Hit NameLength (aa)HSP LengthHSP ScoreHSP Significance
YGL062W (PYC1)1178115759170.0
YBR218C (PYC2)1180115656230.0
Scas_686.171176115653300.0
CAGL0F06941g1180115552880.0
Kwal_14.18031174115352170.0
Scas_563.121216115851910.0
KLLA0C05764g1173115351640.0
CAGL0K06787g1175115751240.0
AAR162C1171115350630.0
Sklu_1458.11132111550070.0
CAGL0M05533g18344517441e-80
YBR208C (DUR1,2)18354716818e-73
ADR051C18194616746e-72
Scas_721.4018344736675e-71
Sklu_2124.118304846561e-69
KLLA0E08107g18294596462e-68
Kwal_27.1195118694596283e-66
Scas_720.7422315134892e-49
CAGL0L10780g22336544883e-49
KLLA0F06072g22315564831e-48
AAR071W22315724812e-48
YNR016C (ACC1)22335134623e-46
YMR207C (HFA1)21234624518e-45
Kwal_23.615722305344463e-44
Kwal_33.1406122213261243e-06
Sklu_2331.122203261243e-06
CAGL0L05676g22113281162e-05
ABR157W11132391153e-05
ACR263C22403261135e-05
YJL130C (URA2)22143251101e-04
Scas_582.4*21933261101e-04
Kwal_55.1978311212511082e-04
KLLA0E23782g393218960.003
Sklu_2413.41122251960.005
KLLA0F03190g1117244930.010
Kwal_27.12090394218910.013
ADR107W442288900.017
Sklu_2431.2394120890.019
Scas_691.191117240870.044
KLLA0F05489g44175860.046
Scas_701.3543075850.061
YDL131W (LYS21)44075840.083
YJR109C (CPA2)1118241850.094
CAGL0J09240g43794840.095
Scas_704.343875830.12
CAGL0J06402g43175830.12
YDL182W (LYS20)42875830.13
KLLA0E15444g2228298830.14
Kwal_56.2440144175800.27
CAGL0C04917g1113365800.34
Kwal_47.19231795127780.48
KLLA0D03146g38470731.8
YHR216W (IMD2)523131713.5
BLASTP 2.2.26 [Sep-21-2011]

Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, 
Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), 
"Gapped BLAST and PSI-BLAST: a new generation of protein database search
programs",  Nucleic Acids Res. 25:3389-3402.

Reference for compositional score matrix adjustment: Altschul, Stephen F., 
John C. Wootton, E. Michael Gertz, Richa Agarwala, Aleksandr Morgulis,
Alejandro A. Schaffer, and Yi-Kuo Yu (2005) "Protein database searches
using compositionally adjusted substitution matrices", FEBS J. 272:5101-5109.

Query= YGL062W
         (1157 letters)

Database: blastdb 
           34,618 sequences; 16,596,109 total letters

Searching..................................................done

                                                                 Score    E
Sequences producing significant alignments:                      (bits) Value

YGL062W (PYC1) [1917] chr7 (385197..388733) Pyruvate carboxylase...  2283   0.0  
YBR218C (PYC2) [399] chr2 complement(658664..662206) Pyruvate ca...  2170   0.0  
Scas_686.17                                                          2057   0.0  
CAGL0F06941g 679960..683502 highly similar to sp|P11154 Saccharo...  2041   0.0  
Kwal_14.1803                                                         2014   0.0  
Scas_563.12                                                          2004   0.0  
KLLA0C05764g complement(512470..515991) highly similar to sp|P32...  1993   0.0  
CAGL0K06787g complement(659290..662817) highly similar to sp|P32...  1978   0.0  
AAR162C [350] [Homologous to ScYGL062W (PYC1) - SH; ScYBR218C (P...  1954   0.0  
Sklu_1458.1 YGL062W, Contig c1458 155-3553 reverse complement        1933   0.0  
CAGL0M05533g complement(588667..594171) similar to sp|P32528 Sac...   291   1e-80
YBR208C (DUR1,2) [390] chr2 complement(636660..642167) Urea amid...   266   8e-73
ADR051C [1792] [Homologous to ScYBR208C (DUR12) - SH] (796213..8...   264   6e-72
Scas_721.40                                                           261   5e-71
Sklu_2124.1 YBR208C, Contig c2124 43-5535 reverse complement          257   1e-69
KLLA0E08107g 730334..735823 highly similar to sp|P32528 Saccharo...   253   2e-68
Kwal_27.11951                                                         246   3e-66
Scas_720.74                                                           192   2e-49
CAGL0L10780g complement(1149588..1156289) highly similar to sp|Q...   192   3e-49
KLLA0F06072g 583276..589971 highly similar to sp|Q00955 Saccharo...   190   1e-48
AAR071W [257] [Homologous to ScYNR016C (ACC1) - SH; ScYMR207C (H...   189   2e-48
YNR016C (ACC1) [4599] chr14 complement(654672..661373) Acetyl-Co...   182   3e-46
YMR207C (HFA1) [4163] chr13 complement(677192..683563) Protein w...   178   8e-45
Kwal_23.6157                                                          176   3e-44
Kwal_33.14061                                                          52   3e-06
Sklu_2331.1 YJL130C, Contig c2331 2029-8691                            52   3e-06
CAGL0L05676g 619734..626369 highly similar to sp|P07259 Saccharo...    49   2e-05
ABR157W [750] [Homologous to ScYJR109C (CPA2) - SH] complement(6...    49   3e-05
ACR263C [1310] [Homologous to ScYJL130C (URA2) - SH] (827830..83...    48   5e-05
YJL130C (URA2) [2788] chr10 complement(165641..172285) Multifunc...    47   1e-04
Scas_582.4*                                                            47   1e-04
Kwal_55.19783                                                          46   2e-04
KLLA0E23782g complement(2105401..2106582) highly similar to sp|Q...    42   0.003
Sklu_2413.4 YJR109C, Contig c2413 10886-14254                          42   0.005
KLLA0F03190g complement(296883..300236) highly similar to sp|P03...    40   0.010
Kwal_27.12090                                                          40   0.013
ADR107W [1848] [Homologous to ScYDL131W (LYS21) - SH; ScYDL182W ...    39   0.017
Sklu_2431.2 YDL131W, Contig c2431 3030-4214                            39   0.019
Scas_691.19                                                            38   0.044
KLLA0F05489g 541146..542471 highly similar to sp|Q12122 Saccharo...    38   0.046
Scas_701.35                                                            37   0.061
YDL131W (LYS21) [738] chr4 (227393..228715) Homocitrate synthase...    37   0.083
YJR109C (CPA2) [3001] chr10 complement(629500..632856) Carbamoyl...    37   0.094
CAGL0J09240g 911669..912982 highly similar to sp|Q12122 Saccharo...    37   0.095
Scas_704.3                                                             37   0.12 
CAGL0J06402g complement(608851..610146) highly similar to sp|Q12...    37   0.12 
YDL182W (LYS20) [690] chr4 (133438..134724) Homocitrate synthase...    37   0.13 
KLLA0E15444g 1370741..1377427 highly similar to sp|P07259 Saccha...    37   0.14 
Kwal_56.24401                                                          35   0.27 
CAGL0C04917g 457506..460847 highly similar to sp|P03965 Saccharo...    35   0.34 
Kwal_47.19231                                                          35   0.48 
KLLA0D03146g complement(263816..264970) similar to sp|P53164 Sac...    33   1.8  
YHR216W (IMD2) [2500] chr8 (554394..555965) Inosine-5'-monophosp...    32   3.5  

>YGL062W (PYC1) [1917] chr7 (385197..388733) Pyruvate carboxylase 1,
            catalyzes conversion of pyruvate to oxaloacetate in the
            gluconeogenesis pathway [3537 bp, 1178 aa]
          Length = 1178

 Score = 2283 bits (5917), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 1108/1157 (95%), Positives = 1108/1157 (95%)

Query: 1    MSQRKFAGLRDNFNLLGEKNKILVANRGEIPIRIFRTAHELSMQTVAIYSHEDRLSTHKQ 60
            MSQRKFAGLRDNFNLLGEKNKILVANRGEIPIRIFRTAHELSMQTVAIYSHEDRLSTHKQ
Sbjct: 1    MSQRKFAGLRDNFNLLGEKNKILVANRGEIPIRIFRTAHELSMQTVAIYSHEDRLSTHKQ 60

Query: 61   KADEAYVIGEVGQYTPVGAYLAIDEIISIAQKHQVDFIHPGYGFLSENSEFADKVVKAGI 120
            KADEAYVIGEVGQYTPVGAYLAIDEIISIAQKHQVDFIHPGYGFLSENSEFADKVVKAGI
Sbjct: 61   KADEAYVIGEVGQYTPVGAYLAIDEIISIAQKHQVDFIHPGYGFLSENSEFADKVVKAGI 120

Query: 121  TWIGPPAEVIDSVGDKVSARNLAAKANVPTVPGTPGPIETVEEALDFVNEYGYPVIIKAA 180
            TWIGPPAEVIDSVGDKVSARNLAAKANVPTVPGTPGPIETVEEALDFVNEYGYPVIIKAA
Sbjct: 121  TWIGPPAEVIDSVGDKVSARNLAAKANVPTVPGTPGPIETVEEALDFVNEYGYPVIIKAA 180

Query: 181  FXXXXXXXXXXXXXXXXADAFQRATSEARTAFGNGTCFVERFLDKPKHIEVQLLADNHGN 240
            F                ADAFQRATSEARTAFGNGTCFVERFLDKPKHIEVQLLADNHGN
Sbjct: 181  FGGGGRGMRVVREGDDVADAFQRATSEARTAFGNGTCFVERFLDKPKHIEVQLLADNHGN 240

Query: 241  VVHLFERDCSVQRRHQKVVEVAPAKTLPREVRDAILTDAVKLAKECGYRNAGTAEFLVDN 300
            VVHLFERDCSVQRRHQKVVEVAPAKTLPREVRDAILTDAVKLAKECGYRNAGTAEFLVDN
Sbjct: 241  VVHLFERDCSVQRRHQKVVEVAPAKTLPREVRDAILTDAVKLAKECGYRNAGTAEFLVDN 300

Query: 301  QNRHYFIEINPRIQVEHTITEEITXXXXXXXXXXXXXXXSLPQLGLFQDKITTRGFAIQC 360
            QNRHYFIEINPRIQVEHTITEEIT               SLPQLGLFQDKITTRGFAIQC
Sbjct: 301  QNRHYFIEINPRIQVEHTITEEITGIDIVAAQIQIAAGASLPQLGLFQDKITTRGFAIQC 360

Query: 361  RITTEDPAKNFQPDTGRIEVYRSAGGNGVRLDGGNAYAGTIISPHYDSMLVKCSCSGSTY 420
            RITTEDPAKNFQPDTGRIEVYRSAGGNGVRLDGGNAYAGTIISPHYDSMLVKCSCSGSTY
Sbjct: 361  RITTEDPAKNFQPDTGRIEVYRSAGGNGVRLDGGNAYAGTIISPHYDSMLVKCSCSGSTY 420

Query: 421  EIVRRKMIRALIEFRIRGVKTNIPFLLTLLTNPVFIEGTYWTTFIDDTPQLFQMVSSQNR 480
            EIVRRKMIRALIEFRIRGVKTNIPFLLTLLTNPVFIEGTYWTTFIDDTPQLFQMVSSQNR
Sbjct: 421  EIVRRKMIRALIEFRIRGVKTNIPFLLTLLTNPVFIEGTYWTTFIDDTPQLFQMVSSQNR 480

Query: 481  AQKLLHYLADVAVNGSSIKGQIGLPKLKSNPSVPHLHDAQGNVINVTKSAPPSGWRQVLL 540
            AQKLLHYLADVAVNGSSIKGQIGLPKLKSNPSVPHLHDAQGNVINVTKSAPPSGWRQVLL
Sbjct: 481  AQKLLHYLADVAVNGSSIKGQIGLPKLKSNPSVPHLHDAQGNVINVTKSAPPSGWRQVLL 540

Query: 541  EKGPAEFARQVRQFNGTLLMDTTWRDAHQSLLATRVRTHDLATIAPTTAHALAGRFALEC 600
            EKGPAEFARQVRQFNGTLLMDTTWRDAHQSLLATRVRTHDLATIAPTTAHALAGRFALEC
Sbjct: 541  EKGPAEFARQVRQFNGTLLMDTTWRDAHQSLLATRVRTHDLATIAPTTAHALAGRFALEC 600

Query: 601  WGGATFDVAMRFLHEDPWERLRKLRSLVPNIPFQMLLRGANGVAYSSLPDNAIDHFVKQA 660
            WGGATFDVAMRFLHEDPWERLRKLRSLVPNIPFQMLLRGANGVAYSSLPDNAIDHFVKQA
Sbjct: 601  WGGATFDVAMRFLHEDPWERLRKLRSLVPNIPFQMLLRGANGVAYSSLPDNAIDHFVKQA 660

Query: 661  KDNGVDIFRVFDALNDLEQLXXXXXXXXXXXXXXXXXXCFSGDMLQPGKKYNLDYYLEIA 720
            KDNGVDIFRVFDALNDLEQL                  CFSGDMLQPGKKYNLDYYLEIA
Sbjct: 661  KDNGVDIFRVFDALNDLEQLKVGVDAVKKAGGVVEATVCFSGDMLQPGKKYNLDYYLEIA 720

Query: 721  EKIVQMGTHILGIKDMAGTMKPAAAKLLIGSLRAKYPDLPIHVHTHDSAGTAVASMTACA 780
            EKIVQMGTHILGIKDMAGTMKPAAAKLLIGSLRAKYPDLPIHVHTHDSAGTAVASMTACA
Sbjct: 721  EKIVQMGTHILGIKDMAGTMKPAAAKLLIGSLRAKYPDLPIHVHTHDSAGTAVASMTACA 780

Query: 781  LAGADVVDVAINSMSGLTSQPSINALLASLEGNIDTGINVEHVRELDAYWAEMRLLYSCF 840
            LAGADVVDVAINSMSGLTSQPSINALLASLEGNIDTGINVEHVRELDAYWAEMRLLYSCF
Sbjct: 781  LAGADVVDVAINSMSGLTSQPSINALLASLEGNIDTGINVEHVRELDAYWAEMRLLYSCF 840

Query: 841  EADLKGPDPEVYQHEIPGGQLTNLLFQAQQLGLGEQWAETKRAYREANYLLGDIVKVTPT 900
            EADLKGPDPEVYQHEIPGGQLTNLLFQAQQLGLGEQWAETKRAYREANYLLGDIVKVTPT
Sbjct: 841  EADLKGPDPEVYQHEIPGGQLTNLLFQAQQLGLGEQWAETKRAYREANYLLGDIVKVTPT 900

Query: 901  SKVVGDLAQFMVSNKLTSDDVRRLANSLDFPDSVMDFFEGLIGQPYGGFPEPFRSDVLRN 960
            SKVVGDLAQFMVSNKLTSDDVRRLANSLDFPDSVMDFFEGLIGQPYGGFPEPFRSDVLRN
Sbjct: 901  SKVVGDLAQFMVSNKLTSDDVRRLANSLDFPDSVMDFFEGLIGQPYGGFPEPFRSDVLRN 960

Query: 961  KRRKLTCRPGLELEPFDLEKIREDLQNRFGDVDECDVASYNMYPRVYEDFQKMRETYGDL 1020
            KRRKLTCRPGLELEPFDLEKIREDLQNRFGDVDECDVASYNMYPRVYEDFQKMRETYGDL
Sbjct: 961  KRRKLTCRPGLELEPFDLEKIREDLQNRFGDVDECDVASYNMYPRVYEDFQKMRETYGDL 1020

Query: 1021 SVLPTRSFLSPLETDEEIEVVIEQGKTLIIKLQAVGDLNKKTGEREVYFDLNGEMRKIRV 1080
            SVLPTRSFLSPLETDEEIEVVIEQGKTLIIKLQAVGDLNKKTGEREVYFDLNGEMRKIRV
Sbjct: 1021 SVLPTRSFLSPLETDEEIEVVIEQGKTLIIKLQAVGDLNKKTGEREVYFDLNGEMRKIRV 1080

Query: 1081 ADRSQKVETVTKSKADMHDPLHIGAPMAGVIVEVKVHKGSLIKKGQPVAVLSAMKMEMII 1140
            ADRSQKVETVTKSKADMHDPLHIGAPMAGVIVEVKVHKGSLIKKGQPVAVLSAMKMEMII
Sbjct: 1081 ADRSQKVETVTKSKADMHDPLHIGAPMAGVIVEVKVHKGSLIKKGQPVAVLSAMKMEMII 1140

Query: 1141 SSPSDGQVKEVFVSDGE 1157
            SSPSDGQVKEVFVSDGE
Sbjct: 1141 SSPSDGQVKEVFVSDGE 1157

>YBR218C (PYC2) [399] chr2 complement(658664..662206) Pyruvate
            carboxylase 2 [3543 bp, 1180 aa]
          Length = 1180

 Score = 2170 bits (5623), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 1035/1156 (89%), Positives = 1081/1156 (93%)

Query: 2    SQRKFAGLRDNFNLLGEKNKILVANRGEIPIRIFRTAHELSMQTVAIYSHEDRLSTHKQK 61
            S +K AGLRDNF+LLGEKNKILVANRGEIPIRIFR+AHELSM+T+AIYSHEDRLS H+ K
Sbjct: 3    SSKKLAGLRDNFSLLGEKNKILVANRGEIPIRIFRSAHELSMRTIAIYSHEDRLSMHRLK 62

Query: 62   ADEAYVIGEVGQYTPVGAYLAIDEIISIAQKHQVDFIHPGYGFLSENSEFADKVVKAGIT 121
            ADEAYVIGE GQYTPVGAYLA+DEII IA+KH+VDFIHPGYGFLSENSEFADKVVKAGIT
Sbjct: 63   ADEAYVIGEEGQYTPVGAYLAMDEIIEIAKKHKVDFIHPGYGFLSENSEFADKVVKAGIT 122

Query: 122  WIGPPAEVIDSVGDKVSARNLAAKANVPTVPGTPGPIETVEEALDFVNEYGYPVIIKAAF 181
            WIGPPAEVIDSVGDKVSAR+LAA+ANVPTVPGTPGPIETV+EALDFVNEYGYPVIIKAAF
Sbjct: 123  WIGPPAEVIDSVGDKVSARHLAARANVPTVPGTPGPIETVQEALDFVNEYGYPVIIKAAF 182

Query: 182  XXXXXXXXXXXXXXXXADAFQRATSEARTAFGNGTCFVERFLDKPKHIEVQLLADNHGNV 241
                            ADAFQRATSEARTAFGNGTCFVERFLDKPKHIEVQLLADNHGNV
Sbjct: 183  GGGGRGMRVVREGDDVADAFQRATSEARTAFGNGTCFVERFLDKPKHIEVQLLADNHGNV 242

Query: 242  VHLFERDCSVQRRHQKVVEVAPAKTLPREVRDAILTDAVKLAKECGYRNAGTAEFLVDNQ 301
            VHLFERDCSVQRRHQKVVEVAPAKTLPREVRDAILTDAVKLAK CGYRNAGTAEFLVDNQ
Sbjct: 243  VHLFERDCSVQRRHQKVVEVAPAKTLPREVRDAILTDAVKLAKVCGYRNAGTAEFLVDNQ 302

Query: 302  NRHYFIEINPRIQVEHTITEEITXXXXXXXXXXXXXXXSLPQLGLFQDKITTRGFAIQCR 361
            NRHYFIEINPRIQVEHTITEEIT               +L QLGL QDKITTRGF+IQCR
Sbjct: 303  NRHYFIEINPRIQVEHTITEEITGIDIVSAQIQIAAGATLTQLGLLQDKITTRGFSIQCR 362

Query: 362  ITTEDPAKNFQPDTGRIEVYRSAGGNGVRLDGGNAYAGTIISPHYDSMLVKCSCSGSTYE 421
            ITTEDP+KNFQPDTGR+EVYRSAGGNGVRLDGGNAYAG  ISPHYDSMLVKCSCSGSTYE
Sbjct: 363  ITTEDPSKNFQPDTGRLEVYRSAGGNGVRLDGGNAYAGATISPHYDSMLVKCSCSGSTYE 422

Query: 422  IVRRKMIRALIEFRIRGVKTNIPFLLTLLTNPVFIEGTYWTTFIDDTPQLFQMVSSQNRA 481
            IVRRKMIRALIEFRIRGVKTNIPFLLTLLTNPVFIEGTYWTTFIDDTPQLFQMVSSQNRA
Sbjct: 423  IVRRKMIRALIEFRIRGVKTNIPFLLTLLTNPVFIEGTYWTTFIDDTPQLFQMVSSQNRA 482

Query: 482  QKLLHYLADVAVNGSSIKGQIGLPKLKSNPSVPHLHDAQGNVINVTKSAPPSGWRQVLLE 541
            QKLLHYLAD+AVNGSSIKGQIGLPKLKSNPSVPHLHDAQGNVINVTKSAPPSGWRQVLLE
Sbjct: 483  QKLLHYLADLAVNGSSIKGQIGLPKLKSNPSVPHLHDAQGNVINVTKSAPPSGWRQVLLE 542

Query: 542  KGPAEFARQVRQFNGTLLMDTTWRDAHQSLLATRVRTHDLATIAPTTAHALAGRFALECW 601
            KGP+EFA+QVRQFNGTLLMDTTWRDAHQSLLATRVRTHDLATIAPTTAHALAG FALECW
Sbjct: 543  KGPSEFAKQVRQFNGTLLMDTTWRDAHQSLLATRVRTHDLATIAPTTAHALAGAFALECW 602

Query: 602  GGATFDVAMRFLHEDPWERLRKLRSLVPNIPFQMLLRGANGVAYSSLPDNAIDHFVKQAK 661
            GGATFDVAMRFLHEDPWERLRKLRSLVPNIPFQMLLRGANGVAYSSLPDNAIDHFVKQAK
Sbjct: 603  GGATFDVAMRFLHEDPWERLRKLRSLVPNIPFQMLLRGANGVAYSSLPDNAIDHFVKQAK 662

Query: 662  DNGVDIFRVFDALNDLEQLXXXXXXXXXXXXXXXXXXCFSGDMLQPGKKYNLDYYLEIAE 721
            DNGVDIFRVFDALNDLEQL                  C+SGDMLQPGKKYNLDYYLE+ E
Sbjct: 663  DNGVDIFRVFDALNDLEQLKVGVNAVKKAGGVVEATVCYSGDMLQPGKKYNLDYYLEVVE 722

Query: 722  KIVQMGTHILGIKDMAGTMKPAAAKLLIGSLRAKYPDLPIHVHTHDSAGTAVASMTACAL 781
            KIVQMGTHILGIKDMAGTMKPAAAKLLIGSLR +YPDLPIHVH+HDSAGTAVASMTACAL
Sbjct: 723  KIVQMGTHILGIKDMAGTMKPAAAKLLIGSLRTRYPDLPIHVHSHDSAGTAVASMTACAL 782

Query: 782  AGADVVDVAINSMSGLTSQPSINALLASLEGNIDTGINVEHVRELDAYWAEMRLLYSCFE 841
            AGADVVDVAINSMSGLTSQPSINALLASLEGNIDTGINVEHVRELDAYWAEMRLLYSCFE
Sbjct: 783  AGADVVDVAINSMSGLTSQPSINALLASLEGNIDTGINVEHVRELDAYWAEMRLLYSCFE 842

Query: 842  ADLKGPDPEVYQHEIPGGQLTNLLFQAQQLGLGEQWAETKRAYREANYLLGDIVKVTPTS 901
            ADLKGPDPEVYQHEIPGGQLTNLLFQAQQLGLGEQWAETKRAYREANYLLGDIVKVTPTS
Sbjct: 843  ADLKGPDPEVYQHEIPGGQLTNLLFQAQQLGLGEQWAETKRAYREANYLLGDIVKVTPTS 902

Query: 902  KVVGDLAQFMVSNKLTSDDVRRLANSLDFPDSVMDFFEGLIGQPYGGFPEPFRSDVLRNK 961
            KVVGDLAQFMVSNKLTSDD+RRLANSLDFPDSVMDFFEGLIGQPYGGFPEP RSDVLRNK
Sbjct: 903  KVVGDLAQFMVSNKLTSDDIRRLANSLDFPDSVMDFFEGLIGQPYGGFPEPLRSDVLRNK 962

Query: 962  RRKLTCRPGLELEPFDLEKIREDLQNRFGDVDECDVASYNMYPRVYEDFQKMRETYGDLS 1021
            RRKLTCRPGLELEPFDLEKIREDLQNRFGD+DECDVASYNMYPRVYEDFQK+RETYGDLS
Sbjct: 963  RRKLTCRPGLELEPFDLEKIREDLQNRFGDIDECDVASYNMYPRVYEDFQKIRETYGDLS 1022

Query: 1022 VLPTRSFLSPLETDEEIEVVIEQGKTLIIKLQAVGDLNKKTGEREVYFDLNGEMRKIRVA 1081
            VLPT++FL+P E DEEIEV IEQGKTLIIKLQAVGDLNKKTG+REVYF+LNGE+RKIRVA
Sbjct: 1023 VLPTKNFLAPAEPDEEIEVTIEQGKTLIIKLQAVGDLNKKTGQREVYFELNGELRKIRVA 1082

