Hit NameLength (aa)HSP LengthHSP ScoreHSP Significance
YGL081W32031513460.0
Kwal_56.239583561291843e-15
AFL072C3141591736e-14
KLLA0E19393g3361221356e-09
Scas_720.14d19678972e-04
AGL106C45674662.4
KLLA0D18799g46774662.7
KLLA0A00957g79260645.1
YDR200C (VPS64)60475636.7
BLASTP 2.2.26 [Sep-21-2011]

Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, 
Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), 
"Gapped BLAST and PSI-BLAST: a new generation of protein database search
programs",  Nucleic Acids Res. 25:3389-3402.

Reference for compositional score matrix adjustment: Altschul, Stephen F., 
John C. Wootton, E. Michael Gertz, Richa Agarwala, Aleksandr Morgulis,
Alejandro A. Schaffer, and Yi-Kuo Yu (2005) "Protein database searches
using compositionally adjusted substitution matrices", FEBS J. 272:5101-5109.

Query= YGL081W
         (315 letters)

Database: blastdb 
           34,618 sequences; 16,596,109 total letters

Searching..................................................done

                                                                 Score    E
Sequences producing significant alignments:                      (bits) Value

YGL081W (YGL081W) [1901] chr7 (357378..358340) Protein containin...   523   0.0  
Kwal_56.23958                                                          75   3e-15
AFL072C [3121] [Homologous to ScYGL081W - SH] (300464..301408) [...    71   6e-14
KLLA0E19393g 1720040..1721050 no similarity, hypothetical start        57   6e-09
Scas_720.14d                                                           42   2e-04
AGL106C [4206] [Homologous to ScYLR238W - SH; ScYDR200C - SH] (5...    30   2.4  
KLLA0D18799g complement(1584644..1586047) some similarities with...    30   2.7  
KLLA0A00957g 89999..92377 gi|9957024|gb|AAG09178.1 Kluyveromyces...    29   5.1  
YDR200C (VPS64) [1040] chr4 complement(854272..856086) Class B v...    29   6.7  

>YGL081W (YGL081W) [1901] chr7 (357378..358340) Protein containing a
           forkhead associated (FHA) domain, which bind
           phosphopeptides [963 bp, 320 aa]
          Length = 320

 Score =  523 bits (1346), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 262/315 (83%), Positives = 262/315 (83%)

Query: 1   MGDIRTFVFAIEDTETTQGLCKTIGRSSSFDQNSLCKPYNLYFDEPELSRQHAVLCIKTP 60
           MGDIRTFVFAIEDTETTQGLCKTIGRSSSFDQNSLCKPYNLYFDEPELSRQHAVLCIKTP
Sbjct: 1   MGDIRTFVFAIEDTETTQGLCKTIGRSSSFDQNSLCKPYNLYFDEPELSRQHAVLCIKTP 60

Query: 61  IPKIEGVPSIEQLRICIRDLNNKTGTVNLVSDGPNDEIDLKNGDAFGLIAIDNHPFRDNH 120
           IPKIEGVPSIEQLRICIRDLNNKTGTVNLVSDGPNDEIDLKNGDAFGLIAIDNHPFRDNH
Sbjct: 61  IPKIEGVPSIEQLRICIRDLNNKTGTVNLVSDGPNDEIDLKNGDAFGLIAIDNHPFRDNH 120

Query: 121 HLAAKLIFRIELEYFDEAREIVKCTITNVTFGKNNTVSSFPIHSATSTEDSDSSWYGLSE 180
           HLAAKLIFRIELEYFDEAREIVKCTITNVTFGKNNTVSSFPIHSATSTEDSDSSWYGLSE
Sbjct: 121 HLAAKLIFRIELEYFDEAREIVKCTITNVTFGKNNTVSSFPIHSATSTEDSDSSWYGLSE 180

Query: 181 ASTQTEVADECHETNTILTRGGRFSILSLRKRGSKQDQKICSNFDRKIHETSSFXXXXXX 240
           ASTQTEVADECHETNTILTRGGRFSILSLRKRGSKQDQKICSNFDRKIHETSSF      
Sbjct: 181 ASTQTEVADECHETNTILTRGGRFSILSLRKRGSKQDQKICSNFDRKIHETSSFEEEIEV 240

Query: 241 XXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXCFSKNKKIITPQH 300
                                                          CFSKNKKIITPQH
Sbjct: 241 CTDTDTTEEKEEEEEKEEGDDEEGEIELEIIRVKRIKGRTKIKKTLTCFSKNKKIITPQH 300

Query: 301 SNSMWLLLIVILIFD 315
           SNSMWLLLIVILIFD
Sbjct: 301 SNSMWLLLIVILIFD 315

>Kwal_56.23958
          Length = 356

 Score = 75.5 bits (184), Expect = 3e-15,   Method: Compositional matrix adjust.
 Identities = 52/129 (40%), Positives = 71/129 (55%), Gaps = 5/129 (3%)

