Hit NameLength (aa)HSP LengthHSP ScoreHSP Significance
YGL082W38137520080.0
Scas_720.1440334910351e-139
Kwal_56.239543773669341e-124
CAGL0H03289g3853688051e-105
KLLA0E19371g3483338011e-105
AFL071C3513367616e-99
YPL191C3603767141e-91
Scas_611.4*2992656142e-77
CAGL0G09251g3633954871e-57
KLLA0D01507g51548710.89
Kwal_27.1165560567682.0
Scas_468.265160672.6
Kwal_26.9488580137654.1
KLLA0E10593g28070654.2
YGR117C47629654.3
KLLA0D16478g28432636.8
Scas_615.359077638.1
KLLA0C12485g92576638.7
AFL015C33560629.9
BLASTP 2.2.26 [Sep-21-2011]

Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, 
Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), 
"Gapped BLAST and PSI-BLAST: a new generation of protein database search
programs",  Nucleic Acids Res. 25:3389-3402.

Reference for compositional score matrix adjustment: Altschul, Stephen F., 
John C. Wootton, E. Michael Gertz, Richa Agarwala, Aleksandr Morgulis,
Alejandro A. Schaffer, and Yi-Kuo Yu (2005) "Protein database searches
using compositionally adjusted substitution matrices", FEBS J. 272:5101-5109.

Query= YGL082W
         (375 letters)

Database: blastdb 
           34,618 sequences; 16,596,109 total letters

Searching..................................................done

                                                                 Score    E
Sequences producing significant alignments:                      (bits) Value

YGL082W (YGL082W) [1900] chr7 (355828..356973) Member of the DUF...   778   0.0  
Scas_720.14                                                           403   e-139
Kwal_56.23954                                                         364   e-124
CAGL0H03289g 309091..310248 similar to sp|P53155 Saccharomyces c...   314   e-105
KLLA0E19371g 1718449..1719495 similar to sp|P53155 Saccharomyces...   313   e-105
AFL071C [3122] [Homologous to ScYGL082W - SH; ScYPL191C - SH] (3...   297   6e-99
YPL191C (YPL191C) [5256] chr16 complement(183596..184678) Member...   279   1e-91
Scas_611.4*                                                           241   2e-77
CAGL0G09251g complement(882028..883119) similar to sp|Q08930 Sac...   192   1e-57
KLLA0D01507g 133636..135183 some similarities with sp|Q9N2D4 Cal...    32   0.89 
Kwal_27.11655                                                          31   2.0  
Scas_468.2                                                             30   2.6  
Kwal_26.9488                                                           30   4.1  
KLLA0E10593g 935625..936467 no similarity, hypothetical start          30   4.2  
YGR117C (YGR117C) [2074] chr7 complement(725051..726481) Protein...    30   4.3  
KLLA0D16478g complement(1391173..1392027) weakly similar to sgd|...    29   6.8  
Scas_615.3                                                             29   8.1  
KLLA0C12485g 1060167..1062944 weakly similar to sp|Q12236 Saccha...    29   8.7  
AFL015C [3178] [Homologous to ScYGL115W (SNF4) - SH] (407482..40...    28   9.9  

>YGL082W (YGL082W) [1900] chr7 (355828..356973) Member of the DUF544
           protein of unknown function family, has moderate
           similarity to uncharacterized S. cerevisiae Ypl191p
           [1146 bp, 381 aa]
          Length = 381

 Score =  778 bits (2008), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 375/375 (100%), Positives = 375/375 (100%)

Query: 1   MDVTFLTKNVQINGTQFKILLQNGQGECALIALANVLLISPAHARYAQEISRLVRGKETV 60
           MDVTFLTKNVQINGTQFKILLQNGQGECALIALANVLLISPAHARYAQEISRLVRGKETV
Sbjct: 1   MDVTFLTKNVQINGTQFKILLQNGQGECALIALANVLLISPAHARYAQEISRLVRGKETV 60

Query: 61  TLNELVQTLADMGVQNPNGTDVDKQQLLQILPQLYSGLNINPEFNGSFEDGVEMSIFRLY 120
           TLNELVQTLADMGVQNPNGTDVDKQQLLQILPQLYSGLNINPEFNGSFEDGVEMSIFRLY
Sbjct: 61  TLNELVQTLADMGVQNPNGTDVDKQQLLQILPQLYSGLNINPEFNGSFEDGVEMSIFRLY 120

Query: 121 NVGIVHGWIIDGDNDPNSYEHVSKYSYMGAQKVLVQSYEIQKNNAQFENSEQIQSDAPYL 180
           NVGIVHGWIIDGDNDPNSYEHVSKYSYMGAQKVLVQSYEIQKNNAQFENSEQIQSDAPYL
Sbjct: 121 NVGIVHGWIIDGDNDPNSYEHVSKYSYMGAQKVLVQSYEIQKNNAQFENSEQIQSDAPYL 180