Query: 1082 DRSQKVETVTKSKADMHDPLHIGAPMAGVIVEVKVHKGSLIKKGQPVAVLSAMKMEMIIS 1141
            D+SQ +++V K KAD+HD   IGAPMAGVI+EVKVHKGSL+KKG+ +AVLSAMKMEM++S
Sbjct: 1083 DKSQNIQSVAKPKADVHDTHQIGAPMAGVIIEVKVHKGSLVKKGESIAVLSAMKMEMVVS 1142

Query: 1142 SPSDGQVKEVFVSDGE 1157
            SP+DGQVK+VF+ DGE
Sbjct: 1143 SPADGQVKDVFIKDGE 1158

>Scas_686.17
          Length = 1176

 Score = 2057 bits (5330), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 979/1156 (84%), Positives = 1050/1156 (90%), Gaps = 1/1156 (0%)

Query: 1    MSQRKFAGLRDNFNLLGEKNKILVANRGEIPIRIFRTAHELSMQTVAIYSHEDRLSTHKQ 60
            M+  K +GLRDNF+LLGEKNKILVANRGEIPIRIFR+AHELSM+TVAIYSHEDRLSTH+ 
Sbjct: 1    MAHMKLSGLRDNFSLLGEKNKILVANRGEIPIRIFRSAHELSMRTVAIYSHEDRLSTHRL 60

Query: 61   KADEAYVIGEVGQYTPVGAYLAIDEIISIAQKHQVDFIHPGYGFLSENSEFADKVVKAGI 120
            KADE+YVIGE GQ+TPVGAYLAIDEII+IA+KH+VDFIHPGYGFLSENSEFADKV KAGI
Sbjct: 61   KADESYVIGEEGQFTPVGAYLAIDEIINIAKKHKVDFIHPGYGFLSENSEFADKVAKAGI 120

Query: 121  TWIGPPAEVIDSVGDKVSARNLAAKANVPTVPGTPGPIETVEEALDFVNEYGYPVIIKAA 180
            TWIGPPAEVIDSVGDKVSAR LAA+A+VPTVPGTPGPI++V+EA DFV +YGYPVIIKAA
Sbjct: 121  TWIGPPAEVIDSVGDKVSARYLAARADVPTVPGTPGPIKSVKEAEDFVAQYGYPVIIKAA 180

Query: 181  FXXXXXXXXXXXXXXXXADAFQRATSEARTAFGNGTCFVERFLDKPKHIEVQLLADNHGN 240
            F                 DAFQRA+SEA TAFG+GTCFVERFLD PKHIEVQLL DN+GN
Sbjct: 181  FGGGGRGMRVVREGEDINDAFQRASSEALTAFGDGTCFVERFLDHPKHIEVQLLGDNYGN 240

Query: 241  VVHLFERDCSVQRRHQKVVEVAPAKTLPREVRDAILTDAVKLAKECGYRNAGTAEFLVDN 300
            VVHLFERDCSVQRRHQKVVEVAPAK +PREVRDAILTDAVKLAKECGYRNAGTAEFLVDN
Sbjct: 241  VVHLFERDCSVQRRHQKVVEVAPAKNIPREVRDAILTDAVKLAKECGYRNAGTAEFLVDN 300

Query: 301  QNRHYFIEINPRIQVEHTITEEITXXXXXXXXXXXXXXXSLPQLGLFQDKITTRGFAIQC 360
            QNRHYFIEINPRIQVEHTITEEIT               SL QLGL QD+ITTRGFAIQC
Sbjct: 301  QNRHYFIEINPRIQVEHTITEEITGIDLVAAQIQIAAGASLAQLGLLQDRITTRGFAIQC 360

Query: 361  RITTEDPAKNFQPDTGRIEVYRSAGGNGVRLDGGNAYAGTIISPHYDSMLVKCSCSGSTY 420
            RITTEDPAKNFQPDTGR+EVYRSAGGNGVRLDGGNAYAG +ISPHYDSMLVKCSCSGSTY
Sbjct: 361  RITTEDPAKNFQPDTGRLEVYRSAGGNGVRLDGGNAYAGAVISPHYDSMLVKCSCSGSTY 420

Query: 421  EIVRRKMIRALIEFRIRGVKTNIPFLLTLLTNPVFIEGTYWTTFIDDTPQLFQMVSSQNR 480
            EIVRRKMIRALIEFRIRGVKTNIPFLLTLLT+PVFI G YWTTFIDDTPQLF+MVSSQNR
Sbjct: 421  EIVRRKMIRALIEFRIRGVKTNIPFLLTLLTHPVFISGDYWTTFIDDTPQLFKMVSSQNR 480

Query: 481  AQKLLHYLADVAVNGSSIKGQIGLPKLKSNPSVPHLHDAQGNVINVTKSAPPSGWRQVLL 540
            AQKLLHYLAD+AVNGSSIKGQIGLPKLK NP VPHLHDA+GNVINV  + P +GWR+VLL
Sbjct: 481  AQKLLHYLADLAVNGSSIKGQIGLPKLKKNPDVPHLHDAEGNVINVA-TPPTAGWRKVLL 539

Query: 541  EKGPAEFARQVRQFNGTLLMDTTWRDAHQSLLATRVRTHDLATIAPTTAHALAGRFALEC 600
            E+GPAEFA+QVR F GTLLMDTTWRDAHQSLLATRVRTHDLATIAPTTAHAL+G FALEC
Sbjct: 540  EQGPAEFAKQVRNFQGTLLMDTTWRDAHQSLLATRVRTHDLATIAPTTAHALSGAFALEC 599

Query: 601  WGGATFDVAMRFLHEDPWERLRKLRSLVPNIPFQMLLRGANGVAYSSLPDNAIDHFVKQA 660
            WGGATFDVAMRFLHEDPW RLR LR LVPNIPFQMLLRGANGVAYSSLPDNAIDHFVKQA
Sbjct: 600  WGGATFDVAMRFLHEDPWARLRTLRKLVPNIPFQMLLRGANGVAYSSLPDNAIDHFVKQA 659

Query: 661  KDNGVDIFRVFDALNDLEQLXXXXXXXXXXXXXXXXXXCFSGDMLQPGKKYNLDYYLEIA 720
            KDNGVDIFRVFDALNDL+QL                  C+SGDMLQPGKKYNLDYYLE+ 
Sbjct: 660  KDNGVDIFRVFDALNDLDQLKVGVDAVKKAGGVVEATVCYSGDMLQPGKKYNLDYYLEVT 719

Query: 721  EKIVQMGTHILGIKDMAGTMKPAAAKLLIGSLRAKYPDLPIHVHTHDSAGTAVASMTACA 780
            EKIVQMGTHILGIKDMAGTMKPAAA+LLIGS+RAKYPDLPIHVHTHDSAGTAV+SMT  A
Sbjct: 720  EKIVQMGTHILGIKDMAGTMKPAAARLLIGSIRAKYPDLPIHVHTHDSAGTAVSSMTVAA 779

Query: 781  LAGADVVDVAINSMSGLTSQPSINALLASLEGNIDTGINVEHVRELDAYWAEMRLLYSCF 840
            L+GADVVDVAINSMSGLTSQPSINALLASL+G IDTGINV++VRELDAYWAEMRLLYSCF
Sbjct: 780  LSGADVVDVAINSMSGLTSQPSINALLASLDGQIDTGINVQNVRELDAYWAEMRLLYSCF 839

Query: 841  EADLKGPDPEVYQHEIPGGQLTNLLFQAQQLGLGEQWAETKRAYREANYLLGDIVKVTPT 900
            EADLKGPD EVYQHEIPGGQLTNLLFQAQQ GLGEQWAETKRAYREANYLLGDIVKVTPT
Sbjct: 840  EADLKGPDAEVYQHEIPGGQLTNLLFQAQQQGLGEQWAETKRAYREANYLLGDIVKVTPT 899

Query: 901  SKVVGDLAQFMVSNKLTSDDVRRLANSLDFPDSVMDFFEGLIGQPYGGFPEPFRSDVLRN 960
            SKVVGDLAQFMV+NK  SDD++RLAN+LDFPDS+MDFFEGLIGQPYGGFPEP RSD+LRN
Sbjct: 900  SKVVGDLAQFMVTNKFNSDDIKRLANTLDFPDSIMDFFEGLIGQPYGGFPEPLRSDILRN 959

Query: 961  KRRKLTCRPGLELEPFDLEKIREDLQNRFGDVDECDVASYNMYPRVYEDFQKMRETYGDL 1020
            KRRKLT RPGLEL PF+++ IREDL+ RFGD+DECD+ASYNMYP+VYEDFQK++E YGDL
Sbjct: 960  KRRKLTTRPGLELAPFNMQDIREDLETRFGDIDECDIASYNMYPKVYEDFQKIKEKYGDL 1019

Query: 1021 SVLPTRSFLSPLETDEEIEVVIEQGKTLIIKLQAVGDLNKKTGEREVYFDLNGEMRKIRV 1080
            SVLPT+SFLSPL+ DEEIEV IEQGKTLI+KLQA+GDLNK TG REVYFDLNGE+RKIRV
Sbjct: 1020 SVLPTKSFLSPLDVDEEIEVTIEQGKTLIVKLQAIGDLNKATGVREVYFDLNGELRKIRV 1079

Query: 1081 ADRSQKVETVTKSKADMHDPLHIGAPMAGVIVEVKVHKGSLIKKGQPVAVLSAMKMEMII 1140
             DRSQKVET+ K KAD HDP  IGAPMAGV+VEVKVHKGSL+KKG+ VAVLSAMKMEM+I
Sbjct: 1080 VDRSQKVETIAKPKADAHDPYQIGAPMAGVVVEVKVHKGSLVKKGEAVAVLSAMKMEMVI 1139

Query: 1141 SSPSDGQVKEVFVSDG 1156
            SSP+DGQVKEV VS+G
Sbjct: 1140 SSPADGQVKEVLVSNG 1155

>CAGL0F06941g 679960..683502 highly similar to sp|P11154 Saccharomyces
            cerevisiae YGL062w PYC1 pyruvate carboxylase or sp|P32327
            Saccharomyces cerevisiae YBR218c PYC2, hypothetical start
          Length = 1180

 Score = 2041 bits (5288), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 974/1155 (84%), Positives = 1041/1155 (90%)

Query: 3    QRKFAGLRDNFNLLGEKNKILVANRGEIPIRIFRTAHELSMQTVAIYSHEDRLSTHKQKA 62
            ++K AGLR NFN+LGEK+KILVANRGEIPIRIFRTAHELSM+TVAIYSHEDRLSTH+ KA
Sbjct: 7    KKKLAGLRANFNILGEKDKILVANRGEIPIRIFRTAHELSMRTVAIYSHEDRLSTHRLKA 66

Query: 63   DEAYVIGEVGQYTPVGAYLAIDEIISIAQKHQVDFIHPGYGFLSENSEFADKVVKAGITW 122
            DEAYVIGE GQYTPVGAYLAIDEII IA+KH VDFIHPGYGFLSENSEFADKV KAGITW
Sbjct: 67   DEAYVIGEEGQYTPVGAYLAIDEIIDIAKKHGVDFIHPGYGFLSENSEFADKVQKAGITW 126

Query: 123  IGPPAEVIDSVGDKVSARNLAAKANVPTVPGTPGPIETVEEALDFVNEYGYPVIIKAAFX 182
            IGPP EVI+SVGDKVSARNLAAKA VPTVPGTPGPI+TVEEA  FV EYGYPVIIKAA+ 
Sbjct: 127  IGPPPEVIESVGDKVSARNLAAKAKVPTVPGTPGPIKTVEEAEAFVAEYGYPVIIKAAYG 186

Query: 183  XXXXXXXXXXXXXXXADAFQRATSEARTAFGNGTCFVERFLDKPKHIEVQLLADNHGNVV 242
                            DAFQRATSEA+TAFGNGTCFVERFLDKPKHIEVQLLADNHGNV+
Sbjct: 187  GGGRGMRVVREGEDIGDAFQRATSEAKTAFGNGTCFVERFLDKPKHIEVQLLADNHGNVI 246

Query: 243  HLFERDCSVQRRHQKVVEVAPAKTLPREVRDAILTDAVKLAKECGYRNAGTAEFLVDNQN 302
            HLFERDCSVQRRHQKVVEVAPAKTLPR+VRDAILTDAVKLAKE GYRNAGTAEFLVDNQN
Sbjct: 247  HLFERDCSVQRRHQKVVEVAPAKTLPRDVRDAILTDAVKLAKEAGYRNAGTAEFLVDNQN 306

Query: 303  RHYFIEINPRIQVEHTITEEITXXXXXXXXXXXXXXXSLPQLGLFQDKITTRGFAIQCRI 362
            RHYFIEINPRIQVEHTITEEIT               SL +LGL QD+ITTRGFAIQCRI
Sbjct: 307  RHYFIEINPRIQVEHTITEEITGIDIVAAQIQIAAGASLTELGLLQDRITTRGFAIQCRI 366

Query: 363  TTEDPAKNFQPDTGRIEVYRSAGGNGVRLDGGNAYAGTIISPHYDSMLVKCSCSGSTYEI 422
            TTEDPAKNFQPDTGRIEVY S GGNGVRLDGGNAYAG +ISPHYDSMLVKCSCSGSTYEI
Sbjct: 367  TTEDPAKNFQPDTGRIEVYGSTGGNGVRLDGGNAYAGAVISPHYDSMLVKCSCSGSTYEI 426

Query: 423  VRRKMIRALIEFRIRGVKTNIPFLLTLLTNPVFIEGTYWTTFIDDTPQLFQMVSSQNRAQ 482
            VRRK+IRALIEFRIRGVKTNIPFLLTLLT+PVFI G YWTTFIDDTPQLF MVSSQNRAQ
Sbjct: 427  VRRKIIRALIEFRIRGVKTNIPFLLTLLTHPVFISGQYWTTFIDDTPQLFHMVSSQNRAQ 486

Query: 483  KLLHYLADVAVNGSSIKGQIGLPKLKSNPSVPHLHDAQGNVINVTKSAPPSGWRQVLLEK 542
            KLLHYLAD+AVNGSSIKGQIGLPKL + P++PHLHD +G +I+VTK APP GWRQVLLEK
Sbjct: 487  KLLHYLADLAVNGSSIKGQIGLPKLSTKPNIPHLHDEKGEIISVTKVAPPDGWRQVLLEK 546

Query: 543  GPAEFARQVRQFNGTLLMDTTWRDAHQSLLATRVRTHDLATIAPTTAHALAGRFALECWG 602
            GP  FA+ VR F GTLLMDTTWRDAHQSLLATRVRTHDLA IAPTTAHALAG FALECWG
Sbjct: 547  GPEGFAKAVRAFKGTLLMDTTWRDAHQSLLATRVRTHDLAAIAPTTAHALAGAFALECWG 606

Query: 603  GATFDVAMRFLHEDPWERLRKLRSLVPNIPFQMLLRGANGVAYSSLPDNAIDHFVKQAKD 662
            GATFDVAMRFLHEDPWERLR LR LVPNIPFQMLLRGANGVAYSSLPDNAIDHFVKQAKD
Sbjct: 607  GATFDVAMRFLHEDPWERLRVLRKLVPNIPFQMLLRGANGVAYSSLPDNAIDHFVKQAKD 666

Query: 663  NGVDIFRVFDALNDLEQLXXXXXXXXXXXXXXXXXXCFSGDMLQPGKKYNLDYYLEIAEK 722
            NGVDIFRVFDALNDLEQL                  C+SGDMLQPGKKYNLDYYLE+ +K
Sbjct: 667  NGVDIFRVFDALNDLEQLKVGVDAVKKAGGVVEATVCYSGDMLQPGKKYNLDYYLEVTDK 726

Query: 723  IVQMGTHILGIKDMAGTMKPAAAKLLIGSLRAKYPDLPIHVHTHDSAGTAVASMTACALA 782
            IV+MGTH+LGIKDMAGT+KP AAKLLIGS+RAKYPDLPIHVH+HDSAGTAVASM ACA A
Sbjct: 727  IVEMGTHVLGIKDMAGTLKPTAAKLLIGSIRAKYPDLPIHVHSHDSAGTAVASMAACAFA 786

Query: 783  GADVVDVAINSMSGLTSQPSINALLASLEGNIDTGINVEHVRELDAYWAEMRLLYSCFEA 842
            GADVVDVAINSMSG+TSQ SINALLASL+G IDTG+NV+H RELDAYWAEMRLLYSCFEA
Sbjct: 787  GADVVDVAINSMSGMTSQASINALLASLDGEIDTGVNVKHARELDAYWAEMRLLYSCFEA 846

Query: 843  DLKGPDPEVYQHEIPGGQLTNLLFQAQQLGLGEQWAETKRAYREANYLLGDIVKVTPTSK 902
            DLKGPDPEVY HEIPGGQLTNLLFQAQQLGLGE+W ETKRAY+EAN+LLGDIVKVTPTSK
Sbjct: 847  DLKGPDPEVYDHEIPGGQLTNLLFQAQQLGLGEKWIETKRAYKEANHLLGDIVKVTPTSK 906

Query: 903  VVGDLAQFMVSNKLTSDDVRRLANSLDFPDSVMDFFEGLIGQPYGGFPEPFRSDVLRNKR 962
            VVGDLAQFMV+N+LTS+DV+RLANSLDFPDSVMDFFEGL+GQPYGGFPEP RSD+LRNKR
Sbjct: 907  VVGDLAQFMVTNQLTSEDVKRLANSLDFPDSVMDFFEGLMGQPYGGFPEPLRSDILRNKR 966

Query: 963  RKLTCRPGLELEPFDLEKIREDLQNRFGDVDECDVASYNMYPRVYEDFQKMRETYGDLSV 1022
            RKLT RPGLELEPFDLE IREDL+NRFG++DECDVASYNMYP+VYEDFQKM+E YGDLSV
Sbjct: 967  RKLTVRPGLELEPFDLESIREDLENRFGEIDECDVASYNMYPKVYEDFQKMKELYGDLSV 1026

Query: 1023 LPTRSFLSPLETDEEIEVVIEQGKTLIIKLQAVGDLNKKTGEREVYFDLNGEMRKIRVAD 1082
            LPT++FL+P    E+IEV +EQGKTLIIKLQAVGDLNK+TG R+VYF+LNGEMRKIRV D
Sbjct: 1027 LPTKNFLAPPSIGEDIEVHLEQGKTLIIKLQAVGDLNKETGMRDVYFELNGEMRKIRVPD 1086

Query: 1083 RSQKVETVTKSKADMHDPLHIGAPMAGVIVEVKVHKGSLIKKGQPVAVLSAMKMEMIISS 1142
            RSQKVE V+K KAD HDP  IGAPMAGVIVEVKVHKGSL+KKGQPVA+LSAMKMEM++SS
Sbjct: 1087 RSQKVEKVSKPKADNHDPFQIGAPMAGVIVEVKVHKGSLVKKGQPVAILSAMKMEMVVSS 1146

Query: 1143 PSDGQVKEVFVSDGE 1157
             +DGQVK+VFV D E
Sbjct: 1147 QADGQVKDVFVKDAE 1161

>Kwal_14.1803
          Length = 1174

 Score = 2014 bits (5217), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 961/1153 (83%), Positives = 1039/1153 (90%)

Query: 5    KFAGLRDNFNLLGEKNKILVANRGEIPIRIFRTAHELSMQTVAIYSHEDRLSTHKQKADE 64
            K AGLRD+ NLLGEKNKILVANRGEIPIRIFR+AHELSM+TVAIYSHEDRLS H+ KADE
Sbjct: 3    KLAGLRDSSNLLGEKNKILVANRGEIPIRIFRSAHELSMKTVAIYSHEDRLSMHRLKADE 62

Query: 65   AYVIGEVGQYTPVGAYLAIDEIISIAQKHQVDFIHPGYGFLSENSEFADKVVKAGITWIG 124
            AY+IG+ G+YTPVGAYLAIDEI+ IA++H VDFIHPGYGFLSENSEFA KV +AGITWIG
Sbjct: 63   AYMIGKQGKYTPVGAYLAIDEILEIAKEHNVDFIHPGYGFLSENSEFARKVEEAGITWIG 122

Query: 125  PPAEVIDSVGDKVSARNLAAKANVPTVPGTPGPIETVEEALDFVNEYGYPVIIKAAFXXX 184
            P AEVIDSVGDKVSARNLAAKANVP VPGTPGPI++VEEA  FV EYGYPVIIKAAF   
Sbjct: 123  PSAEVIDSVGDKVSARNLAAKANVPVVPGTPGPIDSVEEAQAFVAEYGYPVIIKAAFGGG 182

Query: 185  XXXXXXXXXXXXXADAFQRATSEARTAFGNGTCFVERFLDKPKHIEVQLLADNHGNVVHL 244
                         ADAFQRATSEA+T+FGNGTCF+ERFL+KPKHIEVQLLAD +GNVVHL
Sbjct: 183  GRGMRVVREGDDIADAFQRATSEAKTSFGNGTCFIERFLNKPKHIEVQLLADGYGNVVHL 242

Query: 245  FERDCSVQRRHQKVVEVAPAKTLPREVRDAILTDAVKLAKECGYRNAGTAEFLVDNQNRH 304
            FERDCSVQRRHQKVVEVAPAKTLP++VRDAILTDAVKLA    Y+NAGTAEFLVD+QNRH
Sbjct: 243  FERDCSVQRRHQKVVEVAPAKTLPKDVRDAILTDAVKLASVANYKNAGTAEFLVDDQNRH 302

Query: 305  YFIEINPRIQVEHTITEEITXXXXXXXXXXXXXXXSLPQLGLFQDKITTRGFAIQCRITT 364
            YFIEINPRIQVEHTITEEIT               SL QLGL QD+ITTRGFAIQCRITT
Sbjct: 303  YFIEINPRIQVEHTITEEITGIDIVAAQIQIAAGASLQQLGLLQDRITTRGFAIQCRITT 362

Query: 365  EDPAKNFQPDTGRIEVYRSAGGNGVRLDGGNAYAGTIISPHYDSMLVKCSCSGSTYEIVR 424
            EDPAKNFQPDTGRIEVYRSAGGNGVRLDGGNAYAG+IISPHYDSMLVKCSCSGSTYEIVR
Sbjct: 363  EDPAKNFQPDTGRIEVYRSAGGNGVRLDGGNAYAGSIISPHYDSMLVKCSCSGSTYEIVR 422

Query: 425  RKMIRALIEFRIRGVKTNIPFLLTLLTNPVFIEGTYWTTFIDDTPQLFQMVSSQNRAQKL 484
            RKM+RALIEFRIRGVKTNIPFLLTLLTNPVFI+GTYWTTFIDDTP+LF+MVSSQNRAQKL
Sbjct: 423  RKMLRALIEFRIRGVKTNIPFLLTLLTNPVFIDGTYWTTFIDDTPELFKMVSSQNRAQKL 482

Query: 485  LHYLADVAVNGSSIKGQIGLPKLKSNPSVPHLHDAQGNVINVTKSAPPSGWRQVLLEKGP 544
            LHYLAD+AVNGSSIKGQ+GLPKL + P+VP +HDAQGNVI+V  +APPSGWRQVLLEKGP
Sbjct: 483  LHYLADLAVNGSSIKGQMGLPKLHTQPTVPPIHDAQGNVIDVLTTAPPSGWRQVLLEKGP 542

Query: 545  AEFARQVRQFNGTLLMDTTWRDAHQSLLATRVRTHDLATIAPTTAHALAGRFALECWGGA 604
            AEFA+ VR+ NGTLLMDTTWRDAHQSLLATRVRT+DLA IAPTTAHAL+G FALECWGGA
Sbjct: 543  AEFAKAVRENNGTLLMDTTWRDAHQSLLATRVRTYDLAAIAPTTAHALSGAFALECWGGA 602

Query: 605  TFDVAMRFLHEDPWERLRKLRSLVPNIPFQMLLRGANGVAYSSLPDNAIDHFVKQAKDNG 664
            TFDVAMRFLHEDPWERLR LR LVPNIPFQMLLRGANGVAYSSLPDNAIDHFVKQAK+NG
Sbjct: 603  TFDVAMRFLHEDPWERLRVLRKLVPNIPFQMLLRGANGVAYSSLPDNAIDHFVKQAKENG 662

Query: 665  VDIFRVFDALNDLEQLXXXXXXXXXXXXXXXXXXCFSGDMLQPGKKYNLDYYLEIAEKIV 724
            VDIFRVFDALNDLEQL                  C+SGDMLQ GKKYNLDYYLEI +KIV
Sbjct: 663  VDIFRVFDALNDLEQLKVGVDAVKKAKGVVEATICYSGDMLQSGKKYNLDYYLEITDKIV 722

Query: 725  QMGTHILGIKDMAGTMKPAAAKLLIGSLRAKYPDLPIHVHTHDSAGTAVASMTACALAGA 784
             MGTHILGIKDMAGT+KP+AAKLLIGS+RAKYPDLPIHVHTHDSAGTAVASM ACA AGA
Sbjct: 723  AMGTHILGIKDMAGTLKPSAAKLLIGSIRAKYPDLPIHVHTHDSAGTAVASMAACAFAGA 782

