
            K S  + RD V  D++ +  F S  +   + L++TF  E    AG+D GG+T+E+   +S
Sbjct: 2871 KLSISVRRDQVFLDSYRSLFFKSNEDIKNSKLEITFKGE----AGVDAGGVTREWYQVLS 2926

Query: 611  DEGFKDPKHELFR--TNDRYELYP--SVVYDATKLKYIWFLGKVVGKCLYEHVLIDVSFA 666
             + F +P + LF    +D+   +P  +   +   L +  F+G ++GK + +   +D  F+
Sbjct: 2927 RQMF-NPDYALFLPVASDKTTFHPNRTSSINPEHLSFFKFIGMIIGKAICDQCFLDCHFS 2985

Query: 667  DFFLKKLLNYSNGFLSSFSDLGSYDSVLYNNLIKLLNMTTDEIKSLDLTFEIDEPESSAK 726
                K +L    G   +  D+ S D   Y +LI +L     +I     + E D+     K
Sbjct: 2986 REVYKNIL----GKPVALKDMESLDLDYYKSLIWILENDITDIIEESFSVETDD-YGEHK 3040

Query: 727  VVDLIPNGSKTYVTKDNVLLYVTKVTDYKLNKRCFKPVSAFHGGLSVIIAPHWMEMFNSI 786
            V+DLI NG    VT+ N   YV K+ +YKL+    + +  F  G   II    + +F+  
Sbjct: 3041 VIDLIENGRNILVTEQNKQEYVKKIVEYKLHTSVKEQMDNFLLGFYAIIPKELVAIFDEQ 3100

Query: 787  ELQMLISGERDNIDLDDLKSNTEYGGYKEEDQTIVDFWEVXXXXXXXXXXXXXXXVTSVP 846
            EL++LISG  D ID+DD K+NT Y  Y    + I  FW                 VT   
Sbjct: 3101 ELELLISGLPD-IDVDDWKNNTNYVNYTPTCKQINYFWRAVRSFDSEERAKLLQFVTGTS 3159

Query: 847  QAPLQGFKALD-----PKFGIRNAGTEKYRLPTASTCVNLLKLPDYRNKTILR 894
            + PL GFK L       KF I        RLP++ TC N L LP Y +   LR
Sbjct: 3160 KVPLSGFKELTGVNGISKFSIHRDYGATDRLPSSHTCFNQLDLPAYDSYETLR 3212

>KLLA0E13607g 1198133..1200592 similar to sp|P39940 Saccharomyces
           cerevisiae YER125w RSP5 hect domain E3 ubiquitin-protein
           ligase, start by similarity
          Length = 819

 Score =  136 bits (343), Expect = 8e-33,   Method: Compositional matrix adjust.
 Identities = 104/340 (30%), Positives = 164/340 (48%), Gaps = 22/340 (6%)

Query: 558 ISRDNVLEDAFNAFNSIGERFKASLDVTFINEFGEEAGIDGGGITKEFLTTVSDEGFKDP 617
           + R N+ ED++     I  +    L    + +F  E G+D GG+++EF   +S E F +P
Sbjct: 469 VRRKNIFEDSYQ---EIMRQTPEDLKKRLMIKFDGEEGLDYGGVSREFFFLLSHEMF-NP 524

Query: 618 KHELFR--TNDRY--ELYPSVVYDATKLKYIWFLGKVVGKCLYEHVLIDVSFADFFLKKL 673
            + LF    +D Y  ++ P+   +   L Y  F+G+VVG  ++    +D  F     K +
Sbjct: 525 FYCLFEYSAHDNYTIQINPNSGINPEHLNYFKFIGRVVGLGVFHRRFLDAFFVGALYKMM 584

Query: 674 LNYSNGFLSSFSDLGSYDSVLYNNLIKLLNMTTDEIKSLDLTFEIDEPE-SSAKVVDLIP 732
           L           D+   DS +YN+L  +L  + D I  LDLTF +D+       VVDL P
Sbjct: 585 LRKK----VVLQDMEGVDSEVYNSLKWILENSIDGI--LDLTFNVDDERFGELVVVDLKP 638

Query: 733 NGSKTYVTKDNVLLYVTKVTDYKLNKRCFKPVSAFHGGLSVIIAPHWMEMFNSIELQMLI 792
           NG +  VT +N   YV   T +++  R  +   AF  G + ++    + +F+  EL++LI
Sbjct: 639 NGREIEVTDENKKEYVELYTQWRIADRVQEQFKAFMDGFNELVPEDLVNVFDERELELLI 698

Query: 793 SGERDNIDLDDLKSNTEYGGYKEEDQTIVDFWEVXXXXXXXXXXXXXXXVTSVPQAPLQG 852
            G  + ID++D K +T+Y GY+E D+ I  FW+                 T   + P+ G
Sbjct: 699 GGIAE-IDVEDWKKHTDYRGYQESDEVIQWFWKCITEWDNEQRARLLQFTTGTSRIPVNG 757

Query: 853 FKALDP-----KFGIRNAGTEKYRLPTASTCVNLLKLPDY 887
           FK L       +F I  AG E  +LP + TC N + LP Y
Sbjct: 758 FKDLQGSDGPRRFTIEKAG-EVQQLPKSHTCFNRVDLPPY 796

>ADL055C [1686] [Homologous to ScYER125W (RSP5) - SH]
           (584035..586488) [2454 bp, 817 aa]
          Length = 817

 Score =  133 bits (334), Expect = 1e-31,   Method: Compositional matrix adjust.
 Identities = 108/348 (31%), Positives = 165/348 (47%), Gaps = 22/348 (6%)

Query: 558 ISRDNVLEDAFNAFNSIGERFKASLDVTFINEFGEEAGIDGGGITKEFLTTVSDEGFKDP 617
           + R N+ EDA+     I  +    L    + +F  E G+D GG+++EF   +S E F +P
Sbjct: 467 VRRKNIFEDAYQ---EIMRQSPDDLKKRLMIKFDGEEGLDYGGVSREFFFLLSHEMF-NP 522

Query: 618 KHELFR--TNDRY--ELYPSVVYDATKLKYIWFLGKVVGKCLYEHVLIDVSFADFFLKKL 673
            + LF   ++D Y  ++ P+   +   L Y  F+G+VVG  ++    +D  F     K +
Sbjct: 523 FYCLFEYSSHDNYTIQINPNSGINPEHLNYFKFIGRVVGLGVFHRRFLDAFFVGALYKMM 582

Query: 674 LNYSNGFLSSFSDLGSYDSVLYNNLIKLLNMTTDEIKSLDLTFEIDEPESSAKV-VDLIP 732
           L           D+   DS +YN+L  +L  +   I  LDLTF  D+      V VDL P
Sbjct: 583 LRKK----VVLQDMEGVDSEVYNSLKWILENSIAGI--LDLTFSADDERFGEVVTVDLKP 636

Query: 733 NGSKTYVTKDNVLLYVTKVTDYKLNKRCFKPVSAFHGGLSVIIAPHWMEMFNSIELQMLI 792
           NG    VT DN   YV   T +K+  R      AF  G + +I    + +F+  EL++LI
Sbjct: 637 NGRNIDVTDDNKKEYVELFTQWKICSRVEDQFKAFIDGFNELIPEDLVNVFDERELELLI 696

Query: 793 SGERDNIDLDDLKSNTEYGGYKEEDQTIVDFWEVXXXXXXXXXXXXXXXVTSVPQAPLQG 852
            G  + ID++D K +T+Y GY+E D+ I  FW+                 T   + P+ G
Sbjct: 697 GGIAE-IDVEDWKKHTDYRGYQESDEVIKWFWKCISEWDNEQKARLLQFTTGTSRIPVNG 755

Query: 853 FKALDP-----KFGIRNAGTEKYRLPTASTCVNLLKLPDYRNKTILRE 895
           FK L       +F I  AG E  +LP + TC N + LP Y +   L++
Sbjct: 756 FKDLQGSDGPRRFTIEKAG-EVQQLPKSHTCFNRVDLPAYHDYDTLKQ 802