Query: 181 KSFLARSATQLTEYGLTHLREILVERSYAVLFRNDHFCTLYKNNGELFTLVTDPTYRNRK 240
           KSFLARSATQLTEYGLTHLREILVERSYAVLFRNDHFCTLYKNNGELFTLVTDPTYRNRK
Sbjct: 181 KSFLARSATQLTEYGLTHLREILVERSYAVLFRNDHFCTLYKNNGELFTLVTDPTYRNRK 240

Query: 241 DINWQSLKSVNGSQDSYYTGNFIPTSLERTETTATGQNESYISNPFSDQNTGHVTSNQVN 300
           DINWQSLKSVNGSQDSYYTGNFIPTSLERTETTATGQNESYISNPFSDQNTGHVTSNQVN
Sbjct: 241 DINWQSLKSVNGSQDSYYTGNFIPTSLERTETTATGQNESYISNPFSDQNTGHVTSNQVN 300

Query: 301 SGASGVQQIEDDEELARRLQEQEDMRAANNMQNGYANNGRNHQRERFERPEKNSKKNKFL 360
           SGASGVQQIEDDEELARRLQEQEDMRAANNMQNGYANNGRNHQRERFERPEKNSKKNKFL
Sbjct: 301 SGASGVQQIEDDEELARRLQEQEDMRAANNMQNGYANNGRNHQRERFERPEKNSKKNKFL 360

Query: 361 PFNGSNKEKKRDKLK 375
           PFNGSNKEKKRDKLK
Sbjct: 361 PFNGSNKEKKRDKLK 375

>Scas_720.14
          Length = 403

 Score =  403 bits (1035), Expect = e-139,   Method: Compositional matrix adjust.
 Identities = 214/349 (61%), Positives = 262/349 (75%), Gaps = 14/349 (4%)

Query: 1   MDVTFLTKNVQINGTQFKILLQNGQGECALIALANVLLISPAHARYAQEISRLVRGKET- 59
           M   F TK V INGTQ KILL+N QG  AL+AL NVLL+SP   + A E+ +LV      
Sbjct: 1   MSQGFQTKTVDINGTQHKILLENEQGPTALVALTNVLLLSPGLQQTAYELIQLVNNASNN 60

Query: 60  -VTLNELVQTLADMGVQNPN-GTDVDKQQLLQILPQLYSGLNINPEFNGSFEDGVEMSIF 117
            V+ NEL+Q L+ +G+QN N  ++++ +QL+Q LPQL SGLN+NP FNGSFEDG+EMS+F
Sbjct: 61  FVSWNELLQVLSRVGLQNHNYVSNLNNEQLVQYLPQLQSGLNVNPGFNGSFEDGIEMSLF 120

Query: 118 RLYNVGIVHGWIIDGDNDPNSYEHVSKYSYMGAQKVLVQSYEIQKNNAQFENSEQIQSDA 177
           RL+NVGIVHGWIIDGDNDP +Y+HV++Y+Y  AQ++LVQSY+I+KNN Q +N + I  DA
Sbjct: 121 RLFNVGIVHGWIIDGDNDPVAYDHVARYTYESAQRLLVQSYDIKKNNLQVDNKDLILEDA 180

Query: 178 PYLKSFLARSATQLTEYGLTHLREILVERSYAVLFRNDHFCTLYKNNGELFTLVTDPTYR 237
            Y+KSFLARSATQLTEYGL HL+EILVER +AVLFRN+ + TLYKNNG+L+TLVTD  +R
Sbjct: 181 NYIKSFLARSATQLTEYGLKHLKEILVERGFAVLFRNEVYVTLYKNNGQLYTLVTDLQHR 240

Query: 238 NRKDINWQSLKSVNGSQDSYYTGNFIPTSLERT-----ETTATGQN---ESYISNPFSDQ 289
           N  DI WQSLKSVNG+QDSYYTGNFI TSLERT        A  QN   ES +SNPFSDQ
Sbjct: 241 NDTDIIWQSLKSVNGTQDSYYTGNFISTSLERTNGYGPPQAAALQNPQIESVVSNPFSDQ 300

Query: 290 N-TGHVTSNQVNSGASGV--QQIEDDEELARRLQEQEDMRAANNMQNGY 335
           N T    +  V +       QQ+E DEELARRLQ++ED RAA+NMQ  Y
Sbjct: 301 NQTSRQRTQPVETFHEDTRGQQLETDEELARRLQDEEDSRAADNMQGSY 349

>Kwal_56.23954
          Length = 377

 Score =  364 bits (934), Expect = e-124,   Method: Compositional matrix adjust.
 Identities = 193/366 (52%), Positives = 246/366 (67%), Gaps = 15/366 (4%)