Query: 5   RTFVFAIEDTETTQGLCKTIGRSSSFDQNSLCKPYNLYFDEPELSRQHAVLCIKTPIPKI 64
           R   F I++TE   GL   IGR+S  D     +  N  + E  LS++HA+LCIK  IP  
Sbjct: 10  RKITFNIKETEGA-GLQFPIGRASFKDPQRSDRNDNFMYHEKSLSKKHAMLCIKRLIPSD 68

Query: 65  EG--VPSIEQLRICIRDLNNKTGTVNLVS-DGPNDEIDLKNGDAFGLIAIDNHPFRDNHH 121
           +   VP + Q RI ++DL +  G V+L S D     IDLKNG+ FGLI + +HP      
Sbjct: 69  DDPFVPLLCQFRISVQDLGSTHGLVDLQSQDSEASIIDLKNGERFGLIRL-HHPIAPGQS 127

Query: 122 LAAKLIFRI 130
             AKL F++
Sbjct: 128 RGAKLKFQV 136

>AFL072C [3121] [Homologous to ScYGL081W - SH] (300464..301408) [945
           bp, 314 aa]
          Length = 314

 Score = 71.2 bits (173), Expect = 6e-14,   Method: Compositional matrix adjust.
 Identities = 50/159 (31%), Positives = 82/159 (51%), Gaps = 15/159 (9%)

Query: 5   RTFVFAIEDTETTQGLCKTIGRSSSFDQNSLCKPYNLYFDEPELSRQHAVLCIK---TPI 61
           R  +F I      +GL + IGR+S  D   + +  NL+F E  LS+QHA+L +K    P 
Sbjct: 10  RRLIFNI-----NEGLAEVIGRASERDAERVARADNLFFAERSLSKQHAMLYVKRFTGPG 64

Query: 62  PKIEGVPSIEQLRICIRDLNNKTGTVNLVSD--GPNDEIDLKNGDAFGLIAIDNHPFRDN 119
              +G    E +RI + DL +  G V+L S   G +  IDLKNG+ FG++ +D  P    
Sbjct: 65  GAQDG--DEENIRIWVEDLGSTHGLVDLQSTARGVSQLIDLKNGERFGVVYMDK-PITST 121

Query: 120 HHLAAKLIFRIELEYFDEAREIVKCTITNVTFGKNNTVS 158
               A+L F++ +    +   + +  + +VTFG +  ++
Sbjct: 122 QSRGARLKFQVNV--MQKQGPLWELLVRDVTFGDSPCIT 158

>KLLA0E19393g 1720040..1721050 no similarity, hypothetical start
          Length = 336

 Score = 56.6 bits (135), Expect = 6e-09,   Method: Compositional matrix adjust.
 Identities = 41/122 (33%), Positives = 61/122 (50%), Gaps = 7/122 (5%)

Query: 17  TQGLCKTIGRSSSFDQNSLCKPYNLYFDEPELSRQHAVLCIKT--PIPKIEGVP-SIEQL 73
           + G+   IG+    D++      NL FD+ +L  +HA L +K   P    E +P +I+  
Sbjct: 19  SHGIEVIIGKEVKEDESKHSSESNLIFDDDDLFVEHAKLVVKKLPPTNDEESLPMNIDSF 78

Query: 74  RICIRDLNNKTGTVNLVSDGPNDE---IDLKNGDAFGLIAIDNHPFRDNHHLAAKLIFRI 130
           RI +  L +    V+L S   N +   IDLKNGD FGL+ +D  P   N    AKL F +
Sbjct: 79  RIYLESLGDADRIVDLESADSNTDGKIIDLKNGDRFGLVRLD-EPVSVNQQRGAKLKFNL 137

Query: 131 EL 132
            +
Sbjct: 138 NI 139

>Scas_720.14d
          Length = 196

 Score = 42.0 bits (97), Expect = 2e-04,   Method: Compositional matrix adjust.
 Identities = 28/78 (35%), Positives = 40/78 (51%), Gaps = 5/78 (6%)

Query: 40  NLYFDEPELSRQHAVLCIKT-PIPKIEGVPSIEQLRICIRDLNNKTGTVNLVSDGP---N 95
           NL F    L ++HA L IK  P    EG+P +   R  + DL    G V+L S      N
Sbjct: 57  NLEFSNSALEKKHARLVIKMFPSVSNEGIP-VPNFRAHVEDLTEGNGIVDLYSKKDPSFN 115

Query: 96  DEIDLKNGDAFGLIAIDN 113
           + ++LKNG++F +   DN
Sbjct: 116 NIVELKNGESFAISGKDN 133

>AGL106C [4206] [Homologous to ScYLR238W - SH; ScYDR200C - SH]
           (504816..506186) [1371 bp, 456 aa]
          Length = 456