>YDR457W (TOM1) [1275] chr4 (1369778..1379584) Protein required for
            the G2/M transition, has similarity to Rsp5p, a
            ubiquitin-protein ligase (E3 enzyme) [9807 bp, 3268 aa]
          Length = 3268

 Score =  133 bits (335), Expect = 2e-31,   Method: Compositional matrix adjust.
 Identities = 106/350 (30%), Positives = 166/350 (47%), Gaps = 26/350 (7%)

Query: 558  ISRDNVLEDAFNA--FNSIGERFKASLDVTFINEFGEEAGIDGGGITKEFLTTVSDEGFK 615
            + R+ V  D++ A  F +  E   + L++TF  E    +G+D GG+T+E+   +S + F 
Sbjct: 2915 VRREQVFLDSYRALFFKTNDEIKNSKLEITFKGE----SGVDAGGVTREWYQVLSRQMF- 2969

Query: 616  DPKHELF--RTNDRYELYPSVV--YDATKLKYIWFLGKVVGKCLYEHVLIDVSFADFFLK 671
            +P + LF    +D+   +P+     +   L +  F+G ++GK + +   +D  F+    K
Sbjct: 2970 NPDYALFLPVPSDKTTFHPNRTSGINPEHLSFFKFIGMIIGKAIRDQCFLDCHFSREVYK 3029

Query: 672  KLLNYSNGFLSSFSDLGSYDSVLYNNLIKLL-NMTTDEIKSLDLTFEIDEPE-SSAKVVD 729
             +L    G   S  D+ S D   Y +L+ +L N  TD I+    TF ++  +    KV++
Sbjct: 3030 NIL----GRPVSLKDMESLDPDYYKSLVWILENDITDIIEE---TFSVETDDYGEHKVIN 3082

Query: 730  LIPNGSKTYVTKDNVLLYVTKVTDYKLNKRCFKPVSAFHGGLSVIIAPHWMEMFNSIELQ 789
            LI  G    VT+ N   YV KV +YKL     + +  F  G   +I+   + +F+  EL+
Sbjct: 3083 LIEGGKDIIVTEANKQDYVKKVVEYKLQTSVKEQMDNFLVGFYALISKDLITIFDEQELE 3142

Query: 790  MLISGERDNIDLDDLKSNTEYGGYKEEDQTIVDFWEVXXXXXXXXXXXXXXXVTSVPQAP 849
            +LISG  D ID+DD K+NT Y  Y    + +  FW                 VT   + P
Sbjct: 3143 LLISGLPD-IDVDDWKNNTTYVNYTATCKEVSYFWRAVRSFDAEERAKLLQFVTGTSKVP 3201

Query: 850  LQGFKALDP-----KFGIRNAGTEKYRLPTASTCVNLLKLPDYRNKTILR 894
            L GFK L       KF I        RLP++ TC N L LP Y +   LR
Sbjct: 3202 LNGFKELSGVNGVCKFSIHRDFGSSERLPSSHTCFNQLNLPPYESYETLR 3251

>Kwal_47.17302
          Length = 787

 Score =  131 bits (330), Expect = 3e-31,   Method: Compositional matrix adjust.
 Identities = 106/349 (30%), Positives = 169/349 (48%), Gaps = 24/349 (6%)

Query: 558 ISRDNVLEDAFNAFNSIGERFKASLDVTFINEFGEEAGIDGGGITKEFLTTVSDEGFKDP 617
           + R N+ EDA+     I  +    L    + +F  E G+D GG+++EF   +S E F +P
Sbjct: 437 VRRKNIFEDAYQ---EIMRQTPEDLKKRLMIKFDGEEGLDYGGVSREFFFLLSHEMF-NP 492

Query: 618 KHELFR--TNDRY--ELYPSVVYDATKLKYIWFLGKVVGKCLYEHVLIDVSFADFFLKKL 673
            + LF    +D Y  ++ P    +   L Y  F+G+VVG  ++    +D  F     K +
Sbjct: 493 FYCLFEYSAHDNYTIQINPKSGINPEHLNYFKFIGRVVGLGVFHRRFLDAFFVGALYKMM 552

Query: 674 LNYSNGFLSSFSDLGSYDSVLYNNLIKLLNMTTDEIKSLDLTFEIDEPESSAKV--VDLI 731
           L+          D+   D+ +YN+L  +L  + + +  LDLTF  D+ E+  +V  VDL 
Sbjct: 553 LHKK----VVLQDMEGVDAEVYNSLKWILENSIEGV--LDLTFSADD-ETFGEVMTVDLK 605

Query: 732 PNGSKTYVTKDNVLLYVTKVTDYKLNKRCFKPVSAFHGGLSVIIAPHWMEMFNSIELQML 791
           P+G    VT +N   YV   T +K   R  +   AF  G + +I    + +F+  EL++L
Sbjct: 606 PDGRNIEVTDENKKEYVELFTQWKTCSRVQEQFKAFMDGFNELIPEDLVNVFDERELELL 665

Query: 792 ISGERDNIDLDDLKSNTEYGGYKEEDQTIVDFWEVXXXXXXXXXXXXXXXVTSVPQAPLQ 851
           I G  + ID++D K +T+Y GY+E D+TI  FW+                 T   + P+ 
Sbjct: 666 IGGIAE-IDVEDWKKHTDYRGYQESDETIKWFWKAISEWDNEQKARLLQFTTGTSRIPVN 724

Query: 852 GFKALDP-----KFGIRNAGTEKYRLPTASTCVNLLKLPDYRNKTILRE 895
           GFK L       +F I  AG E  +LP + TC N + LP Y +   L++
Sbjct: 725 GFKDLQGSDGPRRFTIEKAG-EIQQLPKSHTCFNRVDLPPYDDYESLKQ 772

>YER125W (RSP5) [1555] chr5 (410185..412614) Essential
           ubiquitin-protein ligase (E3 enzyme), a member of HECT
           domain family of ligases, may be involved in the
           maintenance and remodeling of actin cytoskeleton during
           endocytosis [2430 bp, 809 aa]
          Length = 809

 Score =  130 bits (326), Expect = 1e-30,   Method: Compositional matrix adjust.
 Identities = 103/340 (30%), Positives = 161/340 (47%), Gaps = 22/340 (6%)

Query: 558 ISRDNVLEDAFNAFNSIGERFKASLDVTFINEFGEEAGIDGGGITKEFLTTVSDEGFKDP 617
           + R N+ EDA+     I  +    L    + +F  E G+D GG+++EF   +S E F +P
Sbjct: 459 VRRKNIFEDAYQ---EIMRQTPEDLKKRLMIKFDGEEGLDYGGVSREFFFLLSHEMF-NP 514

Query: 618 KHELFRTN--DRY--ELYPSVVYDATKLKYIWFLGKVVGKCLYEHVLIDVSFADFFLKKL 673
            + LF  +  D Y  ++ P+   +   L Y  F+G+VVG  ++    +D  F     K +
Sbjct: 515 FYCLFEYSAYDNYTIQINPNSGINPEHLNYFKFIGRVVGLGVFHRRFLDAFFVGALYKMM 574

Query: 674 LNYSNGFLSSFSDLGSYDSVLYNNLIKLLNMTTDEIKSLDLTFEIDEPESSAKV-VDLIP 732
           L           D+   D+ +YN+L  +L  + D +  LDLTF  D+      V VDL P
Sbjct: 575 LRKK----VVLQDMEGVDAEVYNSLNWMLENSIDGV--LDLTFSADDERFGEVVTVDLKP 628

Query: 733 NGSKTYVTKDNVLLYVTKVTDYKLNKRCFKPVSAFHGGLSVIIAPHWMEMFNSIELQMLI 792
           +G    VT  N   YV   T +++  R  +   AF  G + +I    + +F+  EL++LI
Sbjct: 629 DGRNIEVTDGNKKEYVELYTQWRIVDRVQEQFKAFMDGFNELIPEDLVTVFDERELELLI 688

Query: 793 SGERDNIDLDDLKSNTEYGGYKEEDQTIVDFWEVXXXXXXXXXXXXXXXVTSVPQAPLQG 852
            G  + ID++D K +T+Y GY+E D+ I  FW+                 T   + P+ G
Sbjct: 689 GGIAE-IDIEDWKKHTDYRGYQESDEVIQWFWKCVSEWDNEQRARLLQFTTGTSRIPVNG 747