Query: 1   MDVTFLTKNVQINGTQFKILLQNGQGECALIALANVLLISPAHARYAQEISRLVRGKETV 60
           M + F+ K V ING   +ILLQN  G CALIAL NVLL+SP  ARYA  +++LV  K  V
Sbjct: 1   MSLMFVVKGVDINGCSHRILLQNENGPCALIALCNVLLLSPQCARYAGPLTQLVANKSEV 60

Query: 61  TLNELVQTLADMGVQNPNGTDVDKQQLLQILPQLYSGLNINPEFNGSFEDGVEMSIFRLY 120
            L EL+  LA++GVQ P G  +D  +LLQ LPQL++GL+INP FNGSFEDG EM++FRL+
Sbjct: 61  ALRELITILANIGVQIPQGAQMDVDRLLQSLPQLHTGLSINPIFNGSFEDGDEMALFRLF 120

Query: 121 NVGIVHGWIIDGDNDPNSYEHVSKYSYMGAQKVLVQSYEIQKNNAQ------FENSEQIQ 174
           NV IVHGWI D  +DP  YEHVSKYSY  AQKVL+++Y+IQ  +          ++EQ+ 
Sbjct: 121 NVSIVHGWIADYADDPAQYEHVSKYSYEEAQKVLIEAYDIQHGSGSPASPNPGHSAEQVL 180

Query: 175 SDAPYLKSFLARSATQLTEYGLTHLREILVERSYAVLFRNDHFCTLYKNNGELFTLVTDP 234
            DA Y+KSFLARSATQLTEYGL  LRE+L+E S+AVLFRNDHF T+ K+  EL+ LVTD 
Sbjct: 181 EDAGYIKSFLARSATQLTEYGLHQLRELLIENSFAVLFRNDHFSTIVKHKNELYALVTDL 240

Query: 235 TYRNRKDINWQSLKSVNGSQDSYYTGNFIPTSLERTETTATGQNE-SYISNPFSDQNTGH 293
            Y++ ++I W+SLKSVNGSQD++YTG FIP ++++T T  T     S  +NPFSD  T  
Sbjct: 241 GYKDDENIVWESLKSVNGSQDTFYTGRFIPATMQKTNTQVTSLTSGSRANNPFSDPFTSS 300

Query: 294 VTSNQVNSGASGVQQIEDDEELARRLQEQEDMRAANNMQNGY-ANNGRNHQRERFERPEK 352
                 NS          DE+ AR+LQE+ED R A N+Q  Y A+  R     R    E+
Sbjct: 301 AHERSENSNGL------SDEQYARQLQEEEDARVARNIQRQYEASQSRRRPNGRVTGSEE 354

Query: 353 -NSKKN 357
            N KK+
Sbjct: 355 ANPKKS 360

>CAGL0H03289g 309091..310248 similar to sp|P53155 Saccharomyces
           cerevisiae YGL082w, start by similarity
          Length = 385

 Score =  314 bits (805), Expect = e-105,   Method: Compositional matrix adjust.
 Identities = 167/368 (45%), Positives = 237/368 (64%), Gaps = 10/368 (2%)

Query: 1   MDVTFLTKNVQINGTQFKILLQNGQGECALIALANVLLISPAHARYAQEISRLVRGKETV 60
           MD  +  K+++  G   +ILL   +   AL+AL N L++S  H R   ++  +      +
Sbjct: 1   MDDYYSIKSIEFKGYHCRILLDQDEDYSALVALTNALVLSQGHNRVTSQLKSIFDNCNEI 60

Query: 61  TLNELVQTLADMGVQNPNGTDV--DKQQLLQILPQLYSGLNINPEFNGSFEDGVEMSIFR 118
            + +L+  LA++G+Q    ++   DK+QL+  L +   GL+INP+FNGSF D +E S+F 
Sbjct: 61  AVEDLLDELANIGLQLGVMSNYGQDKEQLIATLKEFRKGLHINPKFNGSFTDSLETSVFS 120

Query: 119 LYNVGIVHGWIIDGDNDPNSYEHVSKYSYMGAQKVLVQSYEIQKNN---AQFENSEQIQS 175
            +NV +VHGW++DGD DP SY H+SKYSY  AQ+VLVQ+YEI+K+    A   N++Q+  
Sbjct: 121 GFNVALVHGWVVDGDRDPTSYYHLSKYSYEEAQRVLVQAYEIRKDQNGVALNTNAQQVLD 180

Query: 176 DAPYLKSFLARSATQLTEYGLTHLREILVERSYAVLFRNDHFCTLYKNNGELFTLVTDPT 235
           D+ Y+KSFLARSATQLTEYGL HL+EILVE+S+AVLFRND + TLYKN GELF LVT+P+
Sbjct: 181 DSAYIKSFLARSATQLTEYGLQHLKEILVEKSFAVLFRNDRYFTLYKNAGELFILVTNPS 240