Query: 785  DVVDVAINSMSGLTSQPSINALLASLEGNIDTGINVEHVRELDAYWAEMRLLYSCFEADL 844
            DVVDVA NSMSGLTSQPSINALLASL+G I+T INV  VRELDAYWA+MRLLYSCFEADL
Sbjct: 783  DVVDVATNSMSGLTSQPSINALLASLDGEIETNINVNMVRELDAYWAQMRLLYSCFEADL 842

Query: 845  KGPDPEVYQHEIPGGQLTNLLFQAQQLGLGEQWAETKRAYREANYLLGDIVKVTPTSKVV 904
            KGPDPEVYQHEIPGGQLTNLLFQAQQLGLGE+W+ETKRAYREANYLLGD+VKVTPTSKVV
Sbjct: 843  KGPDPEVYQHEIPGGQLTNLLFQAQQLGLGEKWSETKRAYREANYLLGDLVKVTPTSKVV 902

Query: 905  GDLAQFMVSNKLTSDDVRRLANSLDFPDSVMDFFEGLIGQPYGGFPEPFRSDVLRNKRRK 964
            GDLAQFMVSNKL+SDDVRRLA+SLDFPDSVMDFFEGLIGQPYGGFPEP RSDVL+NKRRK
Sbjct: 903  GDLAQFMVSNKLSSDDVRRLASSLDFPDSVMDFFEGLIGQPYGGFPEPLRSDVLKNKRRK 962

Query: 965  LTCRPGLELEPFDLEKIREDLQNRFGDVDECDVASYNMYPRVYEDFQKMRETYGDLSVLP 1024
            LTCRPGLE+ PFDL KI+EDLQ+RFGD++ECDVASYNMYP+VYEDF+K+RETYGDLSVLP
Sbjct: 963  LTCRPGLEMAPFDLAKIKEDLQDRFGDIEECDVASYNMYPKVYEDFRKIRETYGDLSVLP 1022

Query: 1025 TRSFLSPLETDEEIEVVIEQGKTLIIKLQAVGDLNKKTGEREVYFDLNGEMRKIRVADRS 1084
            T++FLSP    EEI V IE+GKTLIIK QA+G+LNK+TG REVYFDLNGE+RK+ V D+S
Sbjct: 1023 TKNFLSPPTVGEEIVVTIEKGKTLIIKPQAIGELNKETGLREVYFDLNGELRKVAVVDKS 1082

Query: 1085 QKVETVTKSKADMHDPLHIGAPMAGVIVEVKVHKGSLIKKGQPVAVLSAMKMEMIISSPS 1144
            QKV+ ++K KAD HD   IGAPMAGVI+EVKVH GSL+K+GQPVAVLSAMKMEM+ISSP 
Sbjct: 1083 QKVDLISKPKADAHDSYQIGAPMAGVIIEVKVHTGSLVKQGQPVAVLSAMKMEMVISSPI 1142

Query: 1145 DGQVKEVFVSDGE 1157
            DGQVKEV V DGE
Sbjct: 1143 DGQVKEVLVKDGE 1155

>Scas_563.12
          Length = 1216

 Score = 2004 bits (5191), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 958/1158 (82%), Positives = 1033/1158 (89%), Gaps = 4/1158 (0%)

Query: 4    RKFAGLRDNFNLLGEKNK----ILVANRGEIPIRIFRTAHELSMQTVAIYSHEDRLSTHK 59
            +K  G RDNFNLLG +N+    I+V +    P+  FR+AHELSMQTVAIYSHEDRLSTH+
Sbjct: 41   KKLNGPRDNFNLLGTRNRFLSPIVVKSPSYPPVCNFRSAHELSMQTVAIYSHEDRLSTHR 100

Query: 60   QKADEAYVIGEVGQYTPVGAYLAIDEIISIAQKHQVDFIHPGYGFLSENSEFADKVVKAG 119
             KADE+YVIGE  Q+TPVGAYLAIDEII+IA++H VD+IHPGYGFLSENSEFADKV KAG
Sbjct: 101  LKADESYVIGEPHQFTPVGAYLAIDEIINIAKRHGVDYIHPGYGFLSENSEFADKVAKAG 160

Query: 120  ITWIGPPAEVIDSVGDKVSARNLAAKANVPTVPGTPGPIETVEEALDFVNEYGYPVIIKA 179
            ITWIGPPA VIDSVGDKVSARNLA KANVPTVPGTPGPI TV++A DFVNEYGYPVIIKA
Sbjct: 161  ITWIGPPASVIDSVGDKVSARNLATKANVPTVPGTPGPIRTVQDAQDFVNEYGYPVIIKA 220

Query: 180  AFXXXXXXXXXXXXXXXXADAFQRATSEARTAFGNGTCFVERFLDKPKHIEVQLLADNHG 239
            AF                ADAFQRA+SEA TAFG+GTCFVERFL+KPKHIEVQLLAD HG
Sbjct: 221  AFGGGGRGMRVVNEGDDLADAFQRASSEALTAFGDGTCFVERFLNKPKHIEVQLLADTHG 280

Query: 240  NVVHLFERDCSVQRRHQKVVEVAPAKTLPREVRDAILTDAVKLAKECGYRNAGTAEFLVD 299
            NV+HLFERDCSVQRRHQKVVEVAPAKTLPREVRDAILTDAVKLAKECGY+NAGTAEFLVD
Sbjct: 281  NVIHLFERDCSVQRRHQKVVEVAPAKTLPREVRDAILTDAVKLAKECGYQNAGTAEFLVD 340

Query: 300  NQNRHYFIEINPRIQVEHTITEEITXXXXXXXXXXXXXXXSLPQLGLFQDKITTRGFAIQ 359
            +QNRHYFIEINPRIQVEHTITEEIT               SL QLGL QDKITTRGFAIQ
Sbjct: 341  DQNRHYFIEINPRIQVEHTITEEITGIDIVAAQIQIAAGASLEQLGLLQDKITTRGFAIQ 400

Query: 360  CRITTEDPAKNFQPDTGRIEVYRSAGGNGVRLDGGNAYAGTIISPHYDSMLVKCSCSGST 419
            CRITTEDPAKNFQPDTGR+EVY SAGGNGVRLDGGNAYAG IISPHYDSMLVKCSCSGST
Sbjct: 401  CRITTEDPAKNFQPDTGRLEVYDSAGGNGVRLDGGNAYAGAIISPHYDSMLVKCSCSGST 460

Query: 420  YEIVRRKMIRALIEFRIRGVKTNIPFLLTLLTNPVFIEGTYWTTFIDDTPQLFQMVSSQN 479
            YE+VRRKMIRALIEFRIRGVKTNIPFLLTLLT+PVFI G YWTTFIDDTPQLF+MVSSQN
Sbjct: 461  YEVVRRKMIRALIEFRIRGVKTNIPFLLTLLTHPVFIAGDYWTTFIDDTPQLFKMVSSQN 520

Query: 480  RAQKLLHYLADVAVNGSSIKGQIGLPKLKSNPSVPHLHDAQGNVINVTKSAPPSGWRQVL 539
            RAQKLLHYLAD+AVNGSSIKGQ+G+P+LK  P +PH+HDAQGNVI+VT   PP+GWRQVL
Sbjct: 521  RAQKLLHYLADLAVNGSSIKGQVGIPQLKKVPDIPHIHDAQGNVIDVTNVPPPAGWRQVL 580

Query: 540  LEKGPAEFARQVRQFNGTLLMDTTWRDAHQSLLATRVRTHDLATIAPTTAHALAGRFALE 599
            LE+GP EFA+QVRQF GTLLMDTTWRDAHQSLLATRVRTHDLA IAPTTAHALA  FALE
Sbjct: 581  LEQGPEEFAKQVRQFQGTLLMDTTWRDAHQSLLATRVRTHDLAKIAPTTAHALASAFALE 640

Query: 600  CWGGATFDVAMRFLHEDPWERLRKLRSLVPNIPFQMLLRGANGVAYSSLPDNAIDHFVKQ 659
            CWGGATFDVAMRFLHEDPW+RLR LR LVPNIPFQMLLRGANGVAYSSLPDNAIDHFVKQ
Sbjct: 641  CWGGATFDVAMRFLHEDPWKRLRTLRKLVPNIPFQMLLRGANGVAYSSLPDNAIDHFVKQ 700

Query: 660  AKDNGVDIFRVFDALNDLEQLXXXXXXXXXXXXXXXXXXCFSGDMLQPGKKYNLDYYLEI 719
            AKDNGVDIFRVFDALNDL+QL                  C+SGDMLQPGKKYNLDYYLE+
Sbjct: 701  AKDNGVDIFRVFDALNDLDQLKVGVDAVKKAGGVVEATVCYSGDMLQPGKKYNLDYYLEV 760

Query: 720  AEKIVQMGTHILGIKDMAGTMKPAAAKLLIGSLRAKYPDLPIHVHTHDSAGTAVASMTAC 779
             EKIVQMGTHILGIKDMAGTMKPAAA+LLIGS+RAKYPDLPIHVHTHDSAGTAVASM+A 
Sbjct: 761  TEKIVQMGTHILGIKDMAGTMKPAAARLLIGSIRAKYPDLPIHVHTHDSAGTAVASMSAA 820

Query: 780  ALAGADVVDVAINSMSGLTSQPSINALLASLEGNIDTGINVEHVRELDAYWAEMRLLYSC 839
            A AGADV+DVA NSMSGLTSQPSINALLASL+G I+T INV+HVRELDAYWAEMRLLYSC
Sbjct: 821  AYAGADVIDVATNSMSGLTSQPSINALLASLDGEINTSINVQHVRELDAYWAEMRLLYSC 880

Query: 840  FEADLKGPDPEVYQHEIPGGQLTNLLFQAQQLGLGEQWAETKRAYREANYLLGDIVKVTP 899
            F ADLKGPDPEVY+HEIPGGQLTNLLFQAQQLGLGEQW ETKRAY+EAN LLGDIVKVTP
Sbjct: 881  FGADLKGPDPEVYEHEIPGGQLTNLLFQAQQLGLGEQWTETKRAYKEANMLLGDIVKVTP 940

Query: 900  TSKVVGDLAQFMVSNKLTSDDVRRLANSLDFPDSVMDFFEGLIGQPYGGFPEPFRSDVLR 959
            TSKVVGDLAQFMVSNKLTS+DV+RLANSLDFPDSVMDFFEGL+GQPYGGFPEP RSD+LR
Sbjct: 941  TSKVVGDLAQFMVSNKLTSEDVKRLANSLDFPDSVMDFFEGLMGQPYGGFPEPLRSDILR 1000

Query: 960  NKRRKLTCRPGLELEPFDLEKIREDLQNRFGDVDECDVASYNMYPRVYEDFQKMRETYGD 1019
            NKRRKLTCRPGLEL PF+L  I+EDLQ RFGD++ECD+ASYNMYP+VYEDFQKM+E YGD
Sbjct: 1001 NKRRKLTCRPGLELVPFELNNIKEDLQTRFGDINECDIASYNMYPKVYEDFQKMKEKYGD 1060

Query: 1020 LSVLPTRSFLSPLETDEEIEVVIEQGKTLIIKLQAVGDLNKKTGEREVYFDLNGEMRKIR 1079
            LSVLPT+SFL+P E  EEI V I+QGKTLIIKLQA+GDLNK+TG+REV+F+LNGEMRKI 
Sbjct: 1061 LSVLPTKSFLAPAEIGEEILVTIQQGKTLIIKLQAIGDLNKETGKREVFFELNGEMRKIS 1120

Query: 1080 VADRSQKVETVTKSKADMHDPLHIGAPMAGVIVEVKVHKGSLIKKGQPVAVLSAMKMEMI 1139
            V D+SQKVETV K KAD HDP  IGAPMAGVIVEVKVHKGSL+KKG+ VAVLSAMKMEM+
Sbjct: 1121 VTDKSQKVETVAKPKADTHDPFQIGAPMAGVIVEVKVHKGSLVKKGEAVAVLSAMKMEMV 1180

Query: 1140 ISSPSDGQVKEVFVSDGE 1157
            ISSP+DG VKEV V++ E
Sbjct: 1181 ISSPADGLVKEVLVNESE 1198

>KLLA0C05764g complement(512470..515991) highly similar to sp|P32327
            Saccharomyces cerevisiae YBR218c PYC2 pyruvate
            carboxylase 2, start by similarity
          Length = 1173

 Score = 1993 bits (5164), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 950/1153 (82%), Positives = 1033/1153 (89%), Gaps = 1/1153 (0%)

Query: 5    KFAGLRDNFNLLGEKNKILVANRGEIPIRIFRTAHELSMQTVAIYSHEDRLSTHKQKADE 64
            + AGLRDN NL+GEKNK+LVANRGEIPIRIFRTAHELSM+TVAIYSHEDRLS H+ KADE
Sbjct: 4    QLAGLRDNSNLMGEKNKLLVANRGEIPIRIFRTAHELSMKTVAIYSHEDRLSMHRLKADE 63

Query: 65   AYVIGEVGQYTPVGAYLAIDEIISIAQKHQVDFIHPGYGFLSENSEFADKVVKAGITWIG 124
            AYVIGE G+YTPVGAYLAIDEII+IA+ H V+FIHPGYGFLSENSEFA+KV  +GITW+G
Sbjct: 64   AYVIGEQGKYTPVGAYLAIDEIINIAKSHGVNFIHPGYGFLSENSEFAEKVAASGITWVG 123

Query: 125  PPAEVIDSVGDKVSARNLAAKANVPTVPGTPGPIETVEEALDFVNEYGYPVIIKAAFXXX 184
            PPA VIDSVGDKVSARNLA KANVP VPGTPGPIETVEEA  FV++YG+PVIIKAAF   
Sbjct: 124  PPAAVIDSVGDKVSARNLAEKANVPVVPGTPGPIETVEEAQAFVDKYGFPVIIKAAFGGG 183

Query: 185  XXXXXXXXXXXXXADAFQRATSEARTAFGNGTCFVERFLDKPKHIEVQLLADNHGNVVHL 244
                         +DAFQRA SEA TAFGNGTCF+ERFLDKPKHIEVQLLADN+GNVVHL
Sbjct: 184  GRGMRVVREGDDISDAFQRAKSEAITAFGNGTCFIERFLDKPKHIEVQLLADNYGNVVHL 243

Query: 245  FERDCSVQRRHQKVVEVAPAKTLPREVRDAILTDAVKLAKECGYRNAGTAEFLVDNQNRH 304
            FERDCSVQRRHQKVVEVAPAKTLP EVRDAILTDAVKLAKE GYRNAGTAEFLVDNQNRH
Sbjct: 244  FERDCSVQRRHQKVVEVAPAKTLPEEVRDAILTDAVKLAKEAGYRNAGTAEFLVDNQNRH 303

Query: 305  YFIEINPRIQVEHTITEEITXXXXXXXXXXXXXXXSLPQLGLFQDKITTRGFAIQCRITT 364
            YFIEINPRIQVEHTITEEIT               +L QLGL QDKITTRGFAIQCRITT
Sbjct: 304  YFIEINPRIQVEHTITEEITGIDIVAAQIQIAAGATLEQLGLMQDKITTRGFAIQCRITT 363

Query: 365  EDPAKNFQPDTGRIEVYRSAGGNGVRLDGGNAYAGTIISPHYDSMLVKCSCSGSTYEIVR 424
            EDP+KNFQPDTGRI+VYRSAGGNGVRLDGGNA+AG++ISPHYDSMLVKCSCSGSTYEIVR
Sbjct: 364  EDPSKNFQPDTGRIDVYRSAGGNGVRLDGGNAFAGSVISPHYDSMLVKCSCSGSTYEIVR 423

Query: 425  RKMIRALIEFRIRGVKTNIPFLLTLLTNPVFIEGTYWTTFIDDTPQLFQMVSSQNRAQKL 484
            RKM+RALIEFRIRGVKTNIPFLLTLLT+PVF  G YWTTFIDDTPQLF+MVSSQNRAQKL
Sbjct: 424  RKMLRALIEFRIRGVKTNIPFLLTLLTHPVFKSGEYWTTFIDDTPQLFEMVSSQNRAQKL 483

Query: 485  LHYLADVAVNGSSIKGQIGLPKLKSNPSVPHLHDAQGNVINVTKSAPPSGWRQVLLEKGP 544
            LHYLAD+AVNGSSIKGQIGLPKL ++P++PHLH+  G++++V+ + PP+GWR VLL+ GP
Sbjct: 484  LHYLADLAVNGSSIKGQIGLPKLTTHPTIPHLHNEDGSLVDVS-AKPPAGWRDVLLDYGP 542

Query: 545  AEFARQVRQFNGTLLMDTTWRDAHQSLLATRVRTHDLATIAPTTAHALAGRFALECWGGA 604
             EFA+QVR+FNGTLLMDTTWRDAHQSLLATRVRT+DLA IAPTTAHA++G FALECWGGA
Sbjct: 543  EEFAKQVRKFNGTLLMDTTWRDAHQSLLATRVRTYDLAAIAPTTAHAMSGAFALECWGGA 602

Query: 605  TFDVAMRFLHEDPWERLRKLRSLVPNIPFQMLLRGANGVAYSSLPDNAIDHFVKQAKDNG 664
            TFDV+MRFLHEDPWERLR LR LVPNIPFQMLLRGANGVAYSSLPDNAIDHFVKQAKDNG
Sbjct: 603  TFDVSMRFLHEDPWERLRTLRKLVPNIPFQMLLRGANGVAYSSLPDNAIDHFVKQAKDNG 662

Query: 665  VDIFRVFDALNDLEQLXXXXXXXXXXXXXXXXXXCFSGDMLQPGKKYNLDYYLEIAEKIV 724
            VDIFRVFDALNDLEQL                  C+SGDML PGKKYNLDYYL+I EKIV
Sbjct: 663  VDIFRVFDALNDLEQLKVGVDAVKKAGGVVEATICYSGDMLAPGKKYNLDYYLDITEKIV 722

Query: 725  QMGTHILGIKDMAGTMKPAAAKLLIGSLRAKYPDLPIHVHTHDSAGTAVASMTACALAGA 784
              GTHILGIKDMAGT+KP+AA+LLIGS+RAKYP+LPIHVHTHDSAGT VASM ACAL+GA
Sbjct: 723  NSGTHILGIKDMAGTLKPSAARLLIGSIRAKYPELPIHVHTHDSAGTGVASMAACALSGA 782

Query: 785  DVVDVAINSMSGLTSQPSINALLASLEGNIDTGINVEHVRELDAYWAEMRLLYSCFEADL 844
            DVVDVA NSMSGLTSQPSINALLA+L+G ID  +NV +VRELDAYWAEMRLLYSCFEADL
Sbjct: 783  DVVDVATNSMSGLTSQPSINALLAALDGEIDNNVNVGYVRELDAYWAEMRLLYSCFEADL 842

Query: 845  KGPDPEVYQHEIPGGQLTNLLFQAQQLGLGEQWAETKRAYREANYLLGDIVKVTPTSKVV 904
            KGPDPEVY HEIPGGQLTNLLFQAQQLGLGE+WAETKRAYREAN LLGD+VKVTPTSKVV
Sbjct: 843  KGPDPEVYVHEIPGGQLTNLLFQAQQLGLGEKWAETKRAYREANLLLGDLVKVTPTSKVV 902

Query: 905  GDLAQFMVSNKLTSDDVRRLANSLDFPDSVMDFFEGLIGQPYGGFPEPFRSDVLRNKRRK 964
            GDLAQFMVSNKLTSDDVRRLA+SLDFPDSVMDFFEGLIGQPYGGFPEP R+DVLRNKRRK
Sbjct: 903  GDLAQFMVSNKLTSDDVRRLASSLDFPDSVMDFFEGLIGQPYGGFPEPLRTDVLRNKRRK 962

Query: 965  LTCRPGLELEPFDLEKIREDLQNRFGDVDECDVASYNMYPRVYEDFQKMRETYGDLSVLP 1024
            LT RPGLEL PF+LEKI+EDL  RF D+DECDVASYNMYP+VYEDF+K++E YGDLSVLP
Sbjct: 963  LTQRPGLELAPFELEKIKEDLSTRFSDIDECDVASYNMYPKVYEDFRKIKEKYGDLSVLP 1022

Query: 1025 TRSFLSPLETDEEIEVVIEQGKTLIIKLQAVGDLNKKTGEREVYFDLNGEMRKIRVADRS 1084
            T++FLSP    EEI V IEQGKTLIIK QA+GDLNK+TG REVYF+LNGE+RK+ VADRS
Sbjct: 1023 TKNFLSPPVIGEEIVVTIEQGKTLIIKPQAIGDLNKETGIREVYFELNGELRKVSVADRS 1082

Query: 1085 QKVETVTKSKADMHDPLHIGAPMAGVIVEVKVHKGSLIKKGQPVAVLSAMKMEMIISSPS 1144
            QKVE+V+K KAD HDP  IG+PMAGV+VEVKVHKGSLI KGQPVAVLSAMKMEM+ISSP+
Sbjct: 1083 QKVESVSKPKADAHDPFQIGSPMAGVVVEVKVHKGSLIAKGQPVAVLSAMKMEMVISSPA 1142

Query: 1145 DGQVKEVFVSDGE 1157
            DGQVKEV V DGE
Sbjct: 1143 DGQVKEVLVKDGE 1155

>CAGL0K06787g complement(659290..662817) highly similar to sp|P32327
            Saccharomyces cerevisiae YBR218c PYC2 Pyruvate
            carboxylase 2, start by similarity
          Length = 1175

 Score = 1978 bits (5124), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 953/1157 (82%), Positives = 1025/1157 (88%), Gaps = 3/1157 (0%)

Query: 2    SQRKFAGLRDNFNLLGEKNKILVANRGEIPIRIFRTAHELSMQTVAIYSHEDRLSTHKQK 61
            + +   GLRDNF+LLGEKNKILVANRGEIPIRIFR+AHELSM+TVAIYSHEDRLSTH+ K
Sbjct: 3    TNKMLTGLRDNFSLLGEKNKILVANRGEIPIRIFRSAHELSMRTVAIYSHEDRLSTHRLK 62

Query: 62   ADEAYVIGEVGQYTPVGAYLAIDEIISIAQKHQVDFIHPGYGFLSENSEFADKVVKAGIT 121
            ADEAYVIG+ G+YTPVGAYLAIDEII IA+KH VDFIHPGYGFLSEN+EFADKV KAGIT
Sbjct: 63   ADEAYVIGKEGEYTPVGAYLAIDEIIDIAKKHGVDFIHPGYGFLSENAEFADKVQKAGIT 122

Query: 122  WIGPPAEVIDSVGDKVSARNLAAKANVPTVPGTPGPIETVEEALDFVNEYGYPVIIKAAF 181
            WIGPP EVI+SVGDKVSARNLAAKANVPTVPGTPGPIETVEEA DFVN+YGYPVIIKAA+
Sbjct: 123  WIGPPPEVIESVGDKVSARNLAAKANVPTVPGTPGPIETVEEAQDFVNKYGYPVIIKAAY 182

Query: 182  XXXXXXXXXXXXXXXXADAFQRATSEARTAFGNGTCFVERFLDKPKHIEVQLLADNHGNV 241
                            ADAFQRA SEA TAFGNGTCFVERFLDKPKHIEVQLLADNHGNV
Sbjct: 183  GGGGRGMRVVREGDDVADAFQRAKSEAITAFGNGTCFVERFLDKPKHIEVQLLADNHGNV 242

Query: 242  VHLFERDCSVQRRHQKVVEVAPAKTLPREVRDAILTDAVKLAKECGYRNAGTAEFLVDNQ 301
            VHLFERDCSVQRRHQKVVEVAPAKTLPREVRD+ILTDAV+LAKE GYRNAGTAEFLVDNQ
Sbjct: 243  VHLFERDCSVQRRHQKVVEVAPAKTLPREVRDSILTDAVRLAKEAGYRNAGTAEFLVDNQ 302

Query: 302  NRHYFIEINPRIQVEHTITEEITXXXXXXXXXXXXXXXSLPQLGLFQDKITTRGFAIQCR 361
            NRHYFIEINPRIQVEHTITEEIT               SLPQLGL QD+ITTRGFAIQCR
Sbjct: 303  NRHYFIEINPRIQVEHTITEEITGIDLVSAQIQIAAGASLPQLGLLQDRITTRGFAIQCR 362

Query: 362  ITTEDPAKNFQPDTGRIEVYRSAGGNGVRLDGGNAYAGTIISPHYDSMLVKCSCSGSTYE 421
            ITTEDPAKNFQPDTGR+EVYRSAGGNGVRLDGG AYAG +ISPHYDSMLVKCSCSGSTYE
Sbjct: 363  ITTEDPAKNFQPDTGRLEVYRSAGGNGVRLDGGTAYAGAVISPHYDSMLVKCSCSGSTYE 422

Query: 422  IVRRKMIRALIEFRIRGVKTNIPFLLTLLTNPVFIEGTYWTTFIDDTPQLFQMVSSQNRA 481
            IVRRKM+RALIEFRIRGVKTNIPFLLTLLT+PVFI G YWTTFIDDTPQLF MVSS+NRA
Sbjct: 423  IVRRKMLRALIEFRIRGVKTNIPFLLTLLTHPVFISGDYWTTFIDDTPQLFHMVSSRNRA 482