Query: 853 FKALDP-----KFGIRNAGTEKYRLPTASTCVNLLKLPDY 887
           FK L       +F I  AG E  +LP + TC N + LP Y
Sbjct: 748 FKDLQGSDGPRRFTIEKAG-EVQQLPKSHTCFNRVDLPQY 786

>AER304C [2806] [Homologous to ScYDR457W (TOM1) - SH]
            (1194908..1204684) [9777 bp, 3258 aa]
          Length = 3258

 Score =  130 bits (328), Expect = 2e-30,   Method: Compositional matrix adjust.
 Identities = 106/354 (29%), Positives = 162/354 (45%), Gaps = 24/354 (6%)

Query: 553  KQSAIISRDNVLEDAFNAFNSIGERFKASLDVTFIN---EFGEEAGIDGGGITKEFLTTV 609
            K S  + R++V  D++ +       FK++ D+        F  EAG+D GGIT+E+   +
Sbjct: 2900 KLSISVRREHVFLDSYRSL-----FFKSNEDIKISKLEISFKGEAGVDAGGITREWYQVL 2954

Query: 610  SDEGFKDPKHELF--RTNDRYELYPSVV--YDATKLKYIWFLGKVVGKCLYEHVLIDVSF 665
            S + F +P + LF    +D+    P+     +   L +  F+G ++GK + +   +D  F
Sbjct: 2955 SRQMF-NPDYALFIPVASDKTTFRPNRTSGINPEHLSFFKFIGMIIGKAISDQCFLDCHF 3013

Query: 666  ADFFLKKLLNYSNGFLSSFSDLGSYDSVLYNNLIKLLNMTTDEIKSLDLTFEIDEPESSA 725
            +    K +L    G   +  D+ S D   Y +LI +L     +I     + E D+     
Sbjct: 3014 SREVYKNIL----GKPVALKDMESLDLDYYKSLIWILENDITDIIEETFSVETDD-YGEH 3068

Query: 726  KVVDLIPNGSKTYVTKDNVLLYVTKVTDYKLNKRCFKPVSAFHGGLSVIIAPHWMEMFNS 785
            KV++LI NG+   VT+ N   YV K+ +YKL       +  F  G   II    + +F+ 
Sbjct: 3069 KVIELIENGAHVAVTEQNKHDYVKKIVEYKLQTSVKDQMENFLQGFYAIIPKDLISIFDE 3128

Query: 786  IELQMLISGERDNIDLDDLKSNTEYGGYKEEDQTIVDFWEVXXXXXXXXXXXXXXXVTSV 845
             EL++L+SG  D ID+DD K+NT Y  Y    + I  FW                 VT  
Sbjct: 3129 QELELLVSGLPD-IDVDDWKNNTIYVNYTPTCKQINYFWRAVRSFDKEERAKLLQFVTGT 3187

Query: 846  PQAPLQGFKALD-----PKFGIRNAGTEKYRLPTASTCVNLLKLPDYRNKTILR 894
             + PL GFK L       KF I        RLP++ TC N L LP Y +   LR
Sbjct: 3188 SKVPLNGFKELSGVNGISKFSIHRDYGSIDRLPSSHTCFNQLDLPAYDSYETLR 3241

>Scas_627.2
          Length = 835

 Score =  127 bits (318), Expect = 1e-29,   Method: Compositional matrix adjust.
 Identities = 103/348 (29%), Positives = 164/348 (47%), Gaps = 22/348 (6%)

Query: 558 ISRDNVLEDAFNAFNSIGERFKASLDVTFINEFGEEAGIDGGGITKEFLTTVSDEGFKDP 617
           + R N+ EDA+     I  +    L    + +F  E G+D GG+++EF   +S E F +P
Sbjct: 485 VRRKNIFEDAYQ---EIMRQSPEDLKKRLMIKFDGEEGLDYGGVSREFFFLLSHEMF-NP 540

Query: 618 KHELFR--TNDRY--ELYPSVVYDATKLKYIWFLGKVVGKCLYEHVLIDVSFADFFLKKL 673
            + LF    +D Y  ++ P+   +   L Y  F+G+VVG  ++    +D  F     K +
Sbjct: 541 FYCLFEYSAHDNYTIQINPNSGINPEHLNYFKFIGRVVGLGVFHRRFLDAFFVGALYKMM 600

Query: 674 LNYSNGFLSSFSDLGSYDSVLYNNLIKLLNMTTDEIKSLDLTFEIDEPESSAKV-VDLIP 732
           L           D+   D+ +YN+L  +L  + D +  LDLTF  D+      V VDL  
Sbjct: 601 LRKK----VILQDMEGVDADVYNSLNWMLENSIDGV--LDLTFSADDERFGEVVTVDLKE 654

Query: 733 NGSKTYVTKDNVLLYVTKVTDYKLNKRCFKPVSAFHGGLSVIIAPHWMEMFNSIELQMLI 792
           NG    VT +N   YV     +K+  R  +   AF  G + +I    + +F+  EL++LI
Sbjct: 655 NGRDIEVTDENKKEYVELFAQWKIVDRVQEQFRAFMDGFNELIPEDLVTVFDERELELLI 714

Query: 793 SGERDNIDLDDLKSNTEYGGYKEEDQTIVDFWEVXXXXXXXXXXXXXXXVTSVPQAPLQG 852
            G  + ID++D K +T+Y GY+E D+ +  FW+                 T   + P+ G
Sbjct: 715 GGIAE-IDVEDWKKHTDYRGYQESDEVVKWFWKCISEWDNEQRARLLQFTTGTSRIPVNG 773

Query: 853 FKALDP-----KFGIRNAGTEKYRLPTASTCVNLLKLPDYRNKTILRE 895
           FK L       +F I  AG E  +LP + TC N + LP Y +   L++
Sbjct: 774 FKDLQGSDGPRRFTIEKAG-EAQQLPKSHTCFNRVDLPVYEDYDNLKQ 820

>CAGL0K02255g complement(199719..202187) highly similar to sp|P39940
           Saccharomyces cerevisiae YER125w Ubiquitin--protein
           ligase, start by similarity
          Length = 822

 Score =  124 bits (311), Expect = 8e-29,   Method: Compositional matrix adjust.
 Identities = 100/340 (29%), Positives = 162/340 (47%), Gaps = 22/340 (6%)

Query: 558 ISRDNVLEDAFNAFNSIGERFKASLDVTFINEFGEEAGIDGGGITKEFLTTVSDEGFKDP 617
           + R+N+ EDA+     I  +    L    + +F  E G+D GG+++EF   +S E F +P
Sbjct: 472 VRRNNIFEDAYQ---EIMRQTPEDLKKRLMIKFDGEEGLDYGGVSREFFFLLSHEMF-NP 527

Query: 618 KHELFR--TNDRY--ELYPSVVYDATKLKYIWFLGKVVGKCLYEHVLIDVSFADFFLKKL 673
            + LF    +D Y  ++  +   +   L Y  F+G+VVG  ++    +D  F     K +
Sbjct: 528 FYCLFEYSAHDNYTIQINSNSGINPEHLNYFKFIGRVVGLGVFHRRFLDAFFVGALYKMM 587

Query: 674 LNYSNGFLSSFSDLGSYDSVLYNNLIKLLNMTTDEIKSLDLTFEIDEPESSAKV-VDLIP 732
           L        +  D+   D+ +YN+L  +L  + D +  LDLTF  D+      V VDL P
Sbjct: 588 LRKK----VALQDMEGVDADVYNSLKWMLENSIDGV--LDLTFSADDERFGEVVTVDLKP 641

Query: 733 NGSKTYVTKDNVLLYVTKVTDYKLNKRCFKPVSAFHGGLSVIIAPHWMEMFNSIELQMLI 792
           +G    VT +    YV   + +++  R  +   AF  G + +I    + +F+  EL++LI
Sbjct: 642 DGRNIEVTDEVKKEYVELYSQWRIVDRVSEQFKAFMDGFNELIPEDLVTVFDERELELLI 701