Query: 236 YRNRKDINWQSLKSVNGSQDSYYTGNFIPTSLERTETTATGQNESYI--SNPFSDQNTGH 293
                +I WQSL SVNG++D YY G F+  + +  + T    ++  +  SNPFSD  T  
Sbjct: 241 QSRNNNIVWQSLHSVNGARDLYYNGVFVEINPDNDQNTF---DDVVVPQSNPFSDPQTNQ 297

Query: 294 VTSNQVNSGASGVQQIEDDEELARRLQEQEDMRAANNMQNGYANNGRNHQRERFERPEKN 353
              N   +     QQ+EDDE LAR+LQE+ED +AA  MQN Y  NG  ++ +  +  +K 
Sbjct: 298 EFQNIDRNDTFDAQQVEDDELLARQLQEEEDRQAAGLMQNAYRRNGPRNKYQIDDESKKK 357

Query: 354 SKKNKFLP 361
            K+N  +P
Sbjct: 358 KKRNSIIP 365

>KLLA0E19371g 1718449..1719495 similar to sp|P53155 Saccharomyces
           cerevisiae YGL082w, start by similarity
          Length = 348

 Score =  313 bits (801), Expect = e-105,   Method: Compositional matrix adjust.
 Identities = 161/333 (48%), Positives = 220/333 (66%), Gaps = 28/333 (8%)

Query: 5   FLTKNVQINGTQFKILLQNGQGECALIALANVLLISPAHARYAQEISRLVRGKETVTLNE 64
           F TK ++++G    ILLQN  G CAL+AL NVL++SP H   A E+ +L+     VTL +
Sbjct: 3   FETKTIKVDGLTRNILLQNENGPCALVALTNVLVLSPQHKLDANELIQLINSNRKVTLED 62

Query: 65  LVQTLADMGVQNPNGTDVDKQQLLQILPQLYSGLNINPEFNGSFEDGVEMSIFRLYNVGI 124
           L+ TLA++GV   NG   D  +LLQ+LPQL++GLN+NP FNG+F+D   +++FRL+ V +
Sbjct: 63  LITTLANIGVMMDNGQSEDVNELLQLLPQLHTGLNVNPAFNGTFQDDQALALFRLFQVSL 122

Query: 125 VHGWIIDGDNDPNSYEHVSKYSYMGAQKVLVQSYEIQKNNAQFENSEQIQSDAPYLKSFL 184
           VHGWI+D   +   Y  VS YSY  AQ +LV +Y+IQ N  Q ENSEQI  DA YLKSFL
Sbjct: 123 VHGWIVDPTRNEQQYHSVSHYSYDDAQNLLVHAYDIQNNGLQVENSEQILQDAQYLKSFL 182

Query: 185 ARSATQLTEYGLTHLREILVERSYAVLFRNDHFCTLYKNNGELFTLVTDPTYRNRKDINW 244
           ARSATQLTEYG+ HL+++L E SY+V FRNDHF T++KNNG L+ LVTD  ++   +I W
Sbjct: 183 ARSATQLTEYGIQHLQQLLQEHSYSVFFRNDHFSTIHKNNGGLYVLVTDLGFKKASNIVW 242

Query: 245 QSLKSVNGSQDSYYTGNFIPTSLERTETTATGQNESYISNPFSDQNTGHVTSNQVNSGAS 304
           QSLKSV G+QDS++T  F+ T+LE  + TA+G                      ++  ++
Sbjct: 243 QSLKSVKGNQDSFFTSEFLLTTLE--QATASG----------------------LDPNSN 278

Query: 305 GVQQIED----DEELARRLQEQEDMRAANNMQN 333
           G Q  E+    DE+LAR LQE+ED RA   +++
Sbjct: 279 GSQLDEETPMTDEQLARLLQEEEDARAVRGIRS 311

>AFL071C [3122] [Homologous to ScYGL082W - SH; ScYPL191C - SH]
           (301720..302775) [1056 bp, 351 aa]
          Length = 351

 Score =  297 bits (761), Expect = 6e-99,   Method: Compositional matrix adjust.
 Identities = 152/336 (45%), Positives = 218/336 (64%), Gaps = 16/336 (4%)

Query: 1   MDVTFLTKNVQINGTQFKILLQNGQGECALIALANVLLISPAHARYAQEISRLVRGKETV 60
           M +TF TK + +NG   +ILLQN  G CALIAL+NVLL+SP +A    ++  L +   TV
Sbjct: 1   MSLTFATKGITVNGRPSRILLQNENGPCALIALSNVLLLSPNYAETTSQLRNLAQAP-TV 59

Query: 61  TLNELVQTLADMGVQNPNGTDVDKQQLLQILPQLYSGLNINPEFNGSFEDGVEMSIFRLY 120
           TL +LV  LAD+ +Q    +  D  ++L++LP+L +GL I+P FNG+F +G EM++FR++
Sbjct: 60  TLRDLVAVLADIAMQLGGDSHRDMDRMLELLPKLQTGLLIDPAFNGTFREGDEMALFRMF 119