Query: 482  QKLLHYLADVAVNGSSIKGQIGLPKLKSNPSVPHLHDAQGNVINVTKSAPP-SGWRQVLL 540
            QKLLHYLAD+AVNGSSIKGQIG PKLK++P +P LHD  G+ ++V  S PP  GWR +L 
Sbjct: 483  QKLLHYLADLAVNGSSIKGQIGEPKLKTHPQIPRLHDEDGSPVDV--SVPPQKGWRYLLQ 540

Query: 541  EKGPAEFARQVRQFNGTLLMDTTWRDAHQSLLATRVRTHDLATIAPTTAHALAGRFALEC 600
             +GP  FA+ VR   GTL+MDTTWRDAHQSLLATRVRT+DLA IA TTAHA AG FALEC
Sbjct: 541  SEGPEAFAKAVRHNQGTLVMDTTWRDAHQSLLATRVRTYDLAAIAQTTAHAFAGAFALEC 600

Query: 601  WGGATFDVAMRFLHEDPWERLRKLRSLVPNIPFQMLLRGANGVAYSSLPDNAIDHFVKQA 660
            WGGATFDVAMRFLHEDPWERLR LR LVPNIPFQMLLRGANGVAYSSLPDNAIDHFVKQA
Sbjct: 601  WGGATFDVAMRFLHEDPWERLRILRKLVPNIPFQMLLRGANGVAYSSLPDNAIDHFVKQA 660

Query: 661  KDNGVDIFRVFDALNDLEQLXXXXXXXXXXXXXXXXXXCFSGDMLQPGKKYNLDYYLEIA 720
            KDNGVDIFRVFDALNDLEQL                  C+SGDMLQPGKKYNLDYYL++ 
Sbjct: 661  KDNGVDIFRVFDALNDLEQLKVGVDAVKKAGGVVEATVCYSGDMLQPGKKYNLDYYLDVT 720

Query: 721  EKIVQMGTHILGIKDMAGTMKPAAAKLLIGSLRAKYPDLPIHVHTHDSAGTAVASMTACA 780
            EKIV MGTHILGIKDMAGTMKPAAAKLLIG++RAK+PDLPIHVH+HDSAGTAVASM ACA
Sbjct: 721  EKIVAMGTHILGIKDMAGTMKPAAAKLLIGAIRAKFPDLPIHVHSHDSAGTAVASMAACA 780

Query: 781  LAGADVVDVAINSMSGLTSQPSINALLASLEGNIDTGINVEHVRELDAYWAEMRLLYSCF 840
            LAGADVVDVAINSMSGLTSQ S+NA+LASL+G IDTGINV+HV ELDAYWAEMRLLYSCF
Sbjct: 781  LAGADVVDVAINSMSGLTSQASVNAVLASLDGQIDTGINVKHVCELDAYWAEMRLLYSCF 840

Query: 841  EADLKGPDPEVYQHEIPGGQLTNLLFQAQQLGLGEQWAETKRAYREANYLLGDIVKVTPT 900
            EADLKGPDPEVY HEIPGGQLTNLLFQAQQLGLGE+W ETK+AY++AN LLGDIVKVTPT
Sbjct: 841  EADLKGPDPEVYDHEIPGGQLTNLLFQAQQLGLGEKWIETKKAYKQANQLLGDIVKVTPT 900

Query: 901  SKVVGDLAQFMVSNKLTSDDVRRLANSLDFPDSVMDFFEGLIGQPYGGFPEPFRSDVLRN 960
            SKVVGDLAQFMVSN+LT DD+RRLANSLDFPDSVMDFFEGL+GQPYGGFPEP R+D+L+N
Sbjct: 901  SKVVGDLAQFMVSNQLTPDDIRRLANSLDFPDSVMDFFEGLMGQPYGGFPEPLRTDILKN 960

Query: 961  KRRKLTCRPGLELEPFDLEKIREDLQNRFGDVDECDVASYNMYPRVYEDFQKMRETYGDL 1020
            KRRKL  RPGLEL PFDL KIREDL+ RFGD++ECDVASYNMYP+VYEDFQK+ E YGDL
Sbjct: 961  KRRKLNRRPGLELAPFDLAKIREDLEARFGDINECDVASYNMYPKVYEDFQKILEEYGDL 1020

Query: 1021 SVLPTRSFLSPLETDEEIEVVIEQGKTLIIKLQAVGDLNKKTGEREVYFDLNGEMRKIRV 1080
            SVLPTR+FL+     EEIEV IEQGKTLIIKLQAVGDLN++TG REVYF+LNGE RKIR+
Sbjct: 1021 SVLPTRNFLAKPRVGEEIEVHIEQGKTLIIKLQAVGDLNEETGIREVYFELNGETRKIRI 1080

Query: 1081 ADRSQKVETVTKSKADMHDPLHIGAPMAGVIVEVKVHKGSLIKKGQPVAVLSAMKMEMII 1140
            AD+SQ V+T+ K KAD HDPL IGAPMAGVIVEVKVHKGS +KKGQPVAVLSAMKMEM+I
Sbjct: 1081 ADKSQVVQTIAKPKADGHDPLQIGAPMAGVIVEVKVHKGSQVKKGQPVAVLSAMKMEMVI 1140

Query: 1141 SSPSDGQVKEVFVSDGE 1157
            SS  +G VK+V V DGE
Sbjct: 1141 SSTGEGLVKDVLVKDGE 1157

>AAR162C [350] [Homologous to ScYGL062W (PYC1) - SH; ScYBR218C (PYC2)
            - SH] (634067..637582) [3516 bp, 1171 aa]
          Length = 1171

 Score = 1954 bits (5063), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 936/1153 (81%), Positives = 1020/1153 (88%), Gaps = 1/1153 (0%)

Query: 5    KFAGLRDNFNLLGEKNKILVANRGEIPIRIFRTAHELSMQTVAIYSHEDRLSTHKQKADE 64
            + AG R + NLLGEKNK+LVANRGEIPIRIFRTAHELSM TVA+YS+EDRLS H+QKADE
Sbjct: 4    QLAGFRRHSNLLGEKNKVLVANRGEIPIRIFRTAHELSMATVAVYSYEDRLSMHRQKADE 63

Query: 65   AYVIGEVGQYTPVGAYLAIDEIISIAQKHQVDFIHPGYGFLSENSEFADKVVKAGITWIG 124
            AY+IG  GQYTPVGAYLAIDEI+ IA+ H VDFIHPGYGFLSEN+EFA KV  AGITWIG
Sbjct: 64   AYMIGREGQYTPVGAYLAIDEILRIARDHDVDFIHPGYGFLSENAEFAAKVEGAGITWIG 123

Query: 125  PPAEVIDSVGDKVSARNLAAKANVPTVPGTPGPIETVEEALDFVNEYGYPVIIKAAFXXX 184
            PPA VI++VGDKVSARNLAA A+VPTVPGT GPI +VEEA +FV +YGYPVIIKAAF   
Sbjct: 124  PPASVIEAVGDKVSARNLAAVADVPTVPGTEGPISSVEEAEEFVQKYGYPVIIKAAFGGG 183

Query: 185  XXXXXXXXXXXXXADAFQRATSEARTAFGNGTCFVERFLDKPKHIEVQLLADNHGNVVHL 244
                          DAFQRA SEA TAFGNGTCFVERFLD+PKHIEVQLLADN+GNVVHL
Sbjct: 184  GRGMRVVREGDDIRDAFQRARSEAETAFGNGTCFVERFLDQPKHIEVQLLADNYGNVVHL 243

Query: 245  FERDCSVQRRHQKVVEVAPAKTLPREVRDAILTDAVKLAKECGYRNAGTAEFLVDNQNRH 304
            FERDCSVQRRHQKVVEVAPAKTL +EVRDAILTDAVKLAK  GYRNAGTAEFLVD QNRH
Sbjct: 244  FERDCSVQRRHQKVVEVAPAKTLSKEVRDAILTDAVKLAKASGYRNAGTAEFLVDKQNRH 303

Query: 305  YFIEINPRIQVEHTITEEITXXXXXXXXXXXXXXXSLPQLGLFQDKITTRGFAIQCRITT 364
            YFIEINPRIQVEHTITEEIT               SL QLGL QD+ITTRGFAIQCRITT
Sbjct: 304  YFIEINPRIQVEHTITEEITGVDIVAAQIQIAAGASLEQLGLMQDRITTRGFAIQCRITT 363

Query: 365  EDPAKNFQPDTGRIEVYRSAGGNGVRLDGGNAYAGTIISPHYDSMLVKCSCSGSTYEIVR 424
            EDP+KNFQPDTGR++VYRSAGGNGVRLDGGNA+AG +ISPHYDSMLVKCSCSGSTYEIVR
Sbjct: 364  EDPSKNFQPDTGRLDVYRSAGGNGVRLDGGNAFAGAVISPHYDSMLVKCSCSGSTYEIVR 423

Query: 425  RKMIRALIEFRIRGVKTNIPFLLTLLTNPVFIEGTYWTTFIDDTPQLFQMVSSQNRAQKL 484
            RKM+RALIEFRIRGVKTNIPFLLTLLT+PVFI G YWTTFIDDTPQLF+MV+SQNRAQKL
Sbjct: 424  RKMLRALIEFRIRGVKTNIPFLLTLLTHPVFISGDYWTTFIDDTPQLFEMVASQNRAQKL 483

Query: 485  LHYLADVAVNGSSIKGQIGLPKLKSNPSVPHLHDAQGNVINVTKSAPPSGWRQVLLEKGP 544
            L YL+D+AVNGSSIKGQ+G+PKL + PS+P LH+A+G VI+V +S PP+GWRQVLLE GP
Sbjct: 484  LQYLSDLAVNGSSIKGQMGVPKLLAQPSIPQLHNAKGEVIDV-QSQPPAGWRQVLLEHGP 542

Query: 545  AEFARQVRQFNGTLLMDTTWRDAHQSLLATRVRTHDLATIAPTTAHALAGRFALECWGGA 604
              FA++VR+F+GTLL DTTWRDAHQSLLATRVRT+DLA IAPTTAHALAG FALECWGGA
Sbjct: 543  EVFAKKVREFDGTLLTDTTWRDAHQSLLATRVRTYDLAAIAPTTAHALAGAFALECWGGA 602

Query: 605  TFDVAMRFLHEDPWERLRKLRSLVPNIPFQMLLRGANGVAYSSLPDNAIDHFVKQAKDNG 664
            TFDVAMRFLHEDPWERLR LR LVPNIPFQMLLRGANGVAYSSLPDNAIDHFVKQAK+NG
Sbjct: 603  TFDVAMRFLHEDPWERLRTLRKLVPNIPFQMLLRGANGVAYSSLPDNAIDHFVKQAKENG 662

Query: 665  VDIFRVFDALNDLEQLXXXXXXXXXXXXXXXXXXCFSGDMLQPGKKYNLDYYLEIAEKIV 724
            VDIFRVFDALNDLEQL                  C+SGDMLQPGKKYNLDYYLE+ EKIV
Sbjct: 663  VDIFRVFDALNDLEQLKVGVDAVKKAEGLVEATICYSGDMLQPGKKYNLDYYLELTEKIV 722

Query: 725  QMGTHILGIKDMAGTMKPAAAKLLIGSLRAKYPDLPIHVHTHDSAGTAVASMTACALAGA 784
             MGTHILGIKDMAGTMKP AAKLLIGS+RAKYPDLPIHVHTHDSAGT VASM  CA++GA
Sbjct: 723  AMGTHILGIKDMAGTMKPGAAKLLIGSIRAKYPDLPIHVHTHDSAGTGVASMVQCAISGA 782

Query: 785  DVVDVAINSMSGLTSQPSINALLASLEGNIDTGINVEHVRELDAYWAEMRLLYSCFEADL 844
            DVVDVA NSMSGLTSQPSI AL ASL G+I TG++ +H  ELDAYWAEMRLLYSCFEADL
Sbjct: 783  DVVDVATNSMSGLTSQPSITALQASLGGDIATGVDPDHAIELDAYWAEMRLLYSCFEADL 842

Query: 845  KGPDPEVYQHEIPGGQLTNLLFQAQQLGLGEQWAETKRAYREANYLLGDIVKVTPTSKVV 904
            KGPDPEVY+HEIPGGQLTNLLFQAQQLGLGEQWAETKRAY EAN LLGD+VKVTPTSKVV
Sbjct: 843  KGPDPEVYKHEIPGGQLTNLLFQAQQLGLGEQWAETKRAYAEANQLLGDLVKVTPTSKVV 902

Query: 905  GDLAQFMVSNKLTSDDVRRLANSLDFPDSVMDFFEGLIGQPYGGFPEPFRSDVLRNKRRK 964
            GDLAQFMVSN+L SDDVRRLA+SLDFPDSVMDFFEGLIGQPYGGFPEP RSDVLRNKRRK
Sbjct: 903  GDLAQFMVSNRLNSDDVRRLASSLDFPDSVMDFFEGLIGQPYGGFPEPLRSDVLRNKRRK 962

Query: 965  LTCRPGLELEPFDLEKIREDLQNRFGDVDECDVASYNMYPRVYEDFQKMRETYGDLSVLP 1024
            L  RPGLEL PFDL+KIRE+L++RF ++DECDVASYNMYP+VYEDF+K+RETYGDLSVLP
Sbjct: 963  LKVRPGLELAPFDLDKIREELRSRFDNIDECDVASYNMYPKVYEDFRKIRETYGDLSVLP 1022

Query: 1025 TRSFLSPLETDEEIEVVIEQGKTLIIKLQAVGDLNKKTGEREVYFDLNGEMRKIRVADRS 1084
            T +FLSP +  EEI V IEQGK LIIKLQA+GDLNK+TG+REVYF+LNGE+RK+ VAD+S
Sbjct: 1023 THNFLSPPKIGEEIIVTIEQGKVLIIKLQAIGDLNKETGKREVYFELNGELRKVSVADKS 1082

Query: 1085 QKVETVTKSKADMHDPLHIGAPMAGVIVEVKVHKGSLIKKGQPVAVLSAMKMEMIISSPS 1144
            QK+ETV+K KAD HD   +GAPMAGVI+EVKVHKGS + KGQPVAVLSAMKMEM+ISSPS
Sbjct: 1083 QKLETVSKLKADAHDQFQVGAPMAGVIIEVKVHKGSAVTKGQPVAVLSAMKMEMVISSPS 1142

Query: 1145 DGQVKEVFVSDGE 1157
            DGQVK+VFVSDGE
Sbjct: 1143 DGQVKDVFVSDGE 1155

>Sklu_1458.1 YGL062W, Contig c1458 155-3553 reverse complement
          Length = 1132

 Score = 1933 bits (5007), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 925/1115 (82%), Positives = 998/1115 (89%), Gaps = 1/1115 (0%)

Query: 43   MQTVAIYSHEDRLSTHKQKADEAYVIGEVGQYTPVGAYLAIDEIISIAQKHQVDFIHPGY 102
            M+TVAIYS+EDRLS H+ KADEAY+IGE G+YTPVGAYLAIDEIISIA++H V FIHPGY
Sbjct: 1    MKTVAIYSNEDRLSMHRLKADEAYMIGEGGKYTPVGAYLAIDEIISIAKEHGVSFIHPGY 60

Query: 103  GFLSENSEFADKVVKAGITWIGPPAEVIDSVGDKVSARNLAAKANVPTVPGTPGPIETVE 162
            GFLSEN+EFA KV+ AGITWIGPP EVI+SVGDKVSAR+LAAKANVPTVPGTPGPIE+VE
Sbjct: 61   GFLSENAEFAAKVIDAGITWIGPPPEVINSVGDKVSARDLAAKANVPTVPGTPGPIESVE 120

Query: 163  EALDFVNEYGYPVIIKAAFXXXXXXXXXXXXXXXXADAFQRATSEARTAFGNGTCFVERF 222
            EA  FV EYGYPVIIKAAF                 DAFQRATSEA+TAFGNGTCFVERF
Sbjct: 121  EAEAFVAEYGYPVIIKAAFGGGGRGMRVVREGDDIGDAFQRATSEAKTAFGNGTCFVERF 180

Query: 223  LDKPKHIEVQLLADNHGNVVHLFERDCSVQRRHQKVVEVAPAKTLPREVRDAILTDAVKL 282
            LDKPKHIEVQLLADN+GNV+HLFERDCSVQRRHQKVVEVAPAKTLP+EVRD+ILTDAVKL
Sbjct: 181  LDKPKHIEVQLLADNYGNVIHLFERDCSVQRRHQKVVEVAPAKTLPKEVRDSILTDAVKL 240

Query: 283  AKECGYRNAGTAEFLVDNQNRHYFIEINPRIQVEHTITEEITXXXXXXXXXXXXXXXSLP 342
            AKE  YRNAGTAEFLVD QNRHYFIEINPRIQVEHTITEEIT               SL 
Sbjct: 241  AKEAKYRNAGTAEFLVDAQNRHYFIEINPRIQVEHTITEEITGVDVVAAQIQIAAGASLQ 300

Query: 343  QLGLFQDKITTRGFAIQCRITTEDPAKNFQPDTGRIEVYRSAGGNGVRLDGGNAYAGTII 402
            QLGL QDKITTRGFAIQCRITTEDP+KNFQPDTGRIEVYRSAGGNGVRLDGGNAYAG +I
Sbjct: 301  QLGLLQDKITTRGFAIQCRITTEDPSKNFQPDTGRIEVYRSAGGNGVRLDGGNAYAGAVI 360

Query: 403  SPHYDSMLVKCSCSGSTYEIVRRKMIRALIEFRIRGVKTNIPFLLTLLTNPVFIEGTYWT 462
            SPHYDSMLVKCSCSGSTYEIVRRKM+RALIEFRIRGVKTNIPFLLTLLT+ VF  G YWT
Sbjct: 361  SPHYDSMLVKCSCSGSTYEIVRRKMLRALIEFRIRGVKTNIPFLLTLLTHSVFKSGEYWT 420

Query: 463  TFIDDTPQLFQMVSSQNRAQKLLHYLADVAVNGSSIKGQIGLPKLKSNPSVPHLHDAQGN 522
            TFIDDTPQLF+MVSSQNRAQKLLHYLAD+AVNGSSIKGQIGLPKL + PSVP LHD+ GN
Sbjct: 421  TFIDDTPQLFEMVSSQNRAQKLLHYLADLAVNGSSIKGQIGLPKLTTQPSVPTLHDSNGN 480

Query: 523  VINVTKSAPPSGWRQVLLEKGPAEFARQVRQFNGTLLMDTTWRDAHQSLLATRVRTHDLA 582
            V++V  +APP+GWR VLLE+GP  FA+QVR++NGTLLMDTTWRDAHQSLLATRVRTHDLA
Sbjct: 481  VVDVL-AAPPAGWRDVLLEQGPEGFAKQVRKYNGTLLMDTTWRDAHQSLLATRVRTHDLA 539

Query: 583  TIAPTTAHALAGRFALECWGGATFDVAMRFLHEDPWERLRKLRSLVPNIPFQMLLRGANG 642
            TIAPTTAHALAG FALECWGGATF VAMRFLHEDPWERLR LR LVPNIPFQMLLRGANG
Sbjct: 540  TIAPTTAHALAGAFALECWGGATFVVAMRFLHEDPWERLRVLRKLVPNIPFQMLLRGANG 599

Query: 643  VAYSSLPDNAIDHFVKQAKDNGVDIFRVFDALNDLEQLXXXXXXXXXXXXXXXXXXCFSG 702
            VAYSSLPDNAIDHFV QAK+NGVDIFRVFDALNDLEQL                  C+SG
Sbjct: 600  VAYSSLPDNAIDHFVLQAKENGVDIFRVFDALNDLEQLKVGVDAVKKAGGVVEATVCYSG 659

Query: 703  DMLQPGKKYNLDYYLEIAEKIVQMGTHILGIKDMAGTMKPAAAKLLIGSLRAKYPDLPIH 762
            DMLQPGKKYNLDYYLEI +KIV+MGTHILGIKDMAGT+KP+AAKLLIGS+RAKYPDLPIH
Sbjct: 660  DMLQPGKKYNLDYYLEITDKIVKMGTHILGIKDMAGTLKPSAAKLLIGSIRAKYPDLPIH 719

Query: 763  VHTHDSAGTAVASMTACALAGADVVDVAINSMSGLTSQPSINALLASLEGNIDTGINVEH 822
            VHTHDSAGTAVASM ACALAGADVVDVA NSMSGLTSQPSINALLASL+G I+  ++V  
Sbjct: 720  VHTHDSAGTAVASMAACALAGADVVDVATNSMSGLTSQPSINALLASLDGEINNNVDVNM 779

Query: 823  VRELDAYWAEMRLLYSCFEADLKGPDPEVYQHEIPGGQLTNLLFQAQQLGLGEQWAETKR 882
            VRELDAYWA+MRLLYSCFEADLKGPDPEVYQHEIPGGQLTNLLFQAQQLGLGE+WAETKR
Sbjct: 780  VRELDAYWAQMRLLYSCFEADLKGPDPEVYQHEIPGGQLTNLLFQAQQLGLGERWAETKR 839

Query: 883  AYREANYLLGDIVKVTPTSKVVGDLAQFMVSNKLTSDDVRRLANSLDFPDSVMDFFEGLI 942
            AYREANYLLGD+VKVTPTSKVVGDLAQFMV+NKL SDDVRRLA+SLDFPDSVMDFFEGLI
Sbjct: 840  AYREANYLLGDLVKVTPTSKVVGDLAQFMVTNKLNSDDVRRLASSLDFPDSVMDFFEGLI 899

Query: 943  GQPYGGFPEPFRSDVLRNKRRKLTCRPGLELEPFDLEKIREDLQNRFGDVDECDVASYNM 1002
            GQPYGGFPEP R+DVL+NKRRKLTCRPGLEL PFDLE+I+EDL +RFGD+DECDVASYNM
Sbjct: 900  GQPYGGFPEPLRTDVLKNKRRKLTCRPGLELPPFDLERIKEDLSSRFGDIDECDVASYNM 959

Query: 1003 YPRVYEDFQKMRETYGDLSVLPTRSFLSPLETDEEIEVVIEQGKTLIIKLQAVGDLNKKT 1062
            YP+VYEDF+K+RE YGDLSVLPT++FLSP    EEI V IEQGKTLIIK QA+GDLNK T
Sbjct: 960  YPKVYEDFRKIREQYGDLSVLPTKNFLSPPAVGEEIVVTIEQGKTLIIKPQAIGDLNKDT 1019

Query: 1063 GEREVYFDLNGEMRKIRVADRSQKVETVTKSKADMHDPLHIGAPMAGVIVEVKVHKGSLI 1122
            G REVYF+LNGE+RK+ V DRSQKVET++K KAD HDP  +GAPMAGV+VEVKVHKGSL+
Sbjct: 1020 GIREVYFELNGELRKVSVVDRSQKVETISKPKADAHDPYQVGAPMAGVVVEVKVHKGSLV 1079

Query: 1123 KKGQPVAVLSAMKMEMIISSPSDGQVKEVFVSDGE 1157
            KKGQPVAVLSAMKMEM+ISSP+ G VK+V + DGE
Sbjct: 1080 KKGQPVAVLSAMKMEMVISSPAAGLVKDVLIKDGE 1114

>CAGL0M05533g complement(588667..594171) similar to sp|P32528
            Saccharomyces cerevisiae YBR208c DUR1 urea amidolyase,
            hypothetical start
          Length = 1834

 Score =  291 bits (744), Expect = 1e-80,   Method: Compositional matrix adjust.
 Identities = 171/451 (37%), Positives = 247/451 (54%), Gaps = 11/451 (2%)

Query: 17   GEKNKILVANRGEIPIRIFRTAHELSMQTVAIYSHEDRLSTHKQKADEAYVIGEVGQYTP 76
            G    +LVANRGEI +RI +T   + ++++AIYS  D+ S H    D A  +     +T 
Sbjct: 628  GHFKTVLVANRGEIAVRIIKTLKSMQIKSLAIYSATDKYSQHVLDVDMAQALD---GHTV 684

Query: 77   VGAYLAIDEIISIAQKHQVDFIHPGYGFLSENSEFADKVVKAGITWIGPPAEVIDSVGDK 136
               YL +++IISIA+K+ VD I PGYGFLSEN+ FAD+  + GI +IGP  E I  +G K
Sbjct: 685  EETYLHVEKIISIAKKYDVDAIIPGYGFLSENASFADRCEQEGIQFIGPRGETIRKLGLK 744

Query: 137  VSARNLAAKANVPTVPGTPGPIETVEEALDFVNEYGYPVIIKAAFXXXXXXXXXXXXXXX 196
             SAR +A  A VP VPG+P  ++  +EA       GYPV++K+                 
Sbjct: 745  HSAREVAKSAGVPLVPGSP-LVKNADEAFTIAKNIGYPVMVKSTAGGGGIGLQKVDNEQD 803

Query: 197  XADAFQRATSEARTAFGNGTCFVERFLDKPKHIEVQLLADNHGNVVHLFERDCSVQRRHQ 256
               AF+    +  + FG+   F+E+F+D  +H+EVQ++ D  G  + L ERDCS+QRR+Q
Sbjct: 804  MRKAFETVKHQGSSYFGDSGVFMEKFIDNARHVEVQIMGDGKGKTLALGERDCSLQRRNQ 863