Query: 793 SGERDNIDLDDLKSNTEYGGYKEEDQTIVDFWEVXXXXXXXXXXXXXXXVTSVPQAPLQG 852
            G  + ID++D K +T+Y GY+E D+ I  FW+                 T   + P+ G
Sbjct: 702 GGIAE-IDIEDWKKHTDYRGYQESDEVIQWFWKCVSEWDNEQRARLLQFTTGTSRIPVNG 760

Query: 853 FKALDP-----KFGIRNAGTEKYRLPTASTCVNLLKLPDY 887
           FK L       +F I  AG E  +LP + TC N + LP Y
Sbjct: 761 FKDLQGSDGPRRFTIEKAG-EVEQLPKSHTCFNRVDLPPY 799

>Kwal_34.16064
          Length = 849

 Score =  107 bits (266), Expect = 2e-23,   Method: Compositional matrix adjust.
 Identities = 96/351 (27%), Positives = 158/351 (45%), Gaps = 26/351 (7%)

Query: 558 ISRDNVLEDAFNAFNSIGERFKASLDVTFINEFGEEAGIDGGGITKEFLTTVSDEGFKDP 617
           + RD++ +D+     +     K SL +    EF +E GID GG+ KE+   ++ E F +P
Sbjct: 495 VRRDSITQDSLRCIETNLSDLKKSLKI----EFVDEPGIDAGGLRKEWFLLLTRELF-NP 549

Query: 618 KHELFRT--NDRYELYPSVVY---DATK---LKYIWFLGKVVGKCLYEHVLIDVSFADFF 669
            + LF      R+  + ++ Y   DA K    K  + LG V+G  +Y   ++D+SF    
Sbjct: 550 DNGLFTVIEESRFSWF-NIAYTDLDAGKENAHKLYFLLGVVLGLAIYNGTILDLSFPMAL 608

Query: 670 LKKLLNYSNGFLSSFSDLGSYDSVLYNNLIKLLNMTTDEIKSL-DLTFEIDEP---ESSA 725
            KK+     G     +D      +  NNL+KLL    D+ + +  LTFEI  P   ++  
Sbjct: 609 YKKM----KGEPLKRADFLQLYPISGNNLLKLLEYDNDDFEEIFSLTFEITYPGAWDTWL 664

Query: 726 KVVDLIPNGSKTYVTKDNVLLYVTKVTDYKLNKRCFKPVSAFHGGLSVIIAPHWMEMFNS 785
              +L   GS  +VT++N   Y+    D+ + +   +    F  G   ++  H  E+F  
Sbjct: 665 HKKELCSGGSTRHVTRENREEYINLWMDFHMTQAIGESFVNFSNGFQRVVDNHAFELFTP 724

Query: 786 IELQMLISGERDN-IDLDDLKSNTEYG-GYKEEDQTIVDFWEVXXXXXXXXXXXXXXXVT 843
            E+++L+ G  +  ID+  LKS T+Y  G   E + +   WE+               VT
Sbjct: 725 EEVELLLCGSHEKEIDVSVLKSVTKYSIGLNRESRIVQWLWEIIYMFSHAERCKLLEFVT 784

Query: 844 SVPQAPLQGFKALDPKFGIRNAGTEKYRLPTASTCVNLLKLPDYRNKTILR 894
              + P  G   +   F I   G +   LP A TC N L + +Y++   LR
Sbjct: 785 GSDRIPATGISTV--PFKITRLGPDSENLPLAHTCFNELCIYEYKSMEKLR 833

>AEL068W [2438] [Homologous to ScYJR036C (HUL4) - SH]
           complement(505311..507830) [2520 bp, 839 aa]
          Length = 839

 Score =  105 bits (261), Expect = 8e-23,   Method: Compositional matrix adjust.
 Identities = 90/357 (25%), Positives = 159/357 (44%), Gaps = 34/357 (9%)

Query: 558 ISRDNVLEDAFNAFNSIGERFKASLDVTFINEFGEEAGIDGGGITKEFLTTVSDEGFKDP 617
           + R+ V  D+  +  +  +  K SL + F+NE     GID GG+ KE+   ++ + F +P
Sbjct: 481 VRREFVTTDSLRSIQNQQKDLKKSLRIEFVNE----PGIDAGGLRKEWFLLLTRDLF-NP 535

Query: 618 KHELFRTNDR-----YELYPSVVYD-----ATKLKYIWFLGKVVGKCLYEHVLIDVSFAD 667
            + LF          + +  S+ ++      +  +  +  G V+G  +Y   ++D+ F  
Sbjct: 536 NNGLFVYVPESRLCWFSIMESIEHELLQGEGSSSELYYLFGVVLGLAIYNSTILDLKFPR 595

Query: 668 FFLKKLLN---YSNGFLSSFSDLGSYDSVLYNNLIKLLNMTTDEIKSL-DLTFEIDEP-- 721
            F KK+       N FL  + + G+       N++K+L    ++ + +  LTFE   P  
Sbjct: 596 AFYKKICGEVLSVNDFLELYPETGT-------NMLKMLEYDGEDFEDIFALTFETCFPDR 648

Query: 722 --ESSAKVVDLIPNGSKTYVTKDNVLLYVTKVTDYKLNKRCFKPVSAFHGGLSVIIAPHW 779
             ES      L P+GS   VT++N   Y     D+ LN+       +F  G   +I  + 
Sbjct: 649 FDESKIHYRQLCPDGSTQAVTRENKHEYFRLWMDFYLNRSIAPGFESFRNGFFHVIEGNS 708

Query: 780 MEMFNSIELQMLISGERD-NIDLDDLKSNTEY-GGYKEEDQTIVDFWEVXXXXXXXXXXX 837
             +F S EL+ L+ G  + ++D+  L+S T Y GG+ +    +  FWE+           
Sbjct: 709 FRLFGSEELEQLVCGSNEQSLDVSMLRSVTRYQGGFDDNSPVVQWFWEILSEMEYPQQRK 768

Query: 838 XXXXVTSVPQAPLQGFKALDPKFGIRNAGTEKYRLPTASTCVNLLKLPDYRNKTILR 894
               VT   + P  G   +  +     +G +  RLP + TC N + L +Y++K  LR
Sbjct: 769 LLHFVTGSDRVPATGVTTIPFRISRIRSGAD--RLPLSHTCFNEICLHEYKDKETLR 823

>KLLA0E22660g 2011000..2013420 similar to sp|P40985 Saccharomyces
           cerevisiae YJR036c HUL4 hect domain E3 ubiquitin-protein
           ligase, hypothetical start
          Length = 806

 Score =  100 bits (249), Expect = 2e-21,   Method: Compositional matrix adjust.
 Identities = 93/351 (26%), Positives = 150/351 (42%), Gaps = 26/351 (7%)

Query: 558 ISRDNVLEDAFNAFNSIGERFKASLDVTFINEFGEEAGIDGGGITKEFLTTVSDEGFKDP 617
           + R +V +D+  +        K SL V    EF  E GID GG+ KE+   ++ E F  P
Sbjct: 450 VRRSHVTQDSLTSIQRHPHDLKKSLRV----EFSNEPGIDAGGLKKEWFLLLTRELF-HP 504

Query: 618 KHELFRTNDRYELYPSVVYDATKLK--------YIWFLGKVVGKCLYEHVLIDVSFADFF 669
            H LF+  +   L     Y  T LK          +  G V+G  +Y   ++D+ FA   
Sbjct: 505 NHGLFQYVEESRL-SWFAYGNTGLKLHGENNNELYYLFGVVLGLAIYNSTILDLHFARAM 563

Query: 670 LKKLLNYSNGFLSSFSDLGSYDSVLYNNLIKLLNMTTDEIKSL-DLTFEIDEPESSAKV- 727
            KKL N       +F D          NL K+L+ +  +   +  L+FE    + ++ + 
Sbjct: 564 YKKLCNER----ITFEDYEELYPETARNLKKMLSYSELDFSDIFGLSFETTYYDVASGIN 619

Query: 728 --VDLIPNGSKTYVTKDNVLLYVTKVTDYKLNKRCFKPVSAFHGGLSVIIAPHW-MEMFN 784
               L   G    VT +N   +V +  ++ +N+      SAF  G + +I       MF 
Sbjct: 620 VTKPLCDGGESIPVTSENKTEFVERWVNFYMNEGVSSSFSAFQSGFTRVIGDGLAFPMFK 679