Query: 121 NVGIVHGWIIDGDNDPNSYEHVSKYSYMGAQKVLVQSYEIQKNNAQFENSEQIQSDAPYL 180
            VG+VH W++D    P  Y  +S+ SY  AQ++LV++Y+IQ+ +   E ++Q+  DA  L
Sbjct: 120 QVGLVHTWLMDVSQAPQDYSRLSQCSYEEAQRLLVEAYDIQQGSVASEKADQLLQDAHIL 179

Query: 181 KSFLARSATQLTEYGLTHLREILVERSYAVLFRNDHFCTLYKNNGELFTLVTDPTYRNRK 240
           +SFL+RSATQ+T YGL HL+ +L E +YAVLFRNDHF T+ K  GELF LVTD  Y+ R 
Sbjct: 180 RSFLSRSATQMTSYGLQHLKRVLPEGAYAVLFRNDHFATICKQEGELFILVTDLGYQYRH 239

Query: 241 DINWQSLKSVNGSQDSYYTGNFIPTSLERTET----TATGQNESYISNPFSDQNTGHVTS 296
           DI WQSL   +GS+D++YTG+F+PT LE   +    TA G+      +PF+D+N      
Sbjct: 240 DIVWQSLSYPDGSEDTFYTGDFVPTRLEDDSSLFPDTAAGE------DPFADKNATFSAP 293

Query: 297 NQVNSGASGVQQIEDDEELARRLQEQEDMRAANNMQ 332
           +     A        DEELAR LQ++ED     ++Q
Sbjct: 294 SLPPDSA-----FLTDEELARHLQQEEDGLYVRSLQ 324

>YPL191C (YPL191C) [5256] chr16 complement(183596..184678) Member of
           the DUF544 protein of unknown function family, has
           moderate similarity to uncharacterized S. cerevisiae
           Ygl082p [1083 bp, 360 aa]
          Length = 360

 Score =  279 bits (714), Expect = 1e-91,   Method: Compositional matrix adjust.
 Identities = 165/376 (43%), Positives = 236/376 (62%), Gaps = 29/376 (7%)

Query: 1   MDVTFLTKNVQINGTQFKILLQNGQGECALIALANVLLISPAHARYAQEISRLVRGKETV 60
           MD++F TK+V+ING   +ILLQN  G CAL+ALAN+L++SP H R++ E+ RLV     +
Sbjct: 1   MDLSFTTKSVKINGQNHRILLQNENGPCALLALANILILSPDHTRFSNELIRLVNKGSQI 60

Query: 61  TLNELVQTLADMGVQNPNGTDVDKQQLLQILPQLYSGLNINPEFNGSFEDGVEMSIFRLY 120
           +L EL++ LAD+ +Q  +    D  +LL +LP+L+ GLNINPEFNGSFE+  EMSIFRL+
Sbjct: 61  SLKELIEVLADIALQVTDKPSTDISELLSLLPRLHEGLNINPEFNGSFENTKEMSIFRLF 120

Query: 121 NVGIVHGWIIDGDNDPNSYEHVSKYSYMGAQKVLVQSYEIQKNNAQFENSEQIQSDAPYL 180
           NV +VHGW+I+   + N  E +S YSY  AQ++L Q+ +I    +Q ENS+++  DA +L
Sbjct: 121 NVDVVHGWVINSFINENIDEKLSHYSYESAQRILTQAADINCGISQDENSDEVLRDAMHL 180

Query: 181 KSFLARSATQLTEYGLTHLREILVERSYAVLFRNDHFCTLYKNNGELFTLVTDPTYRNRK 240
             FL  S TQLT +GL  LRE L+   +++LFRNDHF TL+K    L+TLVTD  Y+N K
Sbjct: 181 GLFLNESPTQLTAFGLLRLREKLLHNKFSILFRNDHFSTLFKYEDRLYTLVTDFGYKNCK 240

Query: 241 DINWQSLKSVNGSQDSYYTGNFIPTSLERTETTATGQNESYISNPFSDQNTGHVTSNQVN 300
           DI WQSL SV+GS D+++ GNF       +     GQ  S  ++   D  TG++   +  
Sbjct: 241 DIVWQSLDSVDGSCDAFFAGNF-------SAAEVNGQQLS--TDIERDFGTGNLLLEE-- 289

Query: 301 SGASGVQQIEDDEELARRLQEQEDMRA----ANNMQNGYANNGRNH---QRERFERPEKN 353
                +QQIE+D+ELA++LQEQE  R     A    + +  N   H   ++++F+R    
Sbjct: 290 -----IQQIENDKELAKQLQEQEQERVTKFEAKRKIHSHKKNSEIHAPVKKDKFKR---- 340