 Score = 30.0 bits (66), Expect = 2.4,   Method: Compositional matrix adjust.
 Identities = 26/74 (35%), Positives = 33/74 (44%), Gaps = 13/74 (17%)

Query: 36  CKPYNLYFDEPELSRQHAVLCIKTPIPKIEGVPSIEQLRICIRDLNNKTGT-VNLVSDGP 94
            +P N +FD   LSR HA L               E  +I IRDL +  GT +N    G 
Sbjct: 102 VRPDNGHFDSRVLSRNHASLSCDG-----------ESGKIYIRDLKSSNGTFINGTRIGQ 150

Query: 95  NDEIDLKNGDAFGL 108
            D ++LK GD   L
Sbjct: 151 AD-VELKIGDVVDL 163

>KLLA0D18799g complement(1584644..1586047) some similarities with
           sgd|S0002608 Saccharomyces cerevisiae YDR200c,
           hypothetical start
          Length = 467

 Score = 30.0 bits (66), Expect = 2.7,   Method: Compositional matrix adjust.
 Identities = 27/74 (36%), Positives = 31/74 (41%), Gaps = 13/74 (17%)

Query: 36  CKPYNLYFDEPELSRQHAVLCIKTPIPKIEGVPSIEQLRICIRDLNNKTGT-VNLVSDGP 94
            K  N  FD   LSR HA L       KI           CIRDL +  GT VN    G 
Sbjct: 123 VKADNGNFDSRVLSRNHASLSCDAKTGKI-----------CIRDLKSSNGTFVNGSRIGQ 171

Query: 95  NDEIDLKNGDAFGL 108
            D +++K GD   L
Sbjct: 172 TD-VEIKVGDVIDL 184

>KLLA0A00957g 89999..92377 gi|9957024|gb|AAG09178.1 Kluyveromyces
           lactis purine biosynthetic pathway protein ADE5, 7,
           start by similarity
          Length = 792

 Score = 29.3 bits (64), Expect = 5.1,   Method: Compositional matrix adjust.
 Identities = 19/60 (31%), Positives = 28/60 (46%), Gaps = 9/60 (15%)

Query: 148 NVTFGKNNTVSSFPIHSATSTEDSDSSWYGLSEA-----STQTEVADECHETNTILTRGG 202
           NV FG   T +  P+     TED+D +   L+ A     S   ++ D C+ T  +L  GG
Sbjct: 292 NVRFGDPETQTVLPLL----TEDTDLAQVFLAAAEHRLDSVDIKIKDNCYATTVVLAAGG 347

>YDR200C (VPS64) [1040] chr4 complement(854272..856086) Class B
           vacuolar sorting protein involved in Prc1p trafficking
           and alpha-factor secretion, component of a
           high-molecular-weight complex containing Far3p, may
           function in the Far3p-dependent pathway for G1 phase
           arrest [1815 bp, 604 aa]
          Length = 604

 Score = 28.9 bits (63), Expect = 6.7,   Method: Compositional matrix adjust.
 Identities = 29/75 (38%), Positives = 34/75 (45%), Gaps = 15/75 (20%)

Query: 36  CKPYNLYFDEPELSRQHAVL-CIKTPIPKIEGVPSIEQLRICIRDLNNKTGT-VNLVSDG 93
            +P N  FD   LSR HA L C  T              +I IRDL +  GT VN V   
Sbjct: 211 VRPDNGNFDSRVLSRNHACLSCDPT------------SGKIYIRDLKSSNGTFVNGVKIR 258

Query: 94  PNDEIDLKNGDAFGL 108
            ND ++LK GD   L
Sbjct: 259 QND-VELKVGDTVDL 272

  Database: blastdb
    Posted date:  Apr 3, 2006  3:33 PM
  Number of letters in database: 16,596,109
  Number of sequences in database:  34,618
  
Lambda     K      H
   0.319    0.135    0.400 

Gapped
Lambda     K      H
   0.267   0.0410    0.140 

Matrix: BLOSUM62
Gap Penalties: Existence: 11, Extension: 1
Number of Sequences: 34618
Number of Hits to DB: 9,067,722
Number of extensions: 375707
Number of successful extensions: 1086
Number of sequences better than 10.0: 17
Number of HSP's gapped: 1082
Number of HSP's successfully gapped: 18
Length of query: 315
Length of database: 16,596,109
Length adjustment: 102
Effective length of query: 213
Effective length of database: 13,065,073
Effective search space: 2782860549
Effective search space used: 2782860549
Neighboring words threshold: 11
Window for multiple hits: 40
X1: 16 ( 7.4 bits)
X2: 38 (14.6 bits)
X3: 64 (24.7 bits)
S1: 41 (21.8 bits)
S2: 61 (28.1 bits)