Query: 785 SIELQMLISGE-RDNIDLDDLKSNTEY-GGYKEEDQTIVDFWEVXXXXXXXXXXXXXXXV 842
           S E++ LI G    ++D + L++ T+Y GG+  +   +   WE+               V
Sbjct: 680 SCEVERLICGSIEQDMDFEQLRAVTKYQGGFHNQTPVVEWLWEILPQLSHEQQRQFLHFV 739

Query: 843 TSVPQAPLQGFKALDPKFGIRNAGTEKYRLPTASTCVNLLKLPDYRNKTIL 893
           T   + P+ G   L  K     +G+   +LPTA TC N L L +Y ++  L
Sbjct: 740 TGSDRVPVTGLATLPFKVTRTTSGSHD-QLPTAHTCFNELCLYEYESRDTL 789

>YJR036C (HUL4) [2932] chr10 complement(500627..503305) Putative
           ubiquitin-protein ligase [2679 bp, 892 aa]
          Length = 892

 Score = 90.9 bits (224), Expect = 2e-18,   Method: Compositional matrix adjust.
 Identities = 92/356 (25%), Positives = 156/356 (43%), Gaps = 37/356 (10%)

Query: 558 ISRDNVLEDAFNAFNSIGERFKASLDVTFINEFGEEAGIDGGGITKEFLTTVSDEGFKDP 617
           + RD +  D+             SL + F+NE     GID GG+ KE+   ++   F +P
Sbjct: 525 VRRDVISHDSLRCIKEHQGDLLKSLRIEFVNE----PGIDAGGLRKEWFFLLTKSLF-NP 579

Query: 618 KHELF-----RTNDRYELYPSVVYDATK-----LKYIWFLGKVVGKCLYEHVLIDVSFAD 667
            + LF      +   + + P   +D +K     L+  +  G V+G  ++   ++D+ F  
Sbjct: 580 MNGLFIYIKESSRSWFAIDPP-NFDKSKGKNSQLELYYLFGVVMGLAIFNSTILDLQFPK 638

Query: 668 FFLKKLLNYSNGFLSSFSDLGSYDSVLYNNLIKLLNMTTDEIKSL-DLTFE--------- 717
              KKL +       SF D          NLIK+LN T D  + +  LTFE         
Sbjct: 639 ALYKKLCSEP----LSFEDYSELFPETSRNLIKMLNYTEDNFEDVFSLTFETTYRNNNWI 694

Query: 718 IDEPESSAK--VVDLIPNGSKTYVTKDNVLLYVTKVTDYKLNKRCFKPVSAFHGGLSVII 775
           +++ +SS +   V+L  NG    +T+ N   +V K  ++ L K      + F  G   + 
Sbjct: 695 LNDSKSSKEYVTVELCENGRNVPITQSNKHEFVMKWVEFYLEKSIEPQYNKFVSGFKRVF 754

Query: 776 AP-HWMEMFNSIELQMLISG--ERDNIDLDDLKSNTEY-GGYKEEDQTIVDFWEVXXXXX 831
           A  + +++FNS EL+ L+ G  E+   D   L+S T+Y GG+ ++ + +  FWE+     
Sbjct: 755 AECNSIKLFNSEELERLVCGDEEQTKFDFKSLRSVTKYVGGFSDDSRAVCWFWEIIESWD 814

Query: 832 XXXXXXXXXXVTSVPQAPLQGFKALDPKFGIRNAGTEKYRLPTASTCVNLLKLPDY 887
                     VT+  + P  G   +  K  +  +  +   LP A TC N + L +Y
Sbjct: 815 YPLQKKLLQFVTASDRIPATGISTIPFKISLLGSH-DSDDLPLAHTCFNEICLWNY 869

>Scas_668.21
          Length = 1428

 Score = 87.0 bits (214), Expect = 4e-17,   Method: Compositional matrix adjust.
 Identities = 108/438 (24%), Positives = 171/438 (39%), Gaps = 67/438 (15%)

Query: 506  ELPFFIPFEERVDLFYMFIALDKKRL-----SLDDDHNLINMFTPWASTG-MRKQSAIIS 559
            E  F  PFE R+  F    +    RL     S + D  ++N        G M +    +S
Sbjct: 992  EYSFLFPFETRM-FFLQCTSFGYGRLIELWKSRNSDSKILNNDEQLQQLGRMVRHKLRVS 1050

Query: 560  RDNVLEDAFNAFNSIGERFKASLDVTFINEFGEEAGIDGGGITKEFLTTVSDEGFKDPKH 619
            R N+           G    + L++ +I+E G      G G T EF  ++S E  K+  H
Sbjct: 1051 RKNMFLTGLKIIGKYGSS-PSVLEIEYIDEVGS-----GLGPTLEFYASISKEFAKNSLH 1104

Query: 620  ELFRTND-----------------RYELYP----SVVYDATKLKYIWFLGKVVGKCLYEH 658
             L+R+ D                 +  L+P    S   +A  L+    LG  + + + + 
Sbjct: 1105 -LWRSEDFDKKANATDGESSSDYVKDLLFPAPLDSKCDNAKTLELFESLGTFIARSMLDS 1163

Query: 659  VLIDVSFADFFLK---------KLLNYSNGFLSSFSDLGSYDSVLYNNLIKLLNMTTDEI 709
             ++D  F   F +          LL+           L   D  L  +L  L +   D +
Sbjct: 1164 RILDFRFNKLFFELLHKRFTKVALLDNLGDLKGMLQMLSRVDEQLAKSLEYLYDHKDDSV 1223

Query: 710  --KSLDLTFEIDEPESSAKVVDLIPNGSKTYVTKDNVLLYVTKVTDYKLNKRCFKPVSAF 767
              ++L LTF +         ++LIP+G+ T+V   NV  ++ KV +  L +   K + AF
Sbjct: 1224 SLEALSLTFVL-----PGYNIELIPDGTNTFVNATNVEDFIQKVLESTLGRGIEKQLDAF 1278

Query: 768  HGGLSVIIAPHWMEMFNSIELQMLISGERDNIDLDDLKSNTEYG------GYKEEDQTIV 821
              G S +     + +    EL  L       ID +D  + T Y       GY  + QTI 
Sbjct: 1279 IDGFSKVFPYVALLILRPEELTELFG----RID-EDWSTETLYNCMNADHGYTMDSQTIH 1333

Query: 822  DFWEVXXXXXXXXXXXXXXXVTSVPQAPLQGFKALDPKFGI-----RNAGTEKYRLPTAS 876
            D   +               +T  P+ P+ GFK L PKF +      +  T    LP+  
Sbjct: 1334 DLISIVTQFTVQERRLFCQFLTGSPKLPIDGFKGLKPKFTVVLKHAEDGLTPDQYLPSVM 1393

Query: 877  TCVNLLKLPDYRNKTILR 894
            TC N LKLP Y ++ ++R
Sbjct: 1394 TCANYLKLPKYSSRDVMR 1411

>Kwal_26.7869
          Length = 1449

 Score = 84.3 bits (207), Expect = 3e-16,   Method: Compositional matrix adjust.
 Identities = 119/434 (27%), Positives = 170/434 (39%), Gaps = 74/434 (17%)

Query: 508  PFFIPFEERVDLFYM---------FIALDKKRLSLDDDHNLINMFTPWASTGMRKQSAI- 557
            PF  PFE R  +F++          I L K R       N +N        G   +  + 
Sbjct: 1026 PFLFPFETR--MFFLQSTSFGHGRLIQLWKNRTHT----NKVNGADTLHQLGRPTRHKLR 1079

Query: 558  ISRDNVLEDAFNAFNSIGERFKASLDVTFINEFGEEAGIDGGGITKEFLTTVSDEGFKDP 617
            +SRD++L  A       G      L++ + NE G      G G T EF   VS E F   
Sbjct: 1080 VSRDDLLLSAIKILTKYGSSPNI-LEIEYQNEVGT-----GLGPTLEFYAIVSKE-FARK 1132