Query: 354 SKKNKFLPFNGSNKEK 369
             ++  L    S KEK
Sbjct: 341 --RSSLLNAKASEKEK 354

>Scas_611.4*
          Length = 299

 Score =  241 bits (614), Expect = 2e-77,   Method: Compositional matrix adjust.
 Identities = 122/265 (46%), Positives = 177/265 (66%), Gaps = 27/265 (10%)

Query: 5   FLTKNVQINGTQFKILLQNGQGECALIALANVLLISPAHARYAQEISRLVRGK-ETVTLN 63
           F  KN++I GT FKILLQN  G CAL+A+ N+LLISP H R    ++ L+  K  TV+L+
Sbjct: 7   FTIKNIEIKGTPFKILLQNENGPCALLAIVNLLLISPQHKRINYSLTELLEKKTSTVSLD 66

Query: 64  ELVQTLADMGVQN------PNGTDVDKQQLLQILPQLYSGLNINPEFNGSFEDGVEMSIF 117
           E+ Q LA++ +Q+       NG D+D  QLL++LP L++GLNINP+F+G+FED  EM++F
Sbjct: 67  EVNQVLANIALQSNTEMKGSNGADMD--QLLELLPHLHTGLNINPKFDGTFEDSNEMALF 124

Query: 118 RLYNVGIVHGWIIDGDNDPNSYEHVSKYSYMGAQKVLVQSYEIQKNNAQFENSEQIQSDA 177
           R++ + IVHGW+I         E +SKYSY  AQ+VL+++ E           E+   +A
Sbjct: 125 RMFKIPIVHGWVI---------ETLSKYSYESAQQVLLKAAE---------GDEEAVGEA 166

Query: 178 PYLKSFLARSATQLTEYGLTHLREILVERSYAVLFRNDHFCTLYKNNGELFTLVTDPTYR 237
             ++ F   + TQLT+ GL +L  IL E+ + VLFRNDHF T+YK N +L++LVTD  YR
Sbjct: 167 TLIQLFFDETGTQLTQNGLAYLNTILEEKGFVVLFRNDHFSTIYKENNQLYSLVTDLGYR 226

Query: 238 NRKDINWQSLKSVNGSQDSYYTGNF 262
            RKDI W+++KS++GS+D++  GN 
Sbjct: 227 RRKDIVWENIKSIDGSEDTFCDGNL 251

>CAGL0G09251g complement(882028..883119) similar to sp|Q08930
           Saccharomyces cerevisiae YPL191c, hypothetical start
          Length = 363

 Score =  192 bits (487), Expect = 1e-57,   Method: Compositional matrix adjust.
 Identities = 137/395 (34%), Positives = 210/395 (53%), Gaps = 68/395 (17%)

Query: 3   VTFLTKNVQINGTQFKILLQNGQGECALIALANVLLISPAHARYAQEISRLVRGKETVTL 62
           + F TK ++++G    IL+QN  G CAL+AL NVLL+S  H     E+  LV+ K+ V L
Sbjct: 1   MNFATKRIRVDGNDRSILMQNENGPCALVALTNVLLLSSHHEH--SELLELVQPKK-VDL 57

Query: 63  NELVQTLADMGVQNPNGTDVDKQQLLQILPQLYSGLNINPEFNGSFEDGVEMSIFRLYNV 122
           ++L+  LAD+ +   N  D +   LL +LPQL++GLNINP F+G+FED  E+S+F+L+++
Sbjct: 58  DQLLTVLADIAIAT-NPKDEELSVLLSLLPQLHTGLNINPRFDGTFEDTKELSVFKLFDI 116

Query: 123 GIVHGWIIDGDNDPNSYEHVSKYSYMGAQKVLVQSYEIQ------KNNAQFENSEQIQSD 176
            I+HGWI       +S + V KY+Y  +Q++L Q+ +I+        N Q +N   I ++
Sbjct: 117 DIIHGWI-------SSDDKVQKYTYEESQQLLTQAVDIRDRETPGSGNPQDDN---ILAE 166

Query: 177 APYLKSFLARSATQLTEYGLTHLREILVERSYAVLFRNDHFCTLYKNNGELFTLVTDPTY 236
           A  ++ FL  S+TQLT  GL ++   + E +YAVLFRNDHF T+ K+NG  + LVTD  +
Sbjct: 167 ANLIEQFLNDSSTQLTPNGLNNINTTMKEGNYAVLFRNDHFATITKHNGNTYALVTDLGF 226

Query: 237 RNRKDINWQSLKSVNGSQDSYYTGNFIPTSLERTETTATGQNESYISNPFSDQNTGHVTS 296
           R+  +I W+ + S++GS D ++ G F  T L  T  T     E                 
Sbjct: 227 RSCNNIVWEYMGSIDGSNDIFFDGIFEETELNDTAYTTMEATER---------------- 270