Query: 257  KVVEVAPAKTLPREVRDAILTDAVKLAKECGYRNAGTAEFLVDNQ-NRHYFIEINPRIQV 315
            KV+E  PA  LPRE R  +LT A +L     YR AGT EF+ D Q ++ YF+E+N R+QV
Sbjct: 864  KVIEETPAPNLPRETRQKMLTAAERLGAYLNYRGAGTVEFIYDEQRDQFYFLEVNTRLQV 923

Query: 316  EHTITEEITXXXXXXXXXXXXXXXSLPQLGLFQDKITTRGFAIQCRITTEDPAKNFQPDT 375
            EH ITE +T                +P L  F   I+  G +I+ R+  E+P K+F+P  
Sbjct: 924  EHPITEMVTGLDLVEWMIKISAGV-MPSLDEFN--ISQNGASIEVRVYAENPLKDFRPSP 980

Query: 376  GRIEVYRSAGGNGVRLDGGNAYAGTIISPHYDSMLVKCSCSGSTYEIVRRKMIRALIEFR 435
            G  E+      N  R+D      GT ISP +D  L K    G        KM +AL E +
Sbjct: 981  G--ELVDVQFPNDCRVDTW-VKKGTKISPEFDPTLAKIIVHGKDRNEAILKMKKALNETK 1037

Query: 436  IRGVKTNIPFLLTLLTNPVFIEGTYWTTFID 466
            I G  TN+ +L +L+++ +F      T +++
Sbjct: 1038 IYGCVTNVDYLKSLISSEMFRNAQLSTNYLN 1068

 Score = 40.8 bits (94), Expect = 0.007,   Method: Compositional matrix adjust.
 Identities = 27/77 (35%), Positives = 40/77 (51%)

Query: 1081 ADRSQKVETVTKSKADMHDPLHIGAPMAGVIVEVKVHKGSLIKKGQPVAVLSAMKMEMII 1140
            AD  Q    V +      D  +I +  AG   +  V  G+ I+K Q VAV+ AMK EMI+
Sbjct: 1744 ADLKQTTTEVIEQNILEDDCEYIFSEYAGRFWKPIVEIGASIEKDQGVAVIEAMKTEMIV 1803

Query: 1141 SSPSDGQVKEVFVSDGE 1157
            SS   G++K+    +G+
Sbjct: 1804 SSSVVGKLKKFLFKNGD 1820

>YBR208C (DUR1,2) [390] chr2 complement(636660..642167) Urea
            amidolyase, contains urea carboxylase and allophanate
            hydrolase activities fused together in a single
            polypeptide [5508 bp, 1835 aa]
          Length = 1835

 Score =  266 bits (681), Expect = 8e-73,   Method: Compositional matrix adjust.
 Identities = 166/471 (35%), Positives = 248/471 (52%), Gaps = 19/471 (4%)

Query: 5    KFAGLRDNFNLLGEK--------NKILVANRGEIPIRIFRTAHELSMQTVAIYSHEDRLS 56
            K+ G R  F +L +K        + +L+ANRGEI +RI +T  +L +++VA+YS  D+ S
Sbjct: 611  KYGGFRAYFEMLKKKESQKKKLFDTVLIANRGEIAVRIIKTLKKLGIRSVAVYSDPDKYS 670

Query: 57   THKQKADEAYVIGEVGQYTPVGAYLAIDEIISIAQKHQVDFIHPGYGFLSENSEFADKVV 116
             H   AD   V   +   T    YL +++II  A++     I PGYGFLSEN++F+D   
Sbjct: 671  QHVTDAD---VSVPLHGTTAAQTYLDMNKIIDAAKQTNAQAIIPGYGFLSENADFSDACT 727

Query: 117  KAGITWIGPPAEVIDSVGDKVSARNLAAKANVPTVPGTPGPIETVEEALDFVNEYGYPVI 176
             AGIT++GP  ++I  +G K SAR +A KA VP VPG+   I +VEEA     E  YPV+
Sbjct: 728  SAGITFVGPSGDIIRGLGLKHSARQIAQKAGVPLVPGSL-LITSVEEAKKVAAELEYPVM 786

Query: 177  IKAAFXXXXXXXXXXXXXXXXADAFQRATSEARTAFGNGTCFVERFLDKPKHIEVQLLAD 236
            +K+                     F+    +  T FG+   F+ERF++  +H+EVQL+ D
Sbjct: 787  VKSTAGGGGIGLQKVDSEEDIEHIFETVKHQGETFFGDAGVFLERFIENARHVEVQLMGD 846

Query: 237  NHGNVVHLFERDCSVQRRHQKVVEVAPAKTLPREVRDAILTDAVKLAKECGYRNAGTAEF 296
              G  + L ERDCS+QRR+QKV+E  PA  LP + R A+   A  L     Y+ AGT EF
Sbjct: 847  GFGKAIALGERDCSLQRRNQKVIEETPAPNLPEKTRLALRKAAESLGSLLNYKCAGTVEF 906

Query: 297  LVD-NQNRHYFIEINPRIQVEHTITEEITXXXXXXXXXXXXXXXSLPQLGLFQDKITTRG 355
            + D  ++  YF+E+N R+QVEH ITE +T               + P       K+   G
Sbjct: 907  IYDEKKDEFYFLEVNTRLQVEHPITEMVTGLDLVEWMIRIAANDA-PDFD--STKVEVNG 963

Query: 356  FAIQCRITTEDPAKNFQPDTGRIEVYRSAGGNGVRLDGGNAYAGTIISPHYDSMLVKCSC 415
             +++ R+  E+P KNF+P  G +   +    +  R+D      GT ISP YD  L K   
Sbjct: 964  VSMEARLYAENPLKNFRPSPGLLVDVKFP--DWARVDTW-VKKGTNISPEYDPTLAKIIV 1020

Query: 416  SGSTYEIVRRKMIRALIEFRIRGVKTNIPFLLTLLTNPVFIEGTYWTTFID 466
             G   +    K+ +AL E ++ G  TNI +L +++T+  F +    T  ++
Sbjct: 1021 HGKDRDDAISKLNQALEETKVYGCITNIDYLKSIITSDFFAKAKVSTNILN 1071

 Score = 36.2 bits (82), Expect = 0.19,   Method: Compositional matrix adjust.
 Identities = 15/39 (38%), Positives = 27/39 (69%)

Query: 1119 GSLIKKGQPVAVLSAMKMEMIISSPSDGQVKEVFVSDGE 1157
            G +I+ GQ + ++ AMK EMIIS+P  G++ ++   +G+
Sbjct: 1782 GDVIEAGQGLLIIEAMKAEMIISAPKSGKIIKICHGNGD 1820

>ADR051C [1792] [Homologous to ScYBR208C (DUR12) - SH]
            (796213..801672) [5460 bp, 1819 aa]
          Length = 1819

 Score =  264 bits (674), Expect = 6e-72,   Method: Compositional matrix adjust.
 Identities = 162/461 (35%), Positives = 241/461 (52%), Gaps = 19/461 (4%)

Query: 20   NKILVANRGEIPIRIFRTAHELSMQTVAIYSHEDRLSTHKQKADEAYVIGEVGQYTPVGA 79
            + +LVANRGEI +RI RT   L +++VA+YS  DR S H + AD A  +G     +    
Sbjct: 623  DTVLVANRGEIAVRIIRTLKRLGIRSVAVYSDPDRHSQHVRDADVAVALG---GSSAAET 679

Query: 80   YLAIDEIISIAQKHQVDFIHPGYGFLSENSEFADKVVKAGITWIGPPAEVIDSVGDKVSA 139
            YL ID+I++ A+K     I PGYGFLSEN+ FA++    GI ++GP  + I  +G K  A
Sbjct: 680  YLDIDKILAAAKKTDTQAIIPGYGFLSENATFAERCGAEGIVFVGPSGDSIRKLGLKHWA 739

Query: 140  RNLAAKANVPTVPGTPGPIETVEEALDFVNEYGYPVIIKAAFXXXXXXXXXXXXXXXXAD 199
            R LAA A VP   GT G +++   AL+   E GYP+++K+                  A 
Sbjct: 740  RELAASAGVPLTKGT-GLLQSASAALEAGEEIGYPLMVKSTAGGGGIGLQRVDSAAELAA 798

Query: 200  AFQRATSEARTAFGNGTCFVERFLDKPKHIEVQLLADNHGNVVHLFERDCSVQRRHQKVV 259
            AF++   +    F +   F+E F+ + +H+EVQ++ D HG  V L ERDCS+QRR+QK++
Sbjct: 799  AFEQVQRQGELYFTDSGVFLESFIARARHVEVQIMGDGHGRTVALGERDCSLQRRNQKII 858

Query: 260  EVAPAKTLPREVRDAILTDAVKLAKECGYRNAGTAEFLVDNQ-NRHYFIEINPRIQVEHT 318
            E  PA  LP   R  +   A +L     Y+ AGT EF+ D Q +  YF+E+N R+QVEH 
Sbjct: 859  EETPAPNLPAHTRQKMRQAAQRLCSAVKYKCAGTVEFMYDEQKDEFYFLEVNTRLQVEHP 918

Query: 319  ITEEITXXXXXXXXXXXXXXXSLPQLGLFQDKITTRGFAIQCRITTEDPAKNFQPDTGRI 378
            ITE +T                 P    F   +   G +++ R+  E+P K F P  G +
Sbjct: 919  ITEMVTGLDLVEWMLRIAANTP-PD---FDAGVEIEGVSMEARVYVENPVKGFTPSPGLL 974

Query: 379  E--VYRSAGGNGVRLDGGNAYAGTIISPHYDSMLVKCSCSGSTYEIVRRKMIRALIEFRI 436
               V+ S      R+D      GT ++  YD  L K    G   E    K++ AL E RI
Sbjct: 975  TEVVFPSWA----RVDTW-ILKGTRVAAEYDPTLAKIIVHGKDREDAVSKLLLALSETRI 1029

Query: 437  RGVKTNIPFLLTLLTNPVFIEGTYWTTFIDD---TPQLFQM 474
             G  TN+ +L ++ ++  F + + +T  ++D   TP  F++
Sbjct: 1030 AGCMTNLDYLKSIASSEEFRKASVFTRLLNDFEYTPTAFEV 1070

 Score = 40.4 bits (93), Expect = 0.011,   Method: Compositional matrix adjust.
 Identities = 28/101 (27%), Positives = 53/101 (52%), Gaps = 11/101 (10%)

Query: 1061 KTGEREVYFDLNGEMRKIRVADRSQKVETVTKSKADM----HDPLHIGAPMAGVIVEVKV 1116
            ++GER   F      R I+VA+    +ET  + +A+      D   + +  AG   +  V
Sbjct: 1712 QSGERAAEF-----ARLIKVAN--SDLETAVRKEAEPVEYPEDAHMVYSEYAGRFWKQVV 1764

Query: 1117 HKGSLIKKGQPVAVLSAMKMEMIISSPSDGQVKEVFVSDGE 1157
              G  +K+G  + ++ AMK EM++S+ +DG+V  +  ++G+
Sbjct: 1765 SVGDKVKEGDKLVIIEAMKTEMVVSATADGEVINILHANGD 1805

>Scas_721.40
          Length = 1834

 Score =  261 bits (667), Expect = 5e-71,   Method: Compositional matrix adjust.
 Identities = 159/473 (33%), Positives = 248/473 (52%), Gaps = 24/473 (5%)

Query: 5    KFAGLRDNFNLLGEKNK-------ILVANRGEIPIRIFRTAHELSMQTVAIYSHEDRLST 57
            K+ G +     L    K       +LVANRGEI +RI +T  ++ +Q+VAI+S  DR S 
Sbjct: 606  KYGGFKTYLKFLETNTKTKKPFTTVLVANRGEIAVRIIKTLKKMEIQSVAIFSTPDRYSQ 665

Query: 58   HKQKADEAYVIGEVGQYTPVGAYLAIDEIISIAQKHQVDFIHPGYGFLSENSEFADKVVK 117
            H   AD   +  ++   +    YL I++II  A+K     I PGYGFLSEN++F+++   
Sbjct: 666  HVIDAD---LTVDLKGVSAADTYLNIEKIIDAAKKTGAQAIIPGYGFLSENADFSERCDA 722

Query: 118  AGITWIGPPAEVIDSVGDKVSARNLAAKANVPTVPGTPGPIETVEEALDFVNEYGYPVII 177
             GIT++GP  +V+  +G K SAR +A KANVP VPG+   I T  EA +   +  YP+++
Sbjct: 723  EGITFVGPSGDVMRGLGLKHSAREIAKKANVPLVPGS-SLITTAHEAKEIAAKLEYPIMV 781

Query: 178  KAAFXXXXXXXXXXXXXXXXADAFQRATSEARTAFGNGTCFVERFLDKPKHIEVQLLADN 237
            K+                     F+    +    FG+   F+ERF++  +H+EVQ++ D 
Sbjct: 782  KSTAGGGGIGLQKVESEDDIERIFETVKHQGAAYFGDSGVFMERFIENARHVEVQIMGDG 841

Query: 238  HGNVVHLFERDCSVQRRHQKVVEVAPAKTLPREVRDAILTDAVKLAKECGYRNAGTAEFL 297
             GN + + ERDCS+QRR+QK++E  PA  LP   R  +   A +L     Y+ AGT EF+
Sbjct: 842  LGNALAIGERDCSLQRRNQKIIEETPAPNLPETTRQKLREAAQRLGSLLKYKCAGTVEFI 901

Query: 298  VDN-QNRHYFIEINPRIQVEHTITEEITXXXXXXXXXXXXXXXSLPQLGLFQDKITTRGF 356
             D  ++  YF+E+N R+QVEH ITE +T               + P     Q KI   G 
Sbjct: 902  YDEIRDEFYFLEVNTRLQVEHPITEMVTGIDLVEWMLVIAADMA-PDFN--QLKIDVNGV 958

Query: 357  AIQCRITTEDPAKNFQPDTGR---IEVYRSAGGNGVRLDGGNAYAGTIISPHYDSMLVKC 413
            A++ R+  E+P  +F+P  G+   +E  + A     R+D   +  GTI++P YD  L K 
Sbjct: 959  AMEARLYAENPVHDFKPSPGQLVEVEFPKWA-----RIDTWVS-KGTIVTPEYDPTLAKI 1012

Query: 414  SCSGSTYEIVRRKMIRALIEFRIRGVKTNIPFLLTLLTNPVFIEGTYWTTFID 466
               G        K+ +AL+E ++ G  TNI +L ++ ++ +F +    T  ++
Sbjct: 1013 IVHGKDRHDALEKLNKALVETKVSGCITNIDYLRSISSSEMFRDAKVSTNILN 1065

 Score = 33.9 bits (76), Expect = 0.99,   Method: Compositional matrix adjust.
 Identities = 14/41 (34%), Positives = 26/41 (63%)

Query: 1116 VHKGSLIKKGQPVAVLSAMKMEMIISSPSDGQVKEVFVSDG 1156
            V +G  +K GQ + ++ AMK EM++ +  DG+V ++   +G
Sbjct: 1777 VTEGEFVKSGQGLIIIEAMKTEMLVPTLHDGKVLKIVHKNG 1817

>Sklu_2124.1 YBR208C, Contig c2124 43-5535 reverse complement
          Length = 1830

 Score =  257 bits (656), Expect = 1e-69,   Method: Compositional matrix adjust.
 Identities = 161/484 (33%), Positives = 245/484 (50%), Gaps = 22/484 (4%)

Query: 5    KFAGLRDNFNLLGEKN--------KILVANRGEIPIRIFRTAHELSMQTVAIYSHEDRLS 56
            K+ G +   + L ++          +L+ANRGEI +RI +T  +L++++VA+YS  D+ S
Sbjct: 604  KYGGFKKYIDFLKQEEAKVKKPFETVLIANRGEIAVRIIKTLKKLNIRSVAVYSDPDKYS 663

Query: 57   THKQKADEAYVIGEVGQYTPVGAYLAIDEIISIAQKHQVDFIHPGYGFLSENSEFADKVV 116
             H   AD    +      T    YL ID+II  A+      I PGYGFLSEN+EFADK V
Sbjct: 664  QHVIDADLGVALN---GRTAAETYLDIDKIIKAAKDTNAQAIIPGYGFLSENAEFADKCV 720

Query: 117  KAGITWIGPPAEVIDSVGDKVSARNLAAKANVPTVPGTPGPIETVEEALDFVNEYGYPVI 176
            + GI ++GP  E I  +G K SAR +A KA VP VPG+ G + + +EA +  N+  YPV+
Sbjct: 721  EEGIVFVGPSGEAIRKLGLKHSAREIAEKAGVPLVPGS-GLVTSAKEAKEIANKLEYPVM 779

Query: 177  IKAAFXXXXXXXXXXXXXXXXADAFQRATSEARTAFGNGTCFVERFLDKPKHIEVQLLAD 236
            +K+                     F+    + +  FG+   F+ERF++  +H+E+Q++ D
Sbjct: 780  VKSTAGGGGIGLQKVDSENEIERVFETVQHQGKAYFGDSGVFLERFVENARHVEIQMMGD 839

Query: 237  NHGNVVHLFERDCSVQRRHQKVVEVAPAKTLPREVRDAILTDAVKLAKECGYRNAGTAEF 296
             +G  + + ERDCS+QRR+QK++E  PA  L    R  +   A  L     Y+ AGT EF
Sbjct: 840  GYGKAIAIGERDCSLQRRNQKIIEETPAPNLGETTRTKMRQAAESLGSLLKYKCAGTVEF 899

Query: 297  LVDN-QNRHYFIEINPRIQVEHTITEEITXXXXXXXXXXXXXXXSLPQLGLFQDKITTRG 355
            + D  ++  YF+E+N R+QVEH ITE +T               + P        I   G
Sbjct: 900  IYDERRDEFYFLEVNARLQVEHPITEMVTGLDLVEWMLRIAADDA-PDFE--SANIVVTG 956

Query: 356  FAIQCRITTEDPAKNFQPDTGRIEVYRSAGGNGVRLDGGNAYAGTIISPHYDSMLVKCSC 415
             +I+ R+  E+PAK+F+P  G +           R+D   +  GT +S  YD  L K   
Sbjct: 957  ASIEARLYAENPAKDFRPSPGLLTDVHFP--EWARVDTWVS-KGTTVSAEYDPTLAKIIV 1013

Query: 416  SGSTYEIVRRKMIRALIEFRIRGVKTNIPFLLTLLTNPVFIEGTYWTTFIDD---TPQLF 472
             G        KM +AL E  + G  TNI +L ++ ++ +F      T  +D     P  F
Sbjct: 1014 HGKDRNDAIMKMNKALNETVVYGCITNIDYLRSIASSEMFKTAKVATKILDSYDYKPCAF 1073

Query: 473  QMVS 476
            ++ S
Sbjct: 1074 EVTS 1077

 Score = 33.9 bits (76), Expect = 1.0,   Method: Compositional matrix adjust.
 Identities = 21/85 (24%), Positives = 42/85 (49%), Gaps = 3/85 (3%)

Query: 1076 RKIRVADRSQKVETVTKSKADMHDPLH---IGAPMAGVIVEVKVHKGSLIKKGQPVAVLS 1132
            R I+VA++  +  T  KS  +   P     + +  +G   +  V  G  + KG  + ++ 
Sbjct: 1734 RLIQVANQELESSTTNKSAVEEEYPEDAEMVYSEYSGRFWKPMVSAGDTVTKGDGLVIVE 1793

Query: 1133 AMKMEMIISSPSDGQVKEVFVSDGE 1157
            AMK EM++ +   G+V ++   +G+
Sbjct: 1794 AMKTEMVVPAKKSGKVLKIVHKNGD 1818

>KLLA0E08107g 730334..735823 highly similar to sp|P32528 Saccharomyces
            cerevisiae YBR208c DUR1_2 urea amidolyase, start by
            similarity
          Length = 1829

 Score =  253 bits (646), Expect = 2e-68,   Method: Compositional matrix adjust.
 Identities = 154/459 (33%), Positives = 243/459 (52%), Gaps = 14/459 (3%)

Query: 22   ILVANRGEIPIRIFRTAHELSMQTVAIYSHEDRLSTHKQKADEAYVIGEVGQYTPVGAYL 81
            +L+ANRGEI +RI +T   + +++VA+YS  D+ S H   AD  + +   G+ T    YL
Sbjct: 627  VLIANRGEIAVRIMKTLKRMGIKSVAVYSDPDKYSQHVTDAD--FSVALHGR-TAAETYL 683

Query: 82   AIDEIISIAQKHQVDFIHPGYGFLSENSEFADKVVKAGITWIGPPAEVIDSVGDKVSARN 141
             ID+II+ A+K     I PGYGFLSEN++F+D+  +  I ++GP  + I  +G K SAR 
Sbjct: 684  DIDKIINAAKKTGAQAIIPGYGFLSENADFSDRCSQENIVFVGPSGDAIRKLGLKHSARE 743

Query: 142  LAAKANVPTVPGTPGPIETVEEALDFVNEYGYPVIIKAAFXXXXXXXXXXXXXXXXADAF 201
            +A +A VP VPG+ G I+  +EA +   +  YPV++K+                     F
Sbjct: 744  IAERAKVPLVPGS-GLIKDAKEAKEVAKKLEYPVMVKSTAGGGGIGLQKVDSEDDIERVF 802

Query: 202  QRATSEARTAFGNGTCFVERFLDKPKHIEVQLLADNHGNVVHLFERDCSVQRRHQKVVEV 261
            +    + ++ FG+   F+ERF++  +H+E+Q++ D  G  + + ERDCS+QRR+QKV+E 
Sbjct: 803  ETVQHQGKSYFGDAGVFMERFVNNARHVEIQMMGDGFGKAIAIGERDCSLQRRNQKVIEE 862

Query: 262  APAKTLPREVRDAILTDAVKLAKECGYRNAGTAEFLVDNQ-NRHYFIEINPRIQVEHTIT 320
             PA  LP   R  +   + +L     Y+ AGT EF+ D Q +  YF+E+N R+QVEH IT
Sbjct: 863  TPAPNLPEATRAKMRAASERLGSLLKYKCAGTVEFIYDEQRDEFYFLEVNARLQVEHPIT 922

Query: 321  EEITXXXXXXXXXXXXXXXSLPQLGLFQDKITTRGFAIQCRITTEDPAKNFQPDTGRIEV 380
            E +T               S P       KI   G +I+ R+  E+P K+F+P  G++  
Sbjct: 923  EMVTGLDLVEWMLRIAANDS-PDFD--NTKIEVSGASIEARLYAENPVKDFRPSPGQLT- 978

Query: 381  YRSAGGNGVRLDGGNAYAGTIISPHYDSMLVKCSCSGSTYEIVRRKMIRALIEFRIRGVK 440
               +  +  R+D      GT +S  YD  L K    G        K+ +AL E  + G  
Sbjct: 979  -SVSFPSWARVDTW-VKKGTNVSAEYDPTLAKIIVHGKDRNDAIMKLNQALNETAVYGCI 1036

Query: 441  TNIPFLLTLLTNPVFIEGTYWTTFIDD---TPQLFQMVS 476
            TNI +L ++ ++ +F E    T  +D     P  F++++
Sbjct: 1037 TNIDYLRSIASSKMFKEAKVATKVLDSFDYKPCAFEVLA 1075

>Kwal_27.11951
          Length = 1869

 Score =  246 bits (628), Expect = 3e-66,   Method: Compositional matrix adjust.
 Identities = 158/459 (34%), Positives = 242/459 (52%), Gaps = 14/459 (3%)

Query: 22   ILVANRGEIPIRIFRTAHELSMQTVAIYSHEDRLSTHKQKADEAYVIGEVGQYTPVGAYL 81
            +LVANRGEI +RI +T  +L +++VA+YS  D+ S H   AD A  +      T    YL
Sbjct: 668  VLVANRGEIAVRIIKTLKKLKIKSVAVYSDPDKYSQHVTDADVAVALK---GRTAAETYL 724

Query: 82   AIDEIISIAQKHQVDFIHPGYGFLSENSEFADKVVKAGITWIGPPAEVIDSVGDKVSARN 141
             ID+II+ A++   + I PGYGFLSEN++F+D+    GI ++GP  + I  +G K SAR 
Sbjct: 725  DIDKIIAAAKETGTEAIIPGYGFLSENADFSDRCASEGIVFVGPAGDAIRKLGLKHSARE 784

Query: 142  LAAKANVPTVPGTPGPIETVEEALDFVNEYGYPVIIKAAFXXXXXXXXXXXXXXXXADAF 201
            +A KA VP VPG+ G ++T +EA +      YPV++K+                     F
Sbjct: 785  IAEKAGVPLVPGS-GLVKTPQEAREIAKALEYPVMVKSTAGGGGIGLQKVDSEEDIERVF 843

Query: 202  QRATSEARTAFGNGTCFVERFLDKPKHIEVQLLADNHGNVVHLFERDCSVQRRHQKVVEV 261
            +    + +  FG+   F+ERF++  +H+E+Q++ D  G  + + ERDCS+QRR+QKV+E 
Sbjct: 844  ETVQHQGKAYFGDSGVFLERFVENARHVEIQMMGDGKGKAIAIGERDCSLQRRNQKVIEE 903