Query: 618  KHELFRTNDRYE-----------LYPSVVYDATKLKYIW----FLGKVVGKCLYEHVLID 662
               L+R  D Y            LYP+ +  A   K I      LG  V + + +  L+D
Sbjct: 1133 SLGLWRC-DNYAFHDKTGFVEGLLYPAPLRAANDEKRILELFSQLGAFVSRSMLDDRLLD 1191

Query: 663  VSFADFFLKKLLNYSNGFLSSFSDL-------GSYDSVLYNNLIKLLNMTTDE-IKSLDL 714
              F   F +       G   SF+DL          D  L  +L  +L +  D+ I+SL L
Sbjct: 1192 FRFNRAFFELSHMRCRGETLSFADLEFALQYLDMVDPQLTKSLRYVLGLKNDQDIESLAL 1251

Query: 715  TFEIDEPESSAKVVDLIPNGSKTYVTKDNVLLYVTKVTDYKLNKRCFKPVSAFHGGLS-- 772
            TF +   +     V+L+ NG  T VT  N+  Y+ KV D  L     K +S+F  G S  
Sbjct: 1252 TFYLPGYD-----VELVENGKNTPVTASNLREYLEKVLDQVLGTGVEKQISSFIQGFSQA 1306

Query: 773  ------VIIAPHWM-EMFNSIELQMLISGERDNIDLDDLKSNTEYGGYKEEDQTIVDFWE 825
                  +I+ P  + ++F  IE           ID D         GY ++ + I +   
Sbjct: 1307 FPYSSLLILTPDELTKLFGRIEEDWTTGTLLSYIDADH--------GYNQDSEIIHNLVT 1358

Query: 826  VXXXXXXXXXXXXXXXVTSVPQAPLQGFKALDPKFGIRNAGTE-----KYRLPTASTCVN 880
            V               +T  P+ P+ GFK+L PK  +    TE        LP+  TC N
Sbjct: 1359 VMSSFTDSERRLFLQFLTGSPKLPIGGFKSLSPKLTVVRKHTEDNLEPDQYLPSVMTCAN 1418

Query: 881  LLKLPDYRNKTILR 894
             LKLP Y +  +LR
Sbjct: 1419 YLKLPKYSSLEVLR 1432

>CAGL0I01672g 138747..141323 similar to sp|P40985 Saccharomyces
           cerevisiae YJR036c HUL4 hect domain E3 ubiquitin-protein
           ligase, hypothetical start
          Length = 858

 Score = 83.6 bits (205), Expect = 4e-16,   Method: Compositional matrix adjust.
 Identities = 97/360 (26%), Positives = 143/360 (39%), Gaps = 35/360 (9%)

Query: 558 ISRDNVLEDAFNAFNS-IGERFKASLDVTFINEFGEEAGIDGGGITKEFLTTVSDEGFKD 616
           + R N+  D+  +     G+ FK SL V F+ E     GID GG+ KE+   ++   F D
Sbjct: 493 VRRSNISSDSLQSIKEHQGDLFK-SLKVEFVGE----PGIDAGGLRKEWFMLLTKTLF-D 546

Query: 617 PKHELFRTNDRYELY--------PSVVYDATKLKYIWFLGKVVGKCLYEHVLIDVSFADF 668
           P+  LF       L          + + D   ++  +  G V+   ++   ++++ F   
Sbjct: 547 PRTSLFVYVPESRLIWFSNSAQNEASIPDKETMELYYLFGVVMALAIFNSTILNLHFPKA 606

Query: 669 FLKKLLNYSNGFLSSFSDLGSYDSVLYNNLIKLLNMTTDEIKSL-----DLTFEIDEPES 723
             KK+     G    F D          NL KLL    D+   +     + TF  D  E 
Sbjct: 607 LYKKIC----GEPLKFDDYAEIYPETAQNLQKLLEYDGDDFSEVFALNFETTFINDMWEI 662

Query: 724 SAK------VVDLIPNGSKTYVTKDNVLLYVTKVTDYKLNKRCFKPVSAFHGGLS-VIIA 776
           + K       V+L  NG    VT  N   YV    D+ LNK        F  G   V   
Sbjct: 663 NPKNIKKYNTVELCANGKNMSVTSSNKEEYVKLWIDFYLNKNISTTFEKFLLGFKRVFSV 722

Query: 777 PHWMEMFNSIELQMLISGERDN--IDLDDLKSNTEYGGYKEEDQTIVD-FWEVXXXXXXX 833
              +++FN  ELQ L+ G++D    D   LKS T+Y G   E+  +   FWE+       
Sbjct: 723 SKSIKLFNFEELQRLVCGDQDTNKYDFGMLKSVTKYIGGMNENMPVAKWFWEIAQEWDIT 782

Query: 834 XXXXXXXXVTSVPQAPLQGFKALDPKFGIRNAGTEKYRLPTASTCVNLLKLPDYRNKTIL 893
                   VT     P  G   L  K  +  + ++  +LP A TC N L L  YR+K  L
Sbjct: 783 KQKKLMRFVTGSDGVPATGMSTLPFKLSLLGS-SDSDKLPIAHTCFNELCLWQYRSKEKL 841

>KLLA0B13585g 1186427..1190830 similar to sp|P33202 Saccharomyces
            cerevisiae YKL010c SOS1, start by similarity
          Length = 1467

 Score = 82.8 bits (203), Expect = 9e-16,   Method: Compositional matrix adjust.
 Identities = 109/423 (25%), Positives = 177/423 (41%), Gaps = 48/423 (11%)

Query: 509  FFIPFEERVDLF----YMFIALDKK-RLSLDDDHNLINMFTPWASTG-MRKQSAIISRDN 562
            F  PFE R++      Y +  L +  R  L D H+      P    G + +    +SRD+
Sbjct: 1041 FLFPFETRMNFLQNTSYGYGRLIQYWREKLADQHHSNPTENPLHQLGRLTRHKLRVSRDS 1100

Query: 563  VLEDAFNAFNSIGERFKASLDVTFINEFGEEAGIDGGGITKEFLTTVSDEGFKDPKHELF 622
            +    F +   I +++ +S +V  I E+ +E G  G G T EF + +S E F     +++
Sbjct: 1101 L----FLSGIKILKKYGSSPNVLEI-EYKDEEGT-GLGPTLEFYSLMSKE-FARKSLKMW 1153

Query: 623  RTN-----DRYE-----LYPSVVYDATK------LKYIWFLGKVVGKCLYEHVLIDVSFA 666
            +TN     D  E     L+P  +   T+      LK    LG +V + + ++ ++D  F 
Sbjct: 1154 KTNSDTSDDEEEYVTGALFPGPLLGTTEENNEKTLKLFENLGTLVARSMLDNRILDFRFN 1213

Query: 667  DFFLKKLLNYSNG-------FLSSFSDLGSYDSVLYNNLIKLL-NMTTDEIKSLDLTFEI 718
              F + +             F +    +G +D  L  +L  L  N   D IK+LDL F +
Sbjct: 1214 AVFFELMHKCCKNDRLDLEDFETCIHLVGQFDVQLGKSLAFLYDNRHDDSIKNLDLYFML 1273

Query: 719  DEPESSAKVVDLIPNGSKTYVTKDNVLLYVTKVTDYKLNKRCFKPVSAFHGGLSVIIAPH 778
                     ++L+  GSK  V   NV  Y+ +V D  L K     ++AF  G S      
Sbjct: 1274 -----PGYDIELLEGGSKILVESFNVEEYLIRVFDQFLGKGVDMQLAAFRNGFSKSFPYS 1328

Query: 779  WMEMFNSIELQMLISGERDNIDLDDLKSNTEYG-GYKEEDQTIVDFWEVXXXXXXXXXXX 837
             + +    EL  L     ++  +  L S+     GY  +   I D  ++           
Sbjct: 1329 SLLILTPTELSDLFGAVAEDWSVQTLYSSIHADHGYSMDSPIITDLIDILSNFSTQQKRL 1388

Query: 838  XXXXVTSVPQAPLQGFKALDPKFGI-----RNAGTEKYRLPTASTCVNLLKLPDYRNKTI 892
                +T  P+ PL GFK L PKF +         +  + LP+  TC N LKLP Y +K +
Sbjct: 1389 FLQFITGSPKLPLGGFKNLKPKFTVVLKHPDGNISADHCLPSVMTCANYLKLPKYSDKLV 1448