Query: 297 NQVNSGASGVQQIEDDEELARRLQEQE-----------------------DMRAANNMQN 333
                    V+Q++ D +LA++LQ +E                       D R  N+ Q 
Sbjct: 271 ------KERVEQVDKDAQLAQQLQLEENEAIQEADKKQLPKKSTIPKTKTDKRGTNHHQT 324

Query: 334 GYANNGRNHQRERFERPEKNSKKNKFLPFNGSNKE 368
             +N    H      R  KN+KK+  +  N SNK+
Sbjct: 325 P-SNATYKHTHSHHSR--KNNKKHNSMNANASNKK 356

>KLLA0D01507g 133636..135183 some similarities with sp|Q9N2D4
           Callithrix jacchus Pepsin A precursor (EC 3.4.23.1),
           hypothetical start
          Length = 515

 Score = 32.0 bits (71), Expect = 0.89,   Method: Compositional matrix adjust.
 Identities = 16/48 (33%), Positives = 26/48 (54%), Gaps = 1/48 (2%)

Query: 211 LFRND-HFCTLYKNNGELFTLVTDPTYRNRKDINWQSLKSVNGSQDSY 257
           L+  D H+ +L  N    + L  D  Y N + +N+ + ++V GSQ SY
Sbjct: 275 LYTGDIHYASLITNENHYWQLKIDSVYVNSQAVNFSTSEAVTGSQSSY 322

>Kwal_27.11655
          Length = 605

 Score = 30.8 bits (68), Expect = 2.0,   Method: Compositional matrix adjust.
 Identities = 23/67 (34%), Positives = 34/67 (50%), Gaps = 4/67 (5%)

Query: 235 TYRNRKDINWQSLKSVNGSQDSYYTGNFIPTSLERTETTATGQNESYISNPFSDQNTGHV 294
           +Y NR D+  Q L+  NGS D++ +   +P   E +ET      + Y S      +TG V
Sbjct: 113 SYSNRLDL--QRLE--NGSTDTFQSAKEVPPPYEESETQQFLHEKIYRSRSDLSGSTGTV 168

Query: 295 TSNQVNS 301
           T+N V S
Sbjct: 169 TTNAVQS 175

>Scas_468.2
          Length = 651

 Score = 30.4 bits (67), Expect = 2.6,   Method: Compositional matrix adjust.
 Identities = 17/60 (28%), Positives = 31/60 (51%), Gaps = 2/60 (3%)

Query: 232 TDPTYRNRKDINWQSLKSVNGSQDSYYTG--NFIPTSLERTETTATGQNESYISNPFSDQ 289
           TDP +   K     +L+ +   +  +Y    + IP+S E+T  T   Q+ + IS+P S++
Sbjct: 554 TDPDFTPEKHPPVIALEQLEAEKIKFYASKKSLIPSSKEKTSKTIIEQSLTSISSPISNK 613

>Kwal_26.9488
          Length = 580

 Score = 29.6 bits (65), Expect = 4.1,   Method: Compositional matrix adjust.
 Identities = 31/137 (22%), Positives = 63/137 (45%), Gaps = 15/137 (10%)

Query: 115 SIFRLYNVGIVHGWIIDGDNDPNSYEHVSKYSYMGAQKVLVQSYEIQKNNAQFENSEQIQ 174
           S+F L+++G++ G ++D    PN     S  + +G+   ++ + E+ +  +     E I+
Sbjct: 195 SLFGLFHLGVIRG-LLDQKLLPNIISGSSMGACIGSLCSVLTNEELSRLLSGDNLLEAIK 253

Query: 175 SDAPYLKSFLARSATQLTEYGLTHLREILVERSYA------------VLFRNDHFCTLYK 222
           SD   LK     +  Q  +  L  L + +V R Y+            V+ ++  F   ++
Sbjct: 254 SDLELLKQCGYGNIDQ--DLNLGSLLQNVVHRGYSKDVFLFINFVNKVIIKDLTFEEAFQ 311

Query: 223 NNGELFTLVTDPTYRNR 239
             G++  ++  PT RNR
Sbjct: 312 RTGKILNIIVHPTDRNR 328

>KLLA0E10593g 935625..936467 no similarity, hypothetical start
          Length = 280

 Score = 29.6 bits (65), Expect = 4.2,   Method: Compositional matrix adjust.
 Identities = 24/70 (34%), Positives = 34/70 (48%), Gaps = 8/70 (11%)

Query: 184 LARSAT---QLTEYGLTHLREILVERSYAVLFRNDHFCTLYKNNGELFTLVTDPTYRNRK 240
           LARS     ++ E+GL  LREI+V   Y    RND F    KN      + +   Y  R+
Sbjct: 67  LARSGNSDDEVIEHGLRKLREIIVS-IYHSEKRNDEFMNSVKN----VYIYSIEFYLGRR 121

Query: 241 DINWQSLKSV 250
            +NW  L ++
Sbjct: 122 PVNWTKLVNI 131

>YGR117C (YGR117C) [2074] chr7 complement(725051..726481) Protein of
           unknown function, has low similarity to uncharacterized
           C. albicans Orf6.2270p [1431 bp, 476 aa]
          Length = 476