Query: 262  APAKTLPREVRDAILTDAVKLAKECGYRNAGTAEFLVDN-QNRHYFIEINPRIQVEHTIT 320
             PA  L  + R  +   +  L     YR AGT EF+ D  ++  YF+E+N R+QVEH IT
Sbjct: 904  TPAPNLSEKTRARMREASENLGSLLKYRCAGTVEFIYDERRDEFYFLEVNARLQVEHPIT 963

Query: 321  EEITXXXXXXXXXXXXXXXSLPQLGLFQDKITTRGFAIQCRITTEDPAKNFQPDTGRIEV 380
            E +T               + P       KIT  G +I+ R+  E+P K+F+P  G++  
Sbjct: 964  EMVT-GLDLVEWMLLIAAGTPPDFD--ATKITVTGASIEARLYAENPVKDFRPSPGQLT- 1019

Query: 381  YRSAGGNGVRLDGGNAYAGTIISPHYDSMLVKCSCSGSTYEIVRRKMIRALIEFRIRGVK 440
               +     R+D   +  GT IS  YD  L K    G   +   +K+ +AL E  I G  
Sbjct: 1020 -DVSFPEWARVDTWVS-KGTTISAEYDPTLAKIIVHGKDRDEAIQKLNQALNETSIYGCI 1077

Query: 441  TNIPFLLTLLTNPVFIEGTYWTTFIDD---TPQLFQMVS 476
            TNI +L ++ ++ +F      T  +D     P  F++ S
Sbjct: 1078 TNIDYLRSIASSEMFKTAKVATKVLDSYDYRPSAFEITS 1116

 Score = 37.7 bits (86), Expect = 0.064,   Method: Compositional matrix adjust.
 Identities = 30/104 (28%), Positives = 50/104 (48%), Gaps = 12/104 (11%)

Query: 1059 NKKTGEREVYF-----DLNGEMRKIRVADRSQKVETVTKSKADMHDPLHIGAPMAGVIVE 1113
            NK+ GE+   F     + N E+ K    D    VE      A+M     + +  +G   +
Sbjct: 1761 NKQNGEKAEEFAKLIQESNAELEK--APDSQGAVEEEFPEDAEM-----VYSEYSGRFWK 1813

Query: 1114 VKVHKGSLIKKGQPVAVLSAMKMEMIISSPSDGQVKEVFVSDGE 1157
              V  G ++K G  + V+ AMK EM++S+P  G+V +V   +G+
Sbjct: 1814 PLVSVGDVVKAGDGLIVVEAMKTEMMVSAPKGGKVLKVVHKNGD 1857

>Scas_720.74
          Length = 2231

 Score =  192 bits (489), Expect = 2e-49,   Method: Compositional matrix adjust.
 Identities = 150/513 (29%), Positives = 231/513 (45%), Gaps = 73/513 (14%)

Query: 20  NKILVANRGEIPIRIFRT---------AHELSMQTVAIYSHEDRLSTHKQKADEAYVIGE 70
           +KIL+AN G   ++  R+          +E ++Q VA+ + ED L  + +    A    E
Sbjct: 60  SKILIANNGIAAVKEIRSVRKWAYETFGNERTIQFVAMATPED-LEANAEYIRMADQYVE 118

Query: 71  VGQYTPVGAYLAIDEIISIAQKHQVDFIHPGYGFLSENSEFADKVV--KAGITWIGPPAE 128
           V   T    Y  +D I+ IA++  VD +  G+G  SEN    +K+   K  + +IGPP  
Sbjct: 119 VPGGTNNKNYANVDLIVDIAERADVDAVWAGWGHASENPHLPEKLAMSKRKVVFIGPPGS 178

Query: 129 VIDSVGDKVSARNLAAKANVPTVPGTPGPIETV------------------------EEA 164
            + S+GDK+S+  +A  A+VP +P +   I+ V                        E+ 
Sbjct: 179 AMRSLGDKISSTIVAQSAHVPCIPWSGTGIDKVQVDKDTGLVSVADEVYAQGCCSSPEDG 238

Query: 165 LDFVNEYGYPVIIKAAFXXXXXXXXXXXXXXXXADAFQRATSEARTAFGNGTCFVERFLD 224
           L+   + G+PV+IKA+                    + +A +E          F+ +   
Sbjct: 239 LEKAKKIGFPVMIKASEGGGGKGIRQVEREEDFIALYHQAANE----IPGSPIFIMKLAG 294

Query: 225 KPKHIEVQLLADNHGNVVHLFERDCSVQRRHQKVVEVAPAKTLPREVRDAILTDAVKLAK 284
           K +H+EVQLLAD +GN + LF RDCSVQRRHQK++E AP      E    +   AV+L K
Sbjct: 295 KARHLEVQLLADQYGNNISLFGRDCSVQRRHQKIIEEAPVTIAAPETFAMMEKSAVRLGK 354

Query: 285 ECGYRNAGTAEFLVDNQNRH-YFIEINPRIQVEHTITEEITXXXXXXXXXXXXXXXSLPQ 343
             GY +AGT E+L  ++++  YF+E+NPR+QVEH  TE +T                + +
Sbjct: 355 LVGYVSAGTVEYLYSHEDKKFYFLELNPRLQVEHPTTEMVTGVNLPATQLQIAMGIPMHR 414

Query: 344 LG---LF-----------------------QDKITTRGFAIQCRITTEDPAKNFQPDTGR 377
           +    +F                       Q K   +G    CRIT+EDP + F+P  G 
Sbjct: 415 ISDIRVFYGMNPHTASEIDFDFSTEESLKTQRKPVPKGHCTACRITSEDPDEGFKPSGGS 474

Query: 378 IEV--YRSAGGNGVRLDGGNAYAGTIISPHYDSMLVKCSCSGSTYEIVRRKMIRALIEFR 435
           +    +RS+         GN      I    DS        G   +  R+ M+ AL E  
Sbjct: 475 LHELNFRSSSNVWGYFSVGNNGG---IHSFSDSQFGHIFAFGENRQASRKHMVVALKELS 531

Query: 436 IRG-VKTNIPFLLTLLTNPVFIEGTYWTTFIDD 467
           IRG  +T + +L+ LL    F + T  T ++DD
Sbjct: 532 IRGDFRTTVEYLIKLLETEDFEDNTITTGWLDD 564

 Score = 35.4 bits (80), Expect = 0.39,   Method: Compositional matrix adjust.
 Identities = 17/52 (32%), Positives = 27/52 (51%)

Query: 1098 HDPLHIGAPMAGVIVEVKVHKGSLIKKGQPVAVLSAMKMEMIISSPSDGQVK 1149
            +DP  +  P  G +V+  V  G  I  GQP A +  MKM+M + +   G ++
Sbjct: 698  NDPTQLRTPSPGKLVKFLVESGDHIAAGQPYAEIEVMKMQMPLVAQETGIIQ 749

>CAGL0L10780g complement(1149588..1156289) highly similar to
           sp|Q00955 Saccharomyces cerevisiae YNR016c ACC1 or
           sp|P32874 Saccharomyces cerevisiae YMR207c HFA1, start
           by similarity
          Length = 2233

 Score =  192 bits (488), Expect = 3e-49,   Method: Compositional matrix adjust.
 Identities = 177/654 (27%), Positives = 280/654 (42%), Gaps = 109/654 (16%)

Query: 20  NKILVANRGEIPIRIFRTAHELSMQT---------VAIYSHEDRLSTHKQKADEAYVIGE 70
           +K+L+AN G   ++  R+  + + +T         VA+ + ED L  + +    A    E
Sbjct: 60  SKVLIANNGIAAVKEIRSVRKWAYETFGDEKIVQFVAMATPED-LEANAEYIRMADQYVE 118

Query: 71  VGQYTPVGAYLAIDEIISIAQKHQVDFIHPGYGFLSENSEFADKVVKAG--ITWIGPPAE 128
           V   T    Y  +D I+ IA++  VD +  G+G  SEN    +K+ ++   I +IGPP  
Sbjct: 119 VPGGTNNNNYANVDLIVDIAERADVDAVWAGWGHASENPLLPEKLARSKRKILFIGPPGN 178

Query: 129 VIDSVGDKVSARNLAAKANVPTVPGTPGPIETV------------------------EEA 164
            + S+GDK+S+  +A  A VP +P +   ++TV                        E+ 
Sbjct: 179 AMRSLGDKISSTIVAQHAKVPCIPWSGTGVDTVHIDEKNGLVSVDDDIYQKGCCSSPEDG 238

Query: 165 LDFVNEYGYPVIIKAAFXXXXXXXXXXXXXXXXADAFQRATSEARTAFGNGTCFVERFLD 224
           L+   + G+PV+IKA+                  + + +A +E          F+ +   
Sbjct: 239 LEKAKKIGFPVMIKASEGGGGKGIRQVTREEDFINLYHQAANE----IPGSPIFIMKLAG 294

Query: 225 KPKHIEVQLLADNHGNVVHLFERDCSVQRRHQKVVEVAPAKTLPREVRDAILTDAVKLAK 284
           K +H+EVQLLAD +G  + LF RDCSVQRRHQK++E AP      E    +   AV+L K
Sbjct: 295 KARHLEVQLLADQYGTNISLFGRDCSVQRRHQKIIEEAPVTIAGPETFGEMEKAAVRLGK 354

Query: 285 ECGYRNAGTAEFLVD-NQNRHYFIEINPRIQVEHTITEEITXXXXXXXXXXXXXXXSLPQ 343
             GY +AGT E+L   + N+ YF+E+NPR+QVEH  TE +T                + +
Sbjct: 355 LVGYVSAGTVEYLYSHDDNKFYFLELNPRLQVEHPTTEMVTGVNLPAAQLQIAMGIPMHR 414

Query: 344 LG---LF-----------------------QDKITTRGFAIQCRITTEDPAKNFQPDTGR 377
           +    +F                       Q K   +G    CRIT+EDP   F+P  G 
Sbjct: 415 ISDIRIFYGLNPRGSSEIDFEFKSEDSLKTQRKPIPKGHCTACRITSEDPNDGFKPSGGT 474

Query: 378 IEV--YRSAGGNGVRLDGGNAYAGTIISPHYDSMLVKCSCSGSTYEIVRRKMIRALIEFR 435
           +    +RS+         GN      I    DS        G   +  R+ M+ AL E  
Sbjct: 475 LNELNFRSSSNVWGYFSVGNNGG---IHSFSDSQFGHIFAFGENRQASRKHMVVALKELS 531

Query: 436 IRG-VKTNIPFLLTLLTNPVFIEGTYWTTFIDDTPQLFQMVSSQNRAQK---LLHYLADV 491
           IRG  +T + +L+ LL    F E T  T ++DD      ++S++  A+K   +L  +   
Sbjct: 532 IRGDFRTTVEYLIKLLETEDFEENTITTGWLDD------LISTKMTAKKPDPILAVICGA 585

Query: 492 AVNG-------------SSIKGQI-GLPKLKSNPSVPHLHDAQGNVINVTKSAPPSGWRQ 537
           A                S  +GQ+    +LK+   V  +H+ +     V KSA     R 
Sbjct: 586 ATKAFIASEAARQDYINSLTRGQVLSKSQLKTMFPVEFIHEGKRYKFTVAKSADD---RY 642

Query: 538 VLLEKGPAEFARQVRQFNGTLLM-------DTTWRDAHQSLLATRVRTHDLATI 584
            L   G     R  +  +G LL+          W+   + + ATR+    + T+
Sbjct: 643 TLFINGSKCEVRVRKLSDGGLLIALGGKSHTIYWK---EEVAATRLSVDSMTTL 693

 Score = 35.0 bits (79), Expect = 0.41,   Method: Compositional matrix adjust.
 Identities = 23/73 (31%), Positives = 35/73 (47%)

Query: 1077 KIRVADRSQKVETVTKSKADMHDPLHIGAPMAGVIVEVKVHKGSLIKKGQPVAVLSAMKM 1136
            K  VA     V+++T      +DP  +  P  G +V+  V  G  I  GQ  A +  MKM
Sbjct: 677  KEEVAATRLSVDSMTTLLEVENDPTQLRTPSPGKLVKFLVENGDHIAAGQAYAEIEVMKM 736

Query: 1137 EMIISSPSDGQVK 1149
            +M + S  +G V+
Sbjct: 737  QMPLLSQENGIVQ 749

>KLLA0F06072g 583276..589971 highly similar to sp|Q00955
           Saccharomyces cerevisiae YNR016c ACC1 acetyl-CoA
           carboxylase, start by similarity
          Length = 2231

 Score =  190 bits (483), Expect = 1e-48,   Method: Compositional matrix adjust.
 Identities = 153/556 (27%), Positives = 245/556 (44%), Gaps = 81/556 (14%)

Query: 20  NKILVANRGEIPIRIFRTAH---------ELSMQTVAIYSHEDRLSTHKQKADEAYVIGE 70
           +K+L+AN G   ++  R+           E ++Q VA+ + ED L  + +    A    E
Sbjct: 61  SKVLIANNGIAAVKEIRSVRKWAYETFGDERTVQFVAMATPED-LEANAEYIRMADQYIE 119

Query: 71  VGQYTPVGAYLAIDEIISIAQKHQVDFIHPGYGFLSENSEFADKVVKA--GITWIGPPAE 128
           V   T    Y  +D I+ +A++  VD +  G+G  SEN    +++  +   I +IGPP  
Sbjct: 120 VPGGTNNNNYANVDLIVEVAERADVDAVWAGWGHASENPLLPERLAASHRKIIFIGPPGN 179

Query: 129 VIDSVGDKVSARNLAAKANVPTVPGTPGPIETV------------------------EEA 164
            + S+GDK+S+  +A  A VP +P +   ++ V                        E+ 
Sbjct: 180 AMRSLGDKISSTIVAQHAKVPCIPWSGTGVDEVHVDKETNLVSVEDKVYQEGCCSSPEDG 239

Query: 165 LDFVNEYGYPVIIKAAFXXXXXXXXXXXXXXXXADAFQRATSEARTAFGNGTCFVERFLD 224
           L    E G+P+++KA+                    +Q+A +E          F+ +   
Sbjct: 240 LKKAKEIGFPIMVKASEGGGGKGIRKVENEDEFLSLYQQAANE----IPGSPIFIMKLAG 295

Query: 225 KPKHIEVQLLADNHGNVVHLFERDCSVQRRHQKVVEVAPAKTLPREVRDAILTDAVKLAK 284
           K +H+EVQLLAD +G  + LF RDCSVQRRHQK++E AP      +    +   AV+L +
Sbjct: 296 KARHLEVQLLADQYGTNISLFGRDCSVQRRHQKIIEEAPVTIAKPDTFTEMEKAAVRLGQ 355

Query: 285 ECGYRNAGTAEFLVD-NQNRHYFIEINPRIQVEHTITEEITXXXXXXXXXXXXX------ 337
             GY +AGT E+L   ++++ YF+E+NPR+QVEH  TE +T                   
Sbjct: 356 LVGYVSAGTVEYLYSHDEDKFYFLELNPRLQVEHPTTEMVTGVNLPSAQLQIAMGIPMHR 415

Query: 338 --------------------XXSLPQLGLFQDKITTRGFAIQCRITTEDPAKNFQPDTGR 377
                                 S P+    Q K T +G    CRIT+EDP + F+P  G 
Sbjct: 416 IRDIRLLYGVDPKSASEIDFNFSTPESAKTQRKPTPKGHCTACRITSEDPNEGFKPSGGA 475

Query: 378 IEV--YRSAGGNGVRLDGGNAYAGTIISPHYDSMLVKCSCSGSTYEIVRRKMIRALIEFR 435
           +    +RS+         GN      I    DS        G   +  R+ M+ AL E  
Sbjct: 476 LHELNFRSSSNVWGYFSVGNNGG---IHSFSDSQFGHIFAFGENRQASRKHMVVALKELS 532

Query: 436 IRG-VKTNIPFLLTLLTNPVFIEGTYWTTFIDDTPQLFQMVSSQNRAQKLLHYLADVAVN 494
           IRG  +T + +L+ LL    F + T  T ++DD      ++S +  A+K    L+   + 
Sbjct: 533 IRGDFRTTVEYLIKLLETEDFEDNTITTGWLDD------LISQKMTAEKPDRTLS--VIC 584

Query: 495 GSSIKGQIGLPKLKSN 510
           G++ K  I   K + +
Sbjct: 585 GAATKAHIASQKARED 600

 Score = 36.2 bits (82), Expect = 0.19,   Method: Compositional matrix adjust.
 Identities = 18/52 (34%), Positives = 28/52 (53%)

Query: 1098 HDPLHIGAPMAGVIVEVKVHKGSLIKKGQPVAVLSAMKMEMIISSPSDGQVK 1149
            +DP  +  P  G +V+  V  G  +  GQP A +  MKM+M + S  +G V+
Sbjct: 699  NDPTQLRTPSPGKLVKFLVENGDHVIAGQPYAEVEVMKMQMPLISQENGVVQ 750

>AAR071W [257] [Homologous to ScYNR016C (ACC1) - SH; ScYMR207C
           (HFA1) - SH] complement(466791..473486) [6696 bp, 2231
           aa]
          Length = 2231

 Score =  189 bits (481), Expect = 2e-48,   Method: Compositional matrix adjust.
 Identities = 159/572 (27%), Positives = 255/572 (44%), Gaps = 86/572 (15%)

Query: 1   MSQRKFAGLRDNFNLLGEK---NKILVANRGEIPIRIFRTAHELSMQT---------VAI 48
           + Q + + LRD   L G     +KIL+AN G   ++  R+  + + +T         V +
Sbjct: 38  VEQAEASPLRDYVRLHGGHTVISKILIANNGIAAVKEIRSVRKWAYETFGDGKVVQFVVM 97

Query: 49  YSHED-RLSTHKQKADEAYVIGEVGQYTPVGAYLAIDEIISIAQKHQVDFIHPGYGFLSE 107
            + ED   +T   +  + YV  EV   T    Y  +D I+ +A++  VD +  G+G  SE
Sbjct: 98  ATPEDLEANTEYIRMADQYV--EVPGGTNNNNYANVDLIVDVAERADVDAVWAGWGHASE 155

Query: 108 NSEFADKVVKAG--ITWIGPPAEVIDSVGDKVSARNLAAKANVPTVPGTPGPIETVE--- 162
           N    +K+ ++   + +IGPP   + S+GDK+S+  +A  A VP +P +   ++ VE   
Sbjct: 156 NPLLPEKLARSKRKVVFIGPPGSAMRSLGDKISSTIVAQHAKVPCIPWSGTGVDQVEIDP 215

Query: 163 ---------------------EALDFVNEYGYPVIIKAAFXXXXXXXXXXXXXXXXADAF 201
                                + L+   + G+PV++KA+                    +
Sbjct: 216 HTKLVSVADDIYQKGCCLSPEDGLNKAKQIGFPVMVKASEGGGGKGIRKVVREEDFISLY 275

Query: 202 QRATSEARTAFGNGTCFVERFLDKPKHIEVQLLADNHGNVVHLFERDCSVQRRHQKVVEV 261
           Q+A +E          F+ +   K +H+EVQLLAD +G  + LF RDCSVQRRHQK++E 
Sbjct: 276 QQAANE----IPGSPIFIMKLAGKARHLEVQLLADQYGTNISLFGRDCSVQRRHQKIIEE 331

Query: 262 APAKTLPREVRDAILTDAVKLAKECGYRNAGTAEFLVDN-QNRHYFIEINPRIQVEHTIT 320
           AP      +    +   AV+L K  GY +AGT E+L  + +++ YF+E+NPR+QVEH  T
Sbjct: 332 APVTIAKPDTFAEMERAAVRLGKLVGYVSAGTVEYLYSHEEDKFYFLELNPRLQVEHPTT 391

Query: 321 EEITXXXXXXXXXXXXXXXSLPQ---LGLF-----------------------QDKITTR 354
           E +T                L +   + LF                       Q +   +
Sbjct: 392 EMVTGVNLPAAQLQIAMGIPLHRIRDIRLFYGLDPHTATEIDFEFSSADALQTQRRPIPK 451

Query: 355 GFAIQCRITTEDPAKNFQPDTGRIEV--YRSAGGNGVRLDGGNAYAGTIISPHYDSMLVK 412
           G    CRIT+EDP + F+P  G +    +RS+         GN      I    DS    
Sbjct: 452 GHCTACRITSEDPNEGFKPSGGSLHELNFRSSSNVWGYFSVGNNGG---IHSFSDSQFGH 508

Query: 413 CSCSGSTYEIVRRKMIRALIEFRIRG-VKTNIPFLLTLLTNPVFIEGTYWTTFIDDTPQL 471
               G   +  R+ M+ AL E  IRG  +T + +L+ LL    F + T  T ++DD    
Sbjct: 509 IFAFGENRQASRKHMVVALKELSIRGDFRTTVEYLIKLLETEDFEDNTITTGWLDD---- 564

Query: 472 FQMVSSQNRAQKLLHYLADVAVNGSSIKGQIG 503
             ++S +  A+K    LA   + G++ K  I 
Sbjct: 565 --LISQKISAEKPDPMLA--VICGATTKAHIA 592

 Score = 34.3 bits (77), Expect = 0.79,   Method: Compositional matrix adjust.
 Identities = 16/49 (32%), Positives = 25/49 (51%)

Query: 1098 HDPLHIGAPMAGVIVEVKVHKGSLIKKGQPVAVLSAMKMEMIISSPSDG 1146
            +DP  +  P  G +V   V  G  ++ GQP A +  MKM+M + +   G
Sbjct: 698  NDPTQLRTPSPGKLVNFLVESGDHLEAGQPYAEIEVMKMQMPLIAQESG 746

>YNR016C (ACC1) [4599] chr14 complement(654672..661373) Acetyl-CoA
           carboxylase, first and rate-limiting step in fatty acid
           biosynthesis pathway [6702 bp, 2233 aa]
          Length = 2233

 Score =  182 bits (462), Expect = 3e-46,   Method: Compositional matrix adjust.
 Identities = 147/513 (28%), Positives = 227/513 (44%), Gaps = 73/513 (14%)

Query: 20  NKILVANRGEIPIRIFRTAHELSMQT---------VAIYSHEDRLSTHKQKADEAYVIGE 70
           +KIL+AN G   ++  R+  + + +T         VA+ + ED L  + +    A    E
Sbjct: 60  SKILIANNGIAAVKEIRSVRKWAYETFGDDRTVQFVAMATPED-LEANAEYIRMADQYIE 118

Query: 71  VGQYTPVGAYLAIDEIISIAQKHQVDFIHPGYGFLSENSEFADKVV--KAGITWIGPPAE 128
           V   T    Y  +D I+ IA++  VD +  G+G  SEN    +K+   K  + +IGPP  
Sbjct: 119 VPGGTNNNNYANVDLIVDIAERADVDAVWAGWGHASENPLLPEKLSQSKRKVIFIGPPGN 178

Query: 129 VIDSVGDKVSARNLAAKANVPTVPGTPGPIETV------------------------EEA 164
            + S+GDK+S+  +A  A VP +P +   ++TV                        E+ 
Sbjct: 179 AMRSLGDKISSTIVAQSAKVPCIPWSGTGVDTVHVDEKTGLVSVDDDIYQKGCCTSPEDG 238

Query: 165 LDFVNEYGYPVIIKAAFXXXXXXXXXXXXXXXXADAFQRATSEARTAFGNGTCFVERFLD 224
           L      G+PV+IKA+                    + +A +E          F+ +   
Sbjct: 239 LQKAKRIGFPVMIKASEGGGGKGIRQVEREEDFIALYHQAANE----IPGSPIFIMKLAG 294

Query: 225 KPKHIEVQLLADNHGNVVHLFERDCSVQRRHQKVVEVAPAKTLPREVRDAILTDAVKLAK 284
           + +H+EVQLLAD +G  + LF RDCSVQRRHQK++E AP      E    +   AV+L K
Sbjct: 295 RARHLEVQLLADQYGTNISLFGRDCSVQRRHQKIIEEAPVTIAKAETFHEMEKAAVRLGK 354

Query: 285 ECGYRNAGTAEFLVDNQN-RHYFIEINPRIQVEHTITEEITXXXXXXXXXXXXXXXSLPQ 343
             GY +AGT E+L  + + + YF+E+NPR+QVEH  TE ++                + +
Sbjct: 355 LVGYVSAGTVEYLYSHDDGKFYFLELNPRLQVEHPTTEMVSGVNLPAAQLQIAMGIPMHR 414

Query: 344 LG----LF----------------------QDKITTRGFAIQCRITTEDPAKNFQPDTGR 377
           +     L+                      Q +   +G    CRIT+EDP   F+P  G 
Sbjct: 415 ISDIRTLYGMNPHSASEIDFEFKTQDATKKQRRPIPKGHCTACRITSEDPNDGFKPSGGT 474

Query: 378 IEV--YRSAGGNGVRLDGGNAYAGTIISPHYDSMLVKCSCSGSTYEIVRRKMIRALIEFR 435
           +    +RS+         GN   G I S   DS        G   +  R+ M+ AL E  
Sbjct: 475 LHELNFRSSSNVWGYFSVGN--NGNIHS-FSDSQFGHIFAFGENRQASRKHMVVALKELS 531

Query: 436 IRG-VKTNIPFLLTLLTNPVFIEGTYWTTFIDD 467
           IRG  +T + +L+ LL    F + T  T ++DD
Sbjct: 532 IRGDFRTTVEYLIKLLETEDFEDNTITTGWLDD 564