Query: 893  LRE 895
            L++
Sbjct: 1449 LKD 1451

>Sklu_2101.2 YGL141W, Contig c2101 1350-2581
          Length = 411

 Score = 79.0 bits (193), Expect = 4e-15,   Method: Compositional matrix adjust.
 Identities = 101/408 (24%), Positives = 167/408 (40%), Gaps = 29/408 (7%)

Query: 2   LNFTGQTRRRNVNLGNRTRNSXXXXXXXXXXXXXXXXXXXLKEDASKTIQKSIRRHFSNV 61
           +NFTGQT+RRN+NLG+++R S                     ED++  IQ SIR H    
Sbjct: 1   MNFTGQTKRRNINLGSKSRKSKEELLLNAKKERERRAIERRNEDSATRIQSSIRSHLVTR 60

Query: 62  RLFKNTF---TSSQLVHMIPAYGGKLIYYISQYDLQQLLKLSHNFLSSYPNSLGNRQLLS 118
           +L  +     T+     ++ AY  ++ Y    YD      L H+  +  P  + N +L  
Sbjct: 61  KLLLDLISHPTADSATAILIAYTPRMYY---MYDQHLTATLIHSIRNDRP--IVNIKLAQ 115

Query: 119 LLKL--YQD--DALVAETLSDLNMDCPTVDEFLDSL-SVYLCRASFLSYSSASKLADVIE 173
           LL++  Y D  + L    LS  N   P  + F +++  + L     LS     ++  +++
Sbjct: 116 LLQVVGYFDISEELTELVLSKFNTKYPLTNHFYEAVVGLLLNSTKNLSKWVMDRVMQLLK 175

Query: 174 AWEVMHXXXXXXXXXXXXXXYEKRPFALQFYCILAER---NLLPQLINTNPILWDNMAKT 230
             +                        L+F   L       L   + +   IL +N+A  
Sbjct: 176 VLDEESNHYVTSLFAIDTSKTRHLDNNLRFLSQLGSVFYPELTANIKSNKSILLENLAFI 235

Query: 231 YSHCSKGGQKNIAKLLIPNFNNHIAP-SVLRSDNDYVLKFYEKAFIDEVIATTANYVSDE 289
           Y+     G++   + ++        P     S ++Y    Y K F+D ++    NY S +
Sbjct: 236 YAQSKDEGREVFGRCILEYLIESSGPYKATSSLSNYFHGLYSKDFLDFLV----NY-SSQ 290

Query: 290 DHVKNLMCYIASSPNQSCKNSVLITLLSNKDFVRRLSWEFFHT--KF---NASKTEAHPL 344
           +    +  +I SSP+   KN+VLI L+S    ++ ++     T  KF   +   TE    
Sbjct: 291 NQAGYISAFIKSSPDDVSKNNVLIWLISKAGLMKNINKNLMRTNEKFQDLDQKTTEEDLF 350

Query: 345 FSVLAQLIDMHLLISTDRELLDYNSVIPIEELKKFTSTLKDFTFRQYW 392
             +     D  L +S+D ELL      PIE L++FTS LK   F   W
Sbjct: 351 LLLHLLKND--LSVSSDYELLHNIDTYPIENLQEFTSRLKGMVFDCLW 396

>YKL010C (UFD4) [3246] chr11 complement(421067..425518)
            Ubiquitin-protein ligase (E3 enzyme) functioning in
            ubiquitin fusion degradation pathway [4452 bp, 1483 aa]
          Length = 1483

 Score = 78.6 bits (192), Expect = 2e-14,   Method: Compositional matrix adjust.
 Identities = 109/433 (25%), Positives = 173/433 (39%), Gaps = 62/433 (14%)

Query: 508  PFFIPFEERVDLFYMFIALDKKRL------SLDDDHNLINMFTPWASTGMRKQSAIISRD 561
            PF  PF+ R+ LF    +    RL            +L N         + ++   ISR 
Sbjct: 1050 PFLFPFDTRM-LFLQCTSFGYGRLIQLWKNKSKGSKDLRNDEALQQLGRITRRKLRISRK 1108

Query: 562  NVLEDAFNAFNSIGERFKASLDVTFINEFGEEAGIDGGGITKEFLTTVSDEGFKDPKHEL 621
             +        +  G    +S DV  I E+ EEAG  G G T EF + VS + F      +
Sbjct: 1109 TIFATGLKILSKYG----SSPDVLEI-EYQEEAGT-GLGPTLEFYSVVS-KYFARKSLNM 1161

Query: 622  FRTNDRYELYPSVVYDATK---------------------LKYIWFLGKVVGKCLYEHVL 660
            +R N  Y     +  D T                      ++   +LG  V + L ++ +
Sbjct: 1162 WRCNS-YSYRSEMDVDTTDDYITTLLFPEPLNPFSNNEKVIELFGYLGTFVARSLLDNRI 1220

Query: 661  IDVSFADFFLKKLLNYSNGFLSSF-SDLGS-------YDSVLYNNLIKLL-----NMTTD 707
            +D  F+  F + L   S   +++  SD+ +        D +L  +L  ++     NMT  
Sbjct: 1221 LDFRFSKVFFELLHRMSTPNVTTVPSDVETCLLMIELVDPLLAKSLKYIVANKDDNMT-- 1278

Query: 708  EIKSLDLTFEIDEPESSAKVVDLIPNGSKTYVTKDNVLLYVTKVTDYKLNKRCFKPVSAF 767
             ++SL LTF +   +     ++LIP G    +   NV  Y+  V D  L K   K + AF
Sbjct: 1279 -LESLSLTFTVPGNDD----IELIPGGCNKSLNSSNVEEYIHGVIDQILGKGIEKQLKAF 1333

Query: 768  HGGLSVIIAPHWMEMFNSIELQMLISGERDNIDLDDLKSN-TEYGGYKEEDQTIVDFWEV 826
              G S + +   M +    EL  +     ++  +  L +N     GY  +   I DF  +
Sbjct: 1334 IEGFSKVFSYERMLILFPDELVDIFGRVEEDWSMATLYTNLNAEHGYTMDSSIIHDFISI 1393

Query: 827  XXXXXXXXXXXXXXXVTSVPQAPLQGFKALDPKFGI-----RNAGTEKYRLPTASTCVNL 881
                           +T  P+ P+ GFK+L+PKF +      +  T    LP+  TC N 
Sbjct: 1394 ISAFGKHERRLFLQFLTGSPKLPIGGFKSLNPKFTVVLKHAEDGLTADEYLPSVMTCANY 1453

Query: 882  LKLPDYRNKTILR 894
            LKLP Y +K I+R
Sbjct: 1454 LKLPKYTSKDIMR 1466

>Scas_549.3
          Length = 842

 Score = 77.8 bits (190), Expect = 2e-14,   Method: Compositional matrix adjust.
 Identities = 90/362 (24%), Positives = 148/362 (40%), Gaps = 36/362 (9%)

Query: 558 ISRDNVLEDAFNAFNSIGERFKASLDVTFINEFGEEAGIDGGGITKEFLTTVSDEGFKDP 617
           + R+ +  D+             SL V FINE     GID GG+ KE+   ++   F +P
Sbjct: 476 VRRERITNDSLKCIRQHQGDLLKSLRVEFINE----PGIDAGGLKKEWFLLLTKSLF-NP 530

Query: 618 KHELFRTNDRYELYPSVVY-------DATKLKYIWFL-GKVVGKCLYEHVLIDVSFADFF 669
            + LF+  +   L    +        D    K +++L G V+   L+   ++D+ F    
Sbjct: 531 MNGLFKYLEDSRLSWFAIQPICEEESDIESQKELYYLFGVVLALALFNSTILDLKFPKAL 590

Query: 670 LKKLLNYSNGFLSSFSDLGSYDSVLYNNLIKLLNMTTDEIKSL----------DLTFEI- 718
            KKL         +F D          NL K+L+    + + L          D T  I 
Sbjct: 591 YKKLCKEP----LNFEDYRELYPETAKNLEKMLSYPGKDFEDLFCLSFTTTYQDATLGIF 646