 Score = 29.6 bits (65), Expect = 4.3,   Method: Compositional matrix adjust.
 Identities = 14/29 (48%), Positives = 19/29 (65%), Gaps = 1/29 (3%)

Query: 139 YEHVSKYSYMGAQKVLVQSYEIQKNNAQF 167
           Y H++ YS + A+  LV SY I  NNA+F
Sbjct: 286 YTHIACYSIIDAKN-LVHSYNIALNNAEF 313

>KLLA0D16478g complement(1391173..1392027) weakly similar to
           sgd|S0004122 Saccharomyces cerevisiae YLR132c
           hypothetical protein, start by similarity
          Length = 284

 Score = 28.9 bits (63), Expect = 6.8,   Method: Compositional matrix adjust.
 Identities = 12/32 (37%), Positives = 20/32 (62%)

Query: 157 SYEIQKNNAQFENSEQIQSDAPYLKSFLARSA 188
           S+ +  NN QF+N+E+ +  + YL+  LA  A
Sbjct: 215 SFGVIPNNKQFKNAEEFEKSSKYLRHILATEA 246

>Scas_615.3
          Length = 590

 Score = 28.9 bits (63), Expect = 8.1,   Method: Compositional matrix adjust.
 Identities = 21/77 (27%), Positives = 43/77 (55%), Gaps = 9/77 (11%)

Query: 27  ECALIALANVLLISPAHARYAQEISRLVRGKETVTLNELVQTLADMGVQNPNGTDVDKQQ 86
           +  + A A  +LI+P+H  + +EIS       ++ LNE    LA  G Q  + T + + Q
Sbjct: 36  KTTIAAGATPILINPSHESHIKEIS-------SIFLNESGFQLATRGFQLSDLTTLGRTQ 88

Query: 87  LLQILPQLYSGLNINPE 103
           + +++ +++  +N++PE
Sbjct: 89  VQRVVDRVF--INLSPE 103

>KLLA0C12485g 1060167..1062944 weakly similar to sp|Q12236
           Saccharomyces cerevisiae YOL100w PKH2, start by
           similarity
          Length = 925

 Score = 28.9 bits (63), Expect = 8.7,   Method: Compositional matrix adjust.
 Identities = 19/76 (25%), Positives = 36/76 (47%), Gaps = 9/76 (11%)

Query: 233 DPTYRNRKDINWQSLKSVNGSQDSYYTGNFIPTSLERTETTATGQNE------SYISNPF 286
           DP Y NR++ +  S+++++ ++D   +   IP  L  +E+    Q E      + I    
Sbjct: 79  DPKYLNRRNDSLSSVETIDSTRDDNIS---IPKELPISESMQRRQKEWADRGAAMIVKDV 135

Query: 287 SDQNTGHVTSNQVNSG 302
            D+ TG +T   +  G
Sbjct: 136 PDKQTGKITKQVIKKG 151

>AFL015C [3178] [Homologous to ScYGL115W (SNF4) - SH]
           (407482..408489) [1008 bp, 335 aa]
          Length = 335

 Score = 28.5 bits (62), Expect = 9.9,   Method: Compositional matrix adjust.
 Identities = 17/60 (28%), Positives = 31/60 (51%)

Query: 156 QSYEIQKNNAQFENSEQIQSDAPYLKSFLARSATQLTEYGLTHLREILVERSYAVLFRND 215
           QS  ++KNN + E    IQS   +LKS  +     ++   +     +LV++S  +L +N+
Sbjct: 15  QSASVEKNNVELEQKVAIQSIRMFLKSKTSYDVLPVSYRLIVLDTSLLVKKSLNILLQNN 74

  Database: blastdb
    Posted date:  Apr 3, 2006  3:33 PM
  Number of letters in database: 16,596,109
  Number of sequences in database:  34,618
  
Lambda     K      H
   0.313    0.130    0.367 

Gapped
Lambda     K      H
   0.267   0.0410    0.140 

Matrix: BLOSUM62
Gap Penalties: Existence: 11, Extension: 1
Number of Sequences: 34618
Number of Hits to DB: 13,367,519
Number of extensions: 630834
Number of successful extensions: 2238
Number of sequences better than 10.0: 107
Number of HSP's gapped: 2209
Number of HSP's successfully gapped: 110
Length of query: 375
Length of database: 16,596,109
Length adjustment: 103
Effective length of query: 272
Effective length of database: 13,030,455
Effective search space: 3544283760
Effective search space used: 3544283760
Neighboring words threshold: 11
Window for multiple hits: 40
X1: 16 ( 7.2 bits)
X2: 38 (14.6 bits)
X3: 64 (24.7 bits)
S1: 42 (21.9 bits)
S2: 62 (28.5 bits)