 Score = 40.4 bits (93), Expect = 0.012,   Method: Compositional matrix adjust.
 Identities = 25/73 (34%), Positives = 37/73 (50%)

Query: 1077 KIRVADRSQKVETVTKSKADMHDPLHIGAPMAGVIVEVKVHKGSLIKKGQPVAVLSAMKM 1136
            K  VA     V+++T      +DP  +  P  G +V+  V  G  I KGQP A +  MKM
Sbjct: 677  KEEVAATRLSVDSMTTLLEVENDPTQLRTPSPGKLVKFLVENGEHIIKGQPYAEIEVMKM 736

Query: 1137 EMIISSPSDGQVK 1149
            +M + S  +G V+
Sbjct: 737  QMPLVSQENGIVQ 749

>YMR207C (HFA1) [4163] chr13 complement(677192..683563) Protein with
           similarity to acetyl-CoA carboxylase [6372 bp, 2123 aa]
          Length = 2123

 Score =  178 bits (451), Expect = 8e-45,   Method: Compositional matrix adjust.
 Identities = 135/462 (29%), Positives = 215/462 (46%), Gaps = 57/462 (12%)

Query: 80  YLAIDEIISIAQKHQVDFIHPGYGFLSENSEFADKVVKA--GITWIGPPAEVIDSVGDKV 137
           Y  ID I+ +A++  VD +  G+G  SEN    + +  +   I +IGPP   + S+GDK+
Sbjct: 54  YANIDLILDVAEQTDVDAVWAGWGHASENPCLPELLASSQRKILFIGPPGRAMRSLGDKI 113

Query: 138 SARNLAAKANVPTVPGTPGPIETV------------------------EEALDFVNEYGY 173
           S+  +A  A +P +P +   I+T+                        E+AL+     G+
Sbjct: 114 SSTIVAQSAKIPCIPWSGSHIDTIHIDNKTNFVSVPDDVYVRGCCSSPEDALEKAKLIGF 173

Query: 174 PVIIKAAFXXXXXXXXXXXXXXXXADAFQRATSEARTAFGNGTCFVERFLDKPKHIEVQL 233
           PV+IKA+                    +++A +E          FV + +   +H+EVQL
Sbjct: 174 PVMIKASEGGGGKGIRRVDNEDDFIALYRQAVNET----PGSPMFVMKVVTDARHLEVQL 229

Query: 234 LADNHGNVVHLFERDCSVQRRHQKVVEVAPAKTLPREVRDAILTDAVKLAKECGYRNAGT 293
           LAD +G  + LF RDCS+QRRHQK++E AP      E    +   A++L +  GY +AGT
Sbjct: 230 LADQYGTNITLFGRDCSIQRRHQKIIEEAPVTITKPETFQRMERAAIRLGELVGYVSAGT 289

Query: 294 AEFLVD-NQNRHYFIEINPRIQVEHTITEEITXXXXXXXXXXXXXXXSLPQL-------G 345
            E+L     ++ YF+E+NPR+QVEH  TE I+                +  +       G
Sbjct: 290 VEYLYSPKDDKFYFLELNPRLQVEHPTTEMISGVNLPATQLQIAMGIPMHMISDIRKLYG 349

Query: 346 L---------FQD--KITTRGFAIQCRITTEDPAKNFQPDTGRIEV--YRSAGGNGVRLD 392
           L         F++  + + +G  I CRIT+EDP + F+P TG+I    +RS+        
Sbjct: 350 LDPTGTSYIDFKNLKRPSPKGHCISCRITSEDPNEGFKPSTGKIHELNFRSSSNVWGYFS 409

Query: 393 GGNAYAGTIISPHYDSMLVKCSCSGSTYEIVRRKMIRALIEFRIRG-VKTNIPFLLTLLT 451
            GN  A   I    DS        G+  +  ++ M+ AL +F IRG  KT I +L+ LL 
Sbjct: 410 VGNNGA---IHSFSDSQFGHIFAVGNDRQDAKQNMVLALKDFSIRGEFKTPIEYLIELLE 466

Query: 452 NPVFIEGTYWTTFIDDTPQLFQMVSSQNRAQKLLHYLADVAV 493
              F      T ++DD   + + +SS ++    L  +   A+
Sbjct: 467 TRDFESNNISTGWLDDL--ILKNLSSDSKLDPTLAIICGAAM 506

 Score = 33.1 bits (74), Expect = 1.6,   Method: Compositional matrix adjust.
 Identities = 16/51 (31%), Positives = 28/51 (54%)

Query: 1099 DPLHIGAPMAGVIVEVKVHKGSLIKKGQPVAVLSAMKMEMIISSPSDGQVK 1149
            +P  + +P  G +V+  V  G  +  GQ  A +  MKM+M + + SDG ++
Sbjct: 618  NPTQVISPTPGKLVKYLVRSGDHVFAGQQYAEIEIMKMQMPLVAKSDGVIE 668

>Kwal_23.6157
          Length = 2230

 Score =  176 bits (446), Expect = 3e-44,   Method: Compositional matrix adjust.
 Identities = 146/534 (27%), Positives = 238/534 (44%), Gaps = 89/534 (16%)

Query: 20  NKILVANRGEIPIRIFRT---------AHELSMQTVAIYSHED-RLSTHKQKADEAYVIG 69
           +K+L+AN G   ++  R+          +E ++Q VA+ + ED   +    +  + YV  
Sbjct: 61  SKVLIANNGIAAVKEIRSVRKWAYETFGNERAVQFVAMATPEDLEANAEYLRMADQYV-- 118

Query: 70  EVGQYTPVGAYLAIDEIISIAQKHQVDFIHPGYGFLSENSEFADKVVKA--GITWIGPPA 127
           EV   T    Y  +D I+ +A++  VD +  G+G  SEN    +++  +   + +IGPP 
Sbjct: 119 EVPGGTNNNNYANVDLIVELAERADVDAVWAGWGHASENPLLPERLAASPRKVIFIGPPG 178

Query: 128 EVIDSVGDKVSARNLAAKANVPTVP--GT----------------------PGPIETVEE 163
             + S+GDK+S+  +A  A VP +P  GT                       G  ++ E+
Sbjct: 179 NAMRSLGDKISSTIVAQHAKVPCIPWSGTGVDQVHLDEENGLVSVTDDIYQKGCCDSPED 238

Query: 164 ALDFVNEYGYPVIIKAAFXXXXXXXXXXXXXXXXADAFQRATSEARTAFGNGTCFVERFL 223
            L    + G+PV++KA+                    +++A +E          F+ +  
Sbjct: 239 GLAKAKKIGFPVMVKASEGGGGKGIRKVEREQDFIPLYKQAANE----IPGSPIFIMKLA 294

Query: 224 DKPKHIEVQLLADNHGNVVHLFERDCSVQRRHQKVVEVAPAKTLPREVRDAILTDAVKLA 283
              +H+EVQLLAD +G  + LF RDCSVQRRHQK++E AP      +    +   AV+L 
Sbjct: 295 GNARHLEVQLLADQYGTNISLFGRDCSVQRRHQKIIEEAPVTIAKPDTFTEMERSAVRLG 354

Query: 284 KECGYRNAGTAEFLVD-NQNRHYFIEINPRIQVEHTITEEITXXXXXXXXXXXXXXXSLP 342
           K  GY +AGT E+L   + ++ YF+E+NPR+QVEH  TE ++                + 
Sbjct: 355 KLVGYVSAGTVEYLYSHDDDKFYFLELNPRLQVEHPTTEMVSGVNLPAAQLQIAMGIPMH 414

Query: 343 QL-------GL-------------------FQDKITTRGFAIQCRITTEDPAKNFQPDTG 376
           ++       G+                    Q + T +G    CRIT+EDP + F+P  G
Sbjct: 415 RIKDIRLMYGVDPHTATEIDFDFSSKDSTKIQRRPTPKGHCTACRITSEDPNEGFKPSGG 474

Query: 377 RIEV--YRSA----GGNGVRLDGGNAYAGTIISPHYDSMLVKCSCSGSTYEIVRRKMIRA 430
            +    +RS+    G   V   GG       I    DS        G   +  R+ M+ A
Sbjct: 475 SLHELNFRSSSNVWGYFSVSSSGG-------IHSFSDSQFGHIFAFGENRQASRKHMVVA 527

Query: 431 LIEFRIRG-VKTNIPFLLTLLTNPVFIEGTYWTTFIDDTPQLFQMVSSQNRAQK 483
           L E  IRG  +T + +L+ LL    F   +  T ++DD      ++S +  A+K
Sbjct: 528 LKELSIRGDFRTTVEYLIKLLETEDFEGNSITTGWLDD------LISQKMTAEK 575

 Score = 33.5 bits (75), Expect = 1.5,   Method: Compositional matrix adjust.
 Identities = 16/52 (30%), Positives = 26/52 (50%)

Query: 1098 HDPLHIGAPMAGVIVEVKVHKGSLIKKGQPVAVLSAMKMEMIISSPSDGQVK 1149
            +DP  +  P  G +V+     G  +  GQP A +  MKM+M + S   G ++
Sbjct: 699  NDPTQLRTPSPGKLVKFLFESGDHVIAGQPYAEVEVMKMQMPLVSQESGIIQ 750

>Kwal_33.14061
          Length = 2221

 Score = 52.4 bits (124), Expect = 3e-06,   Method: Compositional matrix adjust.
 Identities = 70/326 (21%), Positives = 125/326 (38%), Gaps = 40/326 (12%)

Query: 18  EKNKILVANRGEIPI-----------RIFRTAHELSMQTVAIYSHEDRLSTHKQKADEAY 66
           E  K+LV   G + I           +  +   E  + T+ I  +   + T K  AD+ Y
Sbjct: 437 EAKKVLVLGSGGLSIGQAGEFDYSGSQAIKALKEEGIYTILINPNIATIQTSKGLADKVY 496

Query: 67  VIGEVGQYTPVGAYLAIDEIISIAQKHQVDFIHPGYGFLSENSEFADKVVKAGITWIGPP 126
                  + PV A   + ++I   +   +     G   LS   E  D+    G+  +G P
Sbjct: 497 -------FLPVNAEF-VRKVILHERPDAIYVTFGGQTALSVGIEMKDEFEALGVKVLGTP 548

Query: 127 AEVIDSVGDKVSARNLAAKANVPTVPGTPGPIETVEEALDFVNEYGYPVIIKAAFXXXXX 186
            + + +  D+    N   + N            TVEEAL+ V E G+PVI +AA+     
Sbjct: 549 IDTVITTEDRELFSNAMDEINEKCAKSKAAA--TVEEALEAVKEIGFPVICRAAYALGGL 606

Query: 187 XXXXXXXXXXXADAFQRATSEARTAFGNG-TCFVERFLDKPKHIEVQLLADNHGNVVHLF 245
                       D           AF +     VER +   K +E +++ D   N + + 
Sbjct: 607 GSGFANNEKELVDL-------CNIAFASSPQVLVERSMKGWKEVEYEVVRDAFDNCITV- 658

Query: 246 ERDCSVQR------RHQKVVEVAPAKTLPREVRDAILTDAVKLAKECGYRNAGTAEFLVD 299
              C+++            + VAP++TL  E  + + T AV + +  G       ++ ++
Sbjct: 659 ---CNMENFDPLGIHTGDSIVVAPSQTLSDEDYNMLRTTAVNVIRHLGVVGECNIQYALN 715

Query: 300 NQNRHY-FIEINPRIQVEHTITEEIT 324
             ++ Y  IE+N R+     +  + T
Sbjct: 716 PFSKEYCIIEVNARLSRSSALASKAT 741

 Score = 31.6 bits (70), Expect = 5.7,   Method: Compositional matrix adjust.
 Identities = 48/280 (17%), Positives = 105/280 (37%), Gaps = 24/280 (8%)

Query: 36   RTAHELSMQTVAIYSHEDRLSTHKQKADEAYVIGEVGQYTPVGAYLAIDEIISIAQKHQV 95
            RT  +  ++++ +  + + +ST   +AD  Y              + ++ I+ I +    
Sbjct: 1007 RTLRKEKIKSIMVNYNPETVSTDYDEADRLYF-----------ETICLERILDIYEIESS 1055

Query: 96   DFIHPGYGFLSENSEFADKVVKAGITWIGPPAEVIDSVGDKVSARNLAAKANVPTVPGTP 155
              +    G  + N+  A  + +  +  +G   E+IDS  ++     +  +  V      P
Sbjct: 1056 AGVVVSMGGQTSNN-IAMSLHRENVKILGTTPEMIDSAENRYKFSRMLDQIGV----DQP 1110

Query: 156  G--PIETVEEALDFVNEYGYPVIIKAAFXXXXXXXXXXXXXXXXADAFQRATSEARTAFG 213
                + ++EEA  F +   +PV+++ ++                A    +A   +R    
Sbjct: 1111 AWKELTSIEEAEQFADAVSFPVLVRPSYVLSGAAMNTVYSKDDLASYLNQAVEVSR---- 1166

Query: 214  NGTCFVERFLDKPKHIEVQLLADNHGNVVHLFERDCSVQRRHQ-KVVEVAPAKTLPREVR 272
            +    + ++++  K IE+  +A +   V+H+          H      + P + L  E  
Sbjct: 1167 DYPVVITKYIENAKEIEMDAVAKDGELVMHVVSEHVENAGVHSGDATLIVPPQDLDPETV 1226

Query: 273  DAILTDAVKLAKECGYRNAGTAEFLVDNQNRHYFIEINPR 312
            + I+    K+ K          +F+  N N    IE N R
Sbjct: 1227 ERIVVATAKIGKALKITGPFNIQFIAKN-NDIKVIECNVR 1265

>Sklu_2331.1 YJL130C, Contig c2331 2029-8691
          Length = 2220

 Score = 52.4 bits (124), Expect = 3e-06,   Method: Compositional matrix adjust.
 Identities = 69/326 (21%), Positives = 126/326 (38%), Gaps = 40/326 (12%)

Query: 18  EKNKILVANRGEIPI-----------RIFRTAHELSMQTVAIYSHEDRLSTHKQKADEAY 66
           E  K+LV   G + I           +  +   E  + T+ I  +   + T K  AD+ Y
Sbjct: 437 EAKKVLVLGSGGLSIGQAGEFDYSGSQAIKALKEEGIYTILINPNIATIQTSKGLADKVY 496

Query: 67  VIGEVGQYTPVGAYLAIDEIISIAQKHQVDFIHPGYGFLSENSEFADKVVKAGITWIGPP 126
                  + PV A   + ++I   +   +     G   LS   E  D+    G+  +G P
Sbjct: 497 -------FLPVTAEF-VRKVILHERPDAIYVTFGGQTALSVGIEMKDEFETLGVKVLGTP 548

Query: 127 AEVIDSVGDKVSARNLAAKANVPTVPGTPGPIETVEEALDFVNEYGYPVIIKAAFXXXXX 186
            + + +  D+    N   + N            TV+EAL+ V E G+PVI++AA+     
Sbjct: 549 IDTVITTEDRELFSNAMDEINEKCAKSKAA--STVKEALEAVKEIGFPVIVRAAYALGGL 606

Query: 187 XXXXXXXXXXXADAFQRATSEARTAFGNG-TCFVERFLDKPKHIEVQLLADNHGNVVHLF 245
                       D           AF +     VER +   K +E +++ D   N + + 
Sbjct: 607 GSGFASNETELVDL-------CNVAFASSPQVLVERSMKGWKEVEYEVVRDAFDNCITV- 658

Query: 246 ERDCSVQR------RHQKVVEVAPAKTLPREVRDAILTDAVKLAKECGYRNAGTAEFLVD 299
              C+++            + VAP++TL  E  + + T AV + +  G       ++ ++
Sbjct: 659 ---CNMENFDPLGIHTGDSIVVAPSQTLSDEDYNMLRTTAVNVIRHLGVVGECNIQYALN 715

Query: 300 NQNRHY-FIEINPRIQVEHTITEEIT 324
             ++ Y  IE+N R+     +  + T
Sbjct: 716 PFSKEYCIIEVNARLSRSSALASKAT 741

 Score = 33.1 bits (74), Expect = 1.9,   Method: Compositional matrix adjust.
 Identities = 30/156 (19%), Positives = 59/156 (37%), Gaps = 6/156 (3%)

Query: 158  IETVEEALDFVNEYGYPVIIKAAFXXXXXXXXXXXXXXXXADAFQRATSEARTAFGNGTC 217
            + +++EA  F    GYPV+++ ++                A    +A   +R    +   
Sbjct: 1115 LTSIDEAEGFAENVGYPVLVRPSYVLSGAAMNTVYSKDDLASYLNQAVEVSR----DYPV 1170

Query: 218  FVERFLDKPKHIEVQLLADNHGNVVHLFERDCSVQRRHQ-KVVEVAPAKTLPREVRDAIL 276
             + ++++  K IE+  +A +   V+H+          H      + P + L  E  + I+
Sbjct: 1171 VITKYIENAKEIEMDAVAKDGELVMHVVSEHVENAGVHSGDATLIVPPQDLDPETVNRIV 1230

Query: 277  TDAVKLAKECGYRNAGTAEFLVDNQNRHYFIEINPR 312
                K+ K          +F+  N N    IE N R
Sbjct: 1231 VATAKIGKALKITGPYNIQFIAKN-NDIKVIECNVR 1265

>CAGL0L05676g 619734..626369 highly similar to sp|P07259
           Saccharomyces cerevisiae YJL130c URA2, start by
           similarity
          Length = 2211

 Score = 49.3 bits (116), Expect = 2e-05,   Method: Compositional matrix adjust.
 Identities = 72/328 (21%), Positives = 128/328 (39%), Gaps = 44/328 (13%)

Query: 18  EKNKILVANRGEIPI-----------RIFRTAHELSMQTVAIYSHEDRLSTHKQKADEAY 66
           E  K+LV   G + I           +  +   E  + T+ I  +   + T K  AD+ Y
Sbjct: 435 EAKKVLVLGSGGLSIGQAGEFDYSGSQAIKALKEEGIYTILINPNIATIQTSKGLADKVY 494

Query: 67  VIGEVGQYTPVGAYLAIDEIISIAQKHQVDFIHPGYGFLSENSEFADKVVKAGITWIGPP 126
                  + PV A   + ++I   +   +     G   LS   E  D+    G+  +G P
Sbjct: 495 -------FLPVTAEF-VRKVILHERPDAIYVTFGGQTALSVGIEMKDEFESLGVKVLGTP 546

Query: 127 AEVIDSVGDKVSARNLAAKA--NVPTVPGTPGPIETVEEALDFVNEYGYPVIIKAAFXXX 184
            + I +  D    R L A A   +           +VEEAL  V + G+PVI++AA+   
Sbjct: 547 IDTIITTED----RELFANAIDEIDEKCAKSQAANSVEEALAAVKDIGFPVIVRAAY--- 599

Query: 185 XXXXXXXXXXXXXADAFQRATSEARTAFGNG-TCFVERFLDKPKHIEVQLLADNHGNVVH 243
                        A+  Q        AF +     VER +   K +E +++ D   N + 
Sbjct: 600 ----ALGGLGSGFANNEQELIDLCNVAFASSPQVLVERSMKGWKEVEYEVVRDAFDNCIT 655

Query: 244 LFERDCSVQR------RHQKVVEVAPAKTLPREVRDAILTDAVKLAKECGYRNAGTAEFL 297
           +    C+++            + VAP++TL  E  + + T AV + +  G       ++ 
Sbjct: 656 V----CNMENFDPLGIHTGDSIVVAPSQTLSDEDYNMLRTTAVNVIRHLGVVGECNIQYA 711

Query: 298 VDNQNRHY-FIEINPRIQVEHTITEEIT 324
           ++  ++ Y  IE+N R+     +  + T
Sbjct: 712 LNPFSKEYCIIEVNARLSRSSALASKAT 739

 Score = 36.6 bits (83), Expect = 0.14,   Method: Compositional matrix adjust.
 Identities = 50/280 (17%), Positives = 107/280 (38%), Gaps = 24/280 (8%)

Query: 36   RTAHELSMQTVAIYSHEDRLSTHKQKADEAYVIGEVGQYTPVGAYLAIDEIISIAQKHQV 95
            RT    +++T+ I  + + +ST   +AD  Y              + ++ ++ I +    
Sbjct: 1005 RTLRANNIKTIMINYNPETVSTDYDEADRLYF-----------ETINLERVLDIYEAEAS 1053

Query: 96   DFIHPGYGFLSENSEFADKVVKAGITWIGPPAEVIDSVGDKVSARNLAAKANVPTVPGTP 155
            + +    G  + N+  A  + +  +  +G   ++IDS  ++     +  +  V      P
Sbjct: 1054 NGVVVSMGGQTSNN-IAMSLHRENVKILGTSPDMIDSAENRYKFSRMLDQIGV----DQP 1108

Query: 156  G--PIETVEEALDFVNEYGYPVIIKAAFXXXXXXXXXXXXXXXXADAFQRATSEARTAFG 213
                + +++EA DF  + GYPV+++ ++                     +A   +R    
Sbjct: 1109 AWKELTSMDEAEDFAEKVGYPVLVRPSYVLSGAAMNTVYSKNDLESYLNQAVEVSR---- 1164

Query: 214  NGTCFVERFLDKPKHIEVQLLADNHGNVVHLFERDCSVQRRHQ-KVVEVAPAKTLPREVR 272
            +    + ++++  K IE+  +A N   V+H+          H      + P + L  E  
Sbjct: 1165 DYPVVITKYIENAKEIEMDAVARNGELVMHVVSEHVENAGVHSGDATLIVPPQDLAPETV 1224

Query: 273  DAILTDAVKLAKECGYRNAGTAEFLVDNQNRHYFIEINPR 312
            D I+    K+ K          +F+  + N    IE N R
Sbjct: 1225 DRIVVATAKIGKALKITGPYNIQFIAKD-NEIKVIECNVR 1263

>ABR157W [750] [Homologous to ScYJR109C (CPA2) - SH]
           complement(695747..699088) [3342 bp, 1113 aa]
          Length = 1113

 Score = 48.9 bits (115), Expect = 3e-05,   Method: Compositional matrix adjust.
 Identities = 53/239 (22%), Positives = 98/239 (41%), Gaps = 27/239 (11%)

Query: 117 KAGITWIGPPAEVIDSVGDKVSARNLAAKA----NVPTVPGTPGPIETVEEALDFVNEYG 172
           K G+T +G P  V+++  D    R L A+A    N+P          TVE+A+   N+ G
Sbjct: 131 KYGVTVLGTPISVLETTED----RELFARALKEINMPIAESVA--CSTVEDAVAAANDIG 184

Query: 173 YPVIIKAAFXXXXXXXXXXXXXXXXADAFQRATSEARTAFGNGTCFVERFLDKPKHIEVQ 232
           YPVI+++A+                 D  Q     A++   +    VE+ L   K IE +
Sbjct: 185 YPVIVRSAYALGGLGSGFAD------DDLQLRQLCAQSLALSPQVLVEKSLKGWKEIEYE 238

Query: 233 LLADNHGNVVHLFERDCSVQR------RHQKVVEVAPAKTLPREVRDAILTDAVKLAKEC 286
           ++ D  GN + +    C+++            + +AP++TL  E    + T A+++ +  
Sbjct: 239 VVRDRVGNCITV----CNMENFDPLGIHTGDSIVLAPSQTLSDEEFHMLRTAAIEIIRHL 294

Query: 287 GYRNAGTAEFLVDNQNRHY-FIEINPRIQVEHTITEEITXXXXXXXXXXXXXXXSLPQL 344
           G       ++ +      +  IE+N R+     +  + T               +LP+L
Sbjct: 295 GVVGECNVQYALQPDGLAFKVIEVNARLSRSSALASKATGYPLAYTAAKIALGYTLPEL 353

>ACR263C [1310] [Homologous to ScYJL130C (URA2) - SH]
           (827830..834552) [6723 bp, 2240 aa]
          Length = 2240

 Score = 48.1 bits (113), Expect = 5e-05,   Method: Compositional matrix adjust.
 Identities = 69/326 (21%), Positives = 126/326 (38%), Gaps = 40/326 (12%)

Query: 18  EKNKILVANRGEIPI-----------RIFRTAHELSMQTVAIYSHEDRLSTHKQKADEAY 66
           E  K+LV   G + I           +  +   E  + T+ I  +   + T K  AD+ Y
Sbjct: 453 EPKKVLVLGSGGLSIGQAGEFDYSGSQAIKALKEEGIYTILINPNIATIQTSKGLADKVY 512

Query: 67  VIGEVGQYTPVGAYLAIDEIISIAQKHQVDFIHPGYGFLSENSEFADKVVKAGITWIGPP 126
                  + PV A   + ++I   +   +     G   LS   E  D+    G+  +G  
Sbjct: 513 -------FLPVTAEF-VRKVILHERPDAIYVTFGGQTALSVGIEMKDEFEALGVKVLGTS 564

Query: 127 AEVIDSVGDKVSARNLAAKANVPTVPGTPGPIETVEEALDFVNEYGYPVIIKAAFXXXXX 186
            + I +  D+    N   + N            TV+EAL+ V + G+PVI++AA+     
Sbjct: 565 IDTIITTEDRELFANAMDEINEKCAKSKAA--STVDEALEAVKDIGFPVIVRAAY----- 617