Query: 719 -DEPESSAKVVDLIPNGSKTYVTKDNVLLYVTKVTDYKLNKRCFKPVSAFHGGLSVIIAP 777
             + ++    V+L   G    VT++N   +V    D+ L K        F  G + +   
Sbjct: 647 GSQSQTDKVTVELCKGGKGINVTQENKQRFVDLWVDFYLTKSISNSFDHFQTGFNRVCGK 706

Query: 778 HW-MEMFNSIELQMLISGE--RDNIDLDDLKSNTEYGGYKEEDQTIVD-FWEVXXXXXXX 833
            + + +F+S EL+ L+ G+  ++N D   L+S T+YGG   +   IV+ FW++       
Sbjct: 707 CYSISLFDSDELEKLVCGDEGKENYDFKILRSITKYGGGFNDQSKIVEWFWKIVESWSNQ 766

Query: 834 XXXXXXXXVTSVPQAPLQGFKALDPKFGIRNAGT-EKYRLPTASTCVNLLKLPDYRNKTI 892
                   VT   + P  G   L   F +   GT +K  LP + TC N L L +Y  +  
Sbjct: 767 LQRKLLLFVTGSDRIPATGISTLP--FKVTRLGTKDKEDLPLSHTCFNELCLWEYTTEEK 824

Query: 893 LR 894
           L+
Sbjct: 825 LK 826

>ABR013W [604] [Homologous to ScYKL010C (UFD4) - SH]
            complement(412721..416995) [4275 bp, 1424 aa]
          Length = 1424

 Score = 61.2 bits (147), Expect = 4e-09,   Method: Compositional matrix adjust.
 Identities = 49/173 (28%), Positives = 73/173 (42%), Gaps = 8/173 (4%)

Query: 729  DLIPNGSKTYVTKDNVLLYVTKVTDYKLNKRCFKPVSAFHGGLSVIIAPHWMEMFNSIEL 788
            DL+  G+ T VT  N  LYV +V D  L     + + AF  G S       + +    EL
Sbjct: 1236 DLVEGGANTPVTAANAELYVARVLDAFLGSGVRQQLRAFMKGFSRAFPYSSLLVLTPDEL 1295

Query: 789  QMLISGERDNIDLDDLKSN-TEYGGYKEEDQTIVDFWEVXXXXXXXXXXXXXXXVTSVPQ 847
              L     ++  ++ L S  T   GY  +  T+ D   V               +T  P+
Sbjct: 1296 SELYGRVEEDWSVETLYSYITADHGYSMDSPTLHDLIAVMAAFDQHHRRLFLQFLTGSPK 1355

Query: 848  APLQGFKALDPKFGI------RNAGTEKYRLPTASTCVNLLKLPDYRNKTILR 894
             P+ GFK L P   +       +   ++Y LP+  TC N LKLP Y ++ +LR
Sbjct: 1356 LPVGGFKNLKPHLTVVLKHPEGDLSPDQY-LPSVMTCANYLKLPKYSSREVLR 1407

>CAGL0M10175g complement(1014414..1018844) similar to sp|P33202
            Saccharomyces cerevisiae YKL010c Ubiquitin fusion
            degradation protein 4, hypothetical start
          Length = 1476

 Score = 57.4 bits (137), Expect = 6e-08,   Method: Compositional matrix adjust.
 Identities = 108/445 (24%), Positives = 168/445 (37%), Gaps = 70/445 (15%)

Query: 506  ELPFFIPFEERVDLFYMFIALDKKRL-----SLDDDHNLINMFTPWASTG-MRKQSAIIS 559
            E  F  PFE R+      I+ D+ RL     S  D  + IN        G + +    I 
Sbjct: 1031 EFSFLFPFETRM-FALQCISFDQGRLIQLWKSRVDSSSKINTDEQLEHLGRVVRHKLRIP 1089

Query: 560  RDNVLEDAFNAFNSIGERFKAS---LDVTFINEFGEEAGIDGGGITKEFLTTVS------ 610
            R    +D F+    + +RF      ++V +I+E G      G G T EF   +S      
Sbjct: 1090 R----KDMFSTGVKVLKRFGGDSTVMEVEYIDEVGT-----GLGPTLEFYAIISKEFARK 1140

Query: 611  --------DEGFKDPKHELFRTNDRYELY------PSVVYDATK-----LKYIWFLGKVV 651
                    D+  K         N   E+Y      P+ +    K     L     LG  V
Sbjct: 1141 SLNMWHCLDDNMKHVADGTPNDNTMSEVYVLNPLFPAPMIPEEKKRDEVLDLFNQLGVFV 1200

Query: 652  GKCLYEHVLIDVSFADFF------------LKKLLNYSNGFLSSFSDLGSYDSVLYNNLI 699
             + LY++ ++D  F   F            L  L   S+      S L + DS L  +L 
Sbjct: 1201 ARSLYDNRILDFRFNPVFFMLCHAITKNEGLSTLTLDSDQVYQQLSILANIDSQLAASLR 1260

Query: 700  KLLNMTTDE--IKSLDLTFEIDEPESSAKVVDLIPNGSKTYVTK-DNVLLYVTKVTDYKL 756
             + N  T+   IKSL LTF +          +L+ +G+   V    +V  Y++ V D  L
Sbjct: 1261 YIYNNRTNTPLIKSLSLTFTL-----PGYNFELVEHGNDHAVDDLTSVEKYISLVLDMFL 1315

Query: 757  NKRCFKPVSAFHGGLSVIIAPHWMEMFNSIELQMLISGERDNIDLDDLKSN-TEYGGYKE 815
                   +++F  G S +     M +F+  E+  L     ++   + L +      GY  
Sbjct: 1316 GTGIAPQLNSFIDGFSRLFPYKNMLLFSPNEIADLFGRVEEDWSPETLFTYLVADHGYTM 1375

Query: 816  EDQTIVDFWEVXXXXXXXXXXXXXXXVTSVPQAPLQGFKALDPKFGIRNAGTEKYR---- 871
            +  TI D   +               +T  P+ PL GFK+L PK  +     E       
Sbjct: 1376 DSPTIRDLISIISTFDNQEKRMFLQFLTGSPKLPLGGFKSLKPKLTVVLKHAEDGLQPDD 1435

Query: 872  -LPTASTCVNLLKLPDYRNKTILRE 895
             LP+  TC N LKLP Y ++ ++R+
Sbjct: 1436 YLPSVMTCANYLKLPKYSSREVMRQ 1460

>Scas_481.5
          Length = 416

 Score = 30.8 bits (68), Expect = 5.2,   Method: Compositional matrix adjust.
 Identities = 21/59 (35%), Positives = 33/59 (55%), Gaps = 5/59 (8%)

Query: 536 DHNLINMFTPWASTGMRKQSAII---SRDNVLEDAFNAFNSIGERFKA--SLDVTFINE 589
           D NL+N     A TG +K++A I    R+  LE+A  +  S+ +RF    + D TF+N+
Sbjct: 66  DDNLMNAKMEIAETGSQKENATILMLVRNWELEEALGSMRSLEDRFDKHFAYDWTFLND 124

  Database: blastdb
    Posted date:  Apr 3, 2006  3:33 PM
  Number of letters in database: 16,596,109
  Number of sequences in database:  34,618
  
Lambda     K      H
   0.320    0.136    0.399 

Gapped
Lambda     K      H
   0.267   0.0410    0.140 

Matrix: BLOSUM62
Gap Penalties: Existence: 11, Extension: 1
Number of Sequences: 34618
Number of Hits to DB: 28,087,926
Number of extensions: 1232669
Number of successful extensions: 3819
Number of sequences better than 10.0: 39
Number of HSP's gapped: 3848
Number of HSP's successfully gapped: 48
Length of query: 895
Length of database: 16,596,109
Length adjustment: 111
Effective length of query: 784
Effective length of database: 12,753,511
Effective search space: 9998752624
Effective search space used: 9998752624
Neighboring words threshold: 11
Window for multiple hits: 40
X1: 16 ( 7.4 bits)
X2: 38 (14.6 bits)
X3: 64 (24.7 bits)
S1: 41 (21.8 bits)
S2: 66 (30.0 bits)