Query: 187 XXXXXXXXXXXADAFQRATSEARTAFGNG-TCFVERFLDKPKHIEVQLLADNHGNVVHLF 245
                      A   Q        AF +     VER +   K +E +++ D   N + + 
Sbjct: 618 --ALGGLGSGFASNEQELVDLCNVAFASSPQVLVERSMKGWKEVEYEVVRDAFDNCITV- 674

Query: 246 ERDCSVQR------RHQKVVEVAPAKTLPREVRDAILTDAVKLAKECGYRNAGTAEFLVD 299
              C+++            + VAP++TL  E  + + T AV + +  G       ++ ++
Sbjct: 675 ---CNMENFDPLGIHTGDSIVVAPSQTLSDEDYNMLRTTAVNVIRHLGVVGECNIQYALN 731

Query: 300 NQNRHY-FIEINPRIQVEHTITEEIT 324
             ++ Y  IE+N R+     +  + T
Sbjct: 732 PFSKEYCIIEVNARLSRSSALASKAT 757

 Score = 34.7 bits (78), Expect = 0.62,   Method: Compositional matrix adjust.
 Identities = 30/156 (19%), Positives = 59/156 (37%), Gaps = 6/156 (3%)

Query: 158  IETVEEALDFVNEYGYPVIIKAAFXXXXXXXXXXXXXXXXADAFQRATSEARTAFGNGTC 217
            + ++EEA DF N+ GYPV+++ ++                     +A   +R        
Sbjct: 1131 LTSMEEAEDFANKVGYPVLVRPSYVLSGAAMNTVYSKDDLESYLNQAVEVSREY----PV 1186

Query: 218  FVERFLDKPKHIEVQLLADNHGNVVHLFERDCSVQRRHQ-KVVEVAPAKTLPREVRDAIL 276
             + ++++  K IE+  +A +   ++H+          H      + P + L  E    I+
Sbjct: 1187 VITKYIENAKEIEMDAVAKDGEMIMHVVSEHVENAGVHSGDATLIVPPQDLDPETVRRIV 1246

Query: 277  TDAVKLAKECGYRNAGTAEFLVDNQNRHYFIEINPR 312
                K+ +          +F+  N N    IE N R
Sbjct: 1247 DATAKIGRALKITGPYNIQFIAKN-NEIKVIECNVR 1281

>YJL130C (URA2) [2788] chr10 complement(165641..172285)
           Multifunctional protein of pyrimidine biosynthesis
           pathway, contains glutamine amidotransferase,
           glutamine-dependent carbamylphosphate synthetase
           (CPSase), dihydroorotase-like (DHOase) domain, and
           aspartate carbamyltransferase (ATCase) [6645 bp, 2214
           aa]
          Length = 2214

 Score = 47.0 bits (110), Expect = 1e-04,   Method: Compositional matrix adjust.
 Identities = 67/325 (20%), Positives = 124/325 (38%), Gaps = 38/325 (11%)

Query: 18  EKNKILVANRGEIPI-----------RIFRTAHELSMQTVAIYSHEDRLSTHKQKADEAY 66
           E  K+LV   G + I           +  +   E  + T+ I  +   + T K  AD+ Y
Sbjct: 437 EAKKVLVLGSGGLSIGQAGEFDYSGSQAIKALKEEGIYTILINPNIATIQTSKGLADKVY 496

Query: 67  VIGEVGQYTPVGAYLAIDEIISIAQKHQVDFIHPGYGFLSENSEFADKVVKAGITWIGPP 126
                  + PV A   + ++I   +   +     G   LS      D+    G+  +G P
Sbjct: 497 -------FVPVTAEF-VRKVILHERPDAIYVTFGGQTALSVGIAMKDEFEALGVKVLGTP 548

Query: 127 AEVIDSVGDKVSARNLAAKANVPTVPGTPGPIETVEEALDFVNEYGYPVIIKAAFXXXXX 186
            + I +  D+    N   + N            +V+EAL  V E G+PVI++AA+     
Sbjct: 549 IDTIITTEDRELFSNAIDEINEKCAKSQAA--NSVDEALAAVKEIGFPVIVRAAYALGGL 606

Query: 187 XXXXXXXXXXXADAFQRATSEARTAFGNGTCFVERFLDKPKHIEVQLLADNHGNVVHLFE 246
                       D    A S +          VE+ +   K +E +++ D   N + +  
Sbjct: 607 GSGFANNEKELVDLCNVAFSSS------PQVLVEKSMKGWKEVEYEVVRDAFDNCITV-- 658

Query: 247 RDCSVQR------RHQKVVEVAPAKTLPREVRDAILTDAVKLAKECGYRNAGTAEFLVDN 300
             C+++            + VAP++TL  E  + + T AV + +  G       ++ ++ 
Sbjct: 659 --CNMENFDPLGIHTGDSIVVAPSQTLSDEDYNMLRTTAVNVIRHLGVVGECNIQYALNP 716

Query: 301 QNRHY-FIEINPRIQVEHTITEEIT 324
            ++ Y  IE+N R+     +  + T
Sbjct: 717 VSKDYCIIEVNARLSRSSALASKAT 741

 Score = 33.5 bits (75), Expect = 1.4,   Method: Compositional matrix adjust.
 Identities = 30/156 (19%), Positives = 59/156 (37%), Gaps = 6/156 (3%)

Query: 158  IETVEEALDFVNEYGYPVIIKAAFXXXXXXXXXXXXXXXXADAFQRATSEARTAFGNGTC 217
            + +++EA  F  + GYPV+++ ++                     +A   +R    +   
Sbjct: 1115 LTSMDEAESFAEKVGYPVLVRPSYVLSGAAMNTVYSKNDLESYLNQAVEVSR----DYPV 1170

Query: 218  FVERFLDKPKHIEVQLLADNHGNVVHLFERDCSVQRRHQ-KVVEVAPAKTLPREVRDAIL 276
             + ++++  K IE+  +A N   V+H+          H      + P + L  E  D I+
Sbjct: 1171 VITKYIENAKEIEMDAVARNGELVMHVVSEHVENAGVHSGDATLIVPPQDLAPETVDRIV 1230

Query: 277  TDAVKLAKECGYRNAGTAEFLVDNQNRHYFIEINPR 312
                K+ K          +F+  + N    IE N R
Sbjct: 1231 VATAKIGKALKITGPYNIQFIAKD-NEIKVIECNVR 1265

>Scas_582.4*
          Length = 2193

 Score = 47.0 bits (110), Expect = 1e-04,   Method: Compositional matrix adjust.
 Identities = 70/326 (21%), Positives = 125/326 (38%), Gaps = 40/326 (12%)

Query: 18  EKNKILVANRGEIPI-----------RIFRTAHELSMQTVAIYSHEDRLSTHKQKADEAY 66
           E  K+LV   G + I           +  +   E  + T+ I  +   + T K  AD+ Y
Sbjct: 432 EAKKVLVLGSGGLSIGQAGEFDYSGSQAIKALKEEGIYTILINPNIATIQTSKGLADKVY 491

Query: 67  VIGEVGQYTPVGAYLAIDEIISIAQKHQVDFIHPGYGFLSENSEFADKVVKAGITWIGPP 126
                  + PV A   + ++I   +   +     G   LS   E  D+    G+  +G  
Sbjct: 492 -------FLPVTAEF-VRKVILHERPDAIYVTFGGQTALSVGIEMKDEFESLGVKVLGTQ 543

Query: 127 AEVIDSVGDKVSARNLAAKANVPTVPGTPGPIETVEEALDFVNEYGYPVIIKAAFXXXXX 186
            + I +  D+    N   + N            +VEEAL  V + G+PVI++AA+     
Sbjct: 544 IDTIITTEDRELFANAIDEINEKCAKSHAA--NSVEEALTAVKDIGFPVIVRAAY----- 596

Query: 187 XXXXXXXXXXXADAFQRATSEARTAFGNG-TCFVERFLDKPKHIEVQLLADNHGNVVHLF 245
                      A+  Q        AF +     VER +   K IE +++ D   N V + 
Sbjct: 597 --ALGGLGSGFANNEQELIDLCNVAFASSPQVLVERSMKGWKEIEYEVVRDAFDNCVTV- 653

Query: 246 ERDCSVQR------RHQKVVEVAPAKTLPREVRDAILTDAVKLAKECGYRNAGTAEFLVD 299
              C+++            + VAP++TL  E  + +   AV + +  G       ++ ++
Sbjct: 654 ---CNMENFDPLGIHTGDSIVVAPSQTLSDEEYNMLRNTAVNVIRHLGVVGECNIQYALN 710

Query: 300 NQNRHY-FIEINPRIQVEHTITEEIT 324
             ++ Y  IE+N R+     +  + T
Sbjct: 711 PFSKEYCIIEVNARLSRSSALASKAT 736

 Score = 39.3 bits (90), Expect = 0.025,   Method: Compositional matrix adjust.
 Identities = 52/278 (18%), Positives = 106/278 (38%), Gaps = 20/278 (7%)

Query: 36   RTAHELSMQTVAIYSHEDRLSTHKQKADEAYVIGEVGQYTPVGAYLAIDEIISIAQKHQV 95
            RT     ++T+ I  + + +ST   +AD  Y              + ++ I+ I +    
Sbjct: 982  RTLRANKIKTIMINYNPETVSTDYDEADRLYF-----------ETINLERILDIYEIENS 1030

Query: 96   DFIHPGYGFLSENSEFADKVVKAGITWIGPPAEVIDSVGDKVSARNLAAKANVPTVPGTP 155
              +    G  + N+  A  + +  +  +G   E+IDS  ++     +  +  V   P   
Sbjct: 1031 SGVVVSMGGQTSNN-IAMSLHRENVKILGTSPEMIDSAENRYKFSRMLDQIGVDQ-PAWK 1088

Query: 156  GPIETVEEALDFVNEYGYPVIIKAAFXXXXXXXXXXXXXXXXADAFQRATSEARTAFGNG 215
              + +++EA  F  + GYPV+++ ++                A    +A   +R    + 
Sbjct: 1089 -ELTSMDEAESFAEKVGYPVLVRPSYVLSGAAMNTVYSKNDLASYLNQAVEVSR----DY 1143

Query: 216  TCFVERFLDKPKHIEVQLLADNHGNVVHLFERDCSVQRRHQ-KVVEVAPAKTLPREVRDA 274
               + ++++  K IE+  +A N   V+H+          H      + P + L +E  D 
Sbjct: 1144 PVVITKYIENAKEIEMDAVARNGELVMHVVSEHVENAGVHSGDATLIVPPQDLAKETVDR 1203

Query: 275  ILTDAVKLAKECGYRNAGTAEFLVDNQNRHYFIEINPR 312
            I+    K+ K          +F+  + N    IE N R
Sbjct: 1204 IVVATAKIGKALKITGPYNIQFIAKD-NEIKVIECNVR 1240

>Kwal_55.19783
          Length = 1121

 Score = 46.2 bits (108), Expect = 2e-04,   Method: Compositional matrix adjust.
 Identities = 55/251 (21%), Positives = 99/251 (39%), Gaps = 27/251 (10%)

Query: 117 KAGITWIGPPAEVIDSVGDKVSARNLAAKA----NVPTVPGTPGPIETVEEALDFVNEYG 172
           K G+  +G P + +++  D    R+L A+A    N+PT        ETV+EAL   +  G
Sbjct: 134 KYGVKVLGTPIKTLETSED----RDLFAQALKEINIPTAESFA--CETVDEALSAASRVG 187

Query: 173 YPVIIKAAFXXXXXXXXXXXXXXXXADAFQRATSEARTAFGNGTCFVERFLDKPKHIEVQ 232
           YPVI+++A+                 +   +A S +          VE+ L   K +E +
Sbjct: 188 YPVIVRSAYALGGLGSGFAENEAEMKELAAQALSLSP------QILVEKSLKGWKEVEYE 241

Query: 233 LLADNHGNVVHLFERDCSVQR------RHQKVVEVAPAKTLPREVRDAILTDAVKLAKEC 286
           ++ D   N + +    C+++            +  AP++TL  E    + T A+K+ +  
Sbjct: 242 VVRDRVDNCITV----CNMENFDPLGVHTGDSIVFAPSQTLSDEEFHMLRTAAIKIIRHL 297

Query: 287 GYRNAGTAEFLVDNQNRHY-FIEINPRIQVEHTITEEITXXXXXXXXXXXXXXXSLPQLG 345
           G       ++ +      Y  IE+N R+     +  + T               +LP+L 
Sbjct: 298 GVVGECNVQYALQPDGLDYRVIEVNARLSRSSALASKATGYPLAYTAAKIALGYTLPELP 357

Query: 346 LFQDKITTRGF 356
               K T   F
Sbjct: 358 NPVTKTTVANF 368

 Score = 32.7 bits (73), Expect = 2.5,   Method: Compositional matrix adjust.
 Identities = 28/148 (18%), Positives = 57/148 (38%), Gaps = 7/148 (4%)

Query: 158 IETVEEALDFVNEYGYPVIIKAAFXXXXXXXXXXXXXXXXADAFQRATSEARTAFGNGTC 217
           + +V EA DF    GYPV+I+ ++                 D  +   + A     +   
Sbjct: 717 LSSVSEAKDFSKSVGYPVLIRPSYVLSGAAMSVVNSE----DELETKLTNASDVSPDHPV 772

Query: 218 FVERFLDKPKHIEVQLLADNHGNVVHLFERDCSVQRRHQ-KVVEVAPAKTLPREVRDAIL 276
            + +F++  + I+V  +A N   +VH           H      + P ++L   +++ + 
Sbjct: 773 VISKFIEGAQEIDVDAVAYNGEVLVHAISEHVENAGVHSGDATLILPPQSLSESIKERLY 832

Query: 277 TDAVKLAKECGYRNAGTAEFLVDNQNRH 304
             A K+A    ++  G     +   +RH
Sbjct: 833 DIAKKVAH--AWKITGPFNMQIIKDDRH 858

>KLLA0E23782g complement(2105401..2106582) highly similar to
           sp|Q12122 Saccharomyces cerevisiae YDL131w LYS21
           homocitrate synthase, start by similarity
          Length = 393

 Score = 41.6 bits (96), Expect = 0.003,   Method: Compositional matrix adjust.
 Identities = 47/218 (21%), Positives = 88/218 (40%), Gaps = 21/218 (9%)

Query: 717 LEIAEKIVQMGTHILGIKDMAGTMKPAAAKLLIGSLRAKYPDLPIHVHTHDSAGTAVASM 776
           L I + + ++G + +GI D  G   P     L+ +L++      I  H HD  G A+ + 
Sbjct: 165 LNIYKTVDKIGVNRVGIADTVGCANPRQVYELVRTLKS-VVSCDIECHFHDDTGCAIGNS 223

Query: 777 TACALAGADVVDVA---INSMSGLTSQPSINA-LLASLEGNIDTGINVEHVRELDAYWAE 832
            +   AGA ++DV+   I   +G+TS   + A ++ S    + +   +  +R+L+   A+
Sbjct: 224 YSALEAGARLIDVSVLGIGERNGITSLGGLMARMIVSAPEYVKSKYKLHKLRDLENLVAD 283

Query: 833 MRLLYSCFEADLKG-----PDPEVYQHEIPGGQLTNLLFQAQQLGLGEQ---------WA 878
              +   F   + G         ++   I     T  +   +  G+            W 
Sbjct: 284 AVSVNVPFNNPITGFCAFTHKAGIHAKAILANPSTYEILNPEDFGMKRYIHFANRLTGWN 343

Query: 879 ETKRAYREANYLLGD--IVKVTPTSKVVGDLAQFMVSN 914
             K    + N  L D  I +VT   K +GD+ Q  + +
Sbjct: 344 AIKSRVEQLNLHLSDDQIKEVTSKIKQIGDVRQLSIED 381

>Sklu_2413.4 YJR109C, Contig c2413 10886-14254
          Length = 1122

 Score = 41.6 bits (96), Expect = 0.005,   Method: Compositional matrix adjust.
 Identities = 52/251 (20%), Positives = 99/251 (39%), Gaps = 27/251 (10%)

Query: 117 KAGITWIGPPAEVIDSVGDKVSARNLAAKA----NVPTVPGTPGPIETVEEALDFVNEYG 172
           K G+  +G P + +++  D    R+L A+A    N+P         ET+++AL+   +  
Sbjct: 134 KYGVKVLGTPIKTLETSED----RDLFAQALKEINIPIAESFA--CETIDQALEAAAKVK 187

Query: 173 YPVIIKAAFXXXXXXXXXXXXXXXXADAFQRATSEARTAFGNGTCFVERFLDKPKHIEVQ 232
           YPVI+++A+                 +   ++ S A          VE+ L   K IE +
Sbjct: 188 YPVIVRSAYALGGLGSGFANDEQEMKELASQSLSLAP------QILVEKSLKGWKEIEYE 241

Query: 233 LLADNHGNVVHLFERDCSVQR------RHQKVVEVAPAKTLPREVRDAILTDAVKLAKEC 286
           ++ D  GN + +    C+++            +  AP++TL  E    + + A+K+ +  
Sbjct: 242 VVRDRVGNCITV----CNMENFDPLGIHTGDSIVFAPSQTLSDEEFHMLRSAAIKIIRHL 297

Query: 287 GYRNAGTAEFLVDNQNRHY-FIEINPRIQVEHTITEEITXXXXXXXXXXXXXXXSLPQLG 345
           G       ++ +      Y  IE+N R+     +  + T               +LP+L 
Sbjct: 298 GVVGECNVQYALQPDGLDYRVIEVNARLSRSSALASKATGYPLAYTAAKIALGYTLPELP 357

Query: 346 LFQDKITTRGF 356
               K T   F
Sbjct: 358 NPVTKTTVANF 368

>KLLA0F03190g complement(296883..300236) highly similar to sp|P03965
           Saccharomyces cerevisiae YJR109c CPA2 arginine-specific
           carbamoylphosphate synthase, large chain, start by
           similarity
          Length = 1117

 Score = 40.4 bits (93), Expect = 0.010,   Method: Compositional matrix adjust.
 Identities = 50/244 (20%), Positives = 98/244 (40%), Gaps = 27/244 (11%)

Query: 112 ADKVVKAGITWIGPPAEVIDSVGDKVSARNLAAKA----NVPTVPGTPGPIETVEEALDF 167
           A  + K  I  +G P + +++  D    R+L A+A    ++PT        ETV+ AL+ 
Sbjct: 127 AGVLAKYNIKVLGTPIKTLETSED----RDLFAQALKEIDIPTAESIA--CETVDAALEA 180

Query: 168 VNEYGYPVIIKAAFXXXXXXXXXXXXXXXXADAFQRATSEARTAFGNGTCFVERFLDKPK 227
            +  G+PVI+++A+                     ++ S A          VE+ L   K
Sbjct: 181 ADIVGFPVIVRSAYALGGLGSGFANNAQEMKQLASQSLSLAP------QILVEKSLKGWK 234

Query: 228 HIEVQLLADNHGNVVHLFERDCSVQR------RHQKVVEVAPAKTLPREVRDAILTDAVK 281
            +E +++ D  GN + +    C+++            +  AP++TL  E    + + A+K
Sbjct: 235 EVEYEVVRDRVGNCITV----CNMENFDPLGIHTGDSIVFAPSQTLSDEEFHMLRSAAIK 290

Query: 282 LAKECGYRNAGTAEFLVDNQNRHY-FIEINPRIQVEHTITEEITXXXXXXXXXXXXXXXS 340
           + +  G       ++ +   +  Y  IE+N R+     +  + T               +
Sbjct: 291 IIRHLGVIGECNVQYALSPDSLDYRVIEVNARLSRSSALASKATGYPLAYTAAKIALGYT 350

Query: 341 LPQL 344
           LP+L
Sbjct: 351 LPEL 354

>Kwal_27.12090
          Length = 394

 Score = 39.7 bits (91), Expect = 0.013,   Method: Compositional matrix adjust.
 Identities = 47/218 (21%), Positives = 84/218 (38%), Gaps = 21/218 (9%)

Query: 717 LEIAEKIVQMGTHILGIKDMAGTMKPAAAKLLIGSLRAKYPDLPIHVHTHDSAGTAVASM 776
           L I + +  +G + +GI D  G   P     L+ +L+       I  H HD  G A+ + 
Sbjct: 165 LNIYKTVSAIGVNRVGIADTVGCANPRQVYDLVRTLKGVVT-CDIECHFHDDTGCAIGNA 223

Query: 777 TACALAGADVVDVA---INSMSGLTSQPSINA-LLASLEGNIDTGINVEHVRELDAYWAE 832
            +   AGA ++DV+   I   +G+T    + A ++ +    + +   +  +R+++   AE
Sbjct: 224 YSALEAGAKLIDVSVLGIGERNGITPLGGLMARMIVAAPEYVKSKYKLHKIRDIENLVAE 283

Query: 833 MRLLYSCFEADLKG-----PDPEVYQHEIPGGQLTNLLFQAQQLGLGEQ---------WA 878
              +   F   + G         ++   I     T  +   Q  GL            W 
Sbjct: 284 AVEVNVPFNNPITGFCAFTHKAGIHAKAILANPSTYEILDPQDFGLKRYIHFANRLTGWN 343

Query: 879 ETKRAYREANYLLGD--IVKVTPTSKVVGDLAQFMVSN 914
             K    + N  L D  I  VT   K +GD+ Q  + +
Sbjct: 344 AIKSRVEQLNLHLTDDQIKDVTQKIKKIGDVRQLSIDD 381

>ADR107W [1848] [Homologous to ScYDL131W (LYS21) - SH; ScYDL182W
           (LYS20) - SH] complement(897769..897784,897846..899158)
           [1329 bp, 442 aa]
          Length = 442

 Score = 39.3 bits (90), Expect = 0.017,   Method: Compositional matrix adjust.
 Identities = 61/288 (21%), Positives = 105/288 (36%), Gaps = 62/288 (21%)

Query: 717 LEIAEKIVQMGTHILGIKDMAGTMKPAAAKLLIGSLRAKYPDLPIHVHTHDSAGTAVASM 776
           L I + + ++G + +GI D  G   P     L+ +L++      +  H H+  G A+A+ 
Sbjct: 182 LNIYKTVDKIGVNRVGIADTVGCANPRQVYELVRTLKS-VVSCDVECHFHNDTGCAIANA 240

Query: 777 TACALAGADVVDVAINSMSGLTSQPSINALLASL----EGNIDTGINVEHVRELDAYWAE 832
                 GA +VDV++  +        +  L+A +       + +   +  +R+++   AE
Sbjct: 241 YTALDGGAKLVDVSVLDIGERNEITPLGGLMARMIVAAPDYVKSKYKLHKIRDIENLVAE 300

Query: 833 MRLLYSCFEADLKG----------------PDPEVYQHEIPGG-QLTNLLFQAQQLGLGE 875
              +   F   + G                 +P  Y+   P    +T  +  A +L    
Sbjct: 301 AVEVNVPFNNPITGFCAFTHKAGIHAKAILANPSTYEILNPNDFGMTRYIHFANRL---T 357

Query: 876 QWAETKRAYREAN-YLLGDIVKVTPTSKVVGDLAQFMVSNKLTSDDVRRLANSLDFPDSV 934
            W   K    + N +L  D VK     +V   + QF  S  L  DDV          DS+
Sbjct: 358 GWNAIKSRVDQLNLHLTDDQVK-----EVTAKIKQFGTSRPLNIDDV----------DSI 402

Query: 935 MDFFEGLIGQPYGGFPEPFRSDVLRNKRRKLTCRPG---LELEPFDLE 979
           +  F   I  P                  ++T RP     E+  FDLE
Sbjct: 403 IKAFHAQIATP------------------RVTARPANREEEINGFDLE 432

>Sklu_2431.2 YDL131W, Contig c2431 3030-4214
          Length = 394

 Score = 38.9 bits (89), Expect = 0.019,   Method: Compositional matrix adjust.
 Identities = 30/120 (25%), Positives = 57/120 (47%), Gaps = 5/120 (4%)

Query: 717 LEIAEKIVQMGTHILGIKDMAGTMKPAAAKLLIGSLRAKYPDLPIHVHTHDSAGTAVASM 776
           L I + + ++G   +GI D  G   P     L+ +L++      I  H H+  G A+ + 
Sbjct: 165 LNIYKTVDKIGVDRVGIADTVGCANPRQVYELVRTLKS-VIHCDIECHFHNDTGCAIGNS 223

Query: 777 TACALAGADVVDVA---INSMSGLTSQPSINA-LLASLEGNIDTGINVEHVRELDAYWAE 832
            +   AGA ++DV+   I   +G+TS   + A ++ S    + +   +  +R+L+   AE
Sbjct: 224 YSALEAGARLIDVSVLGIGERNGITSLGGLMARMIVSAPDYVKSKYKLHKLRDLETLVAE 283

>Scas_691.19
          Length = 1117

 Score = 38.1 bits (87), Expect = 0.044,   Method: Compositional matrix adjust.
 Identities = 47/240 (19%), Positives = 89/240 (37%), Gaps = 29/240 (12%)

Query: 117 KAGITWIGPPAEVIDSVGDKVSARNLAAKANVPTVPGTPGPIETVEEALDFVNEYGYPVI 176
           K  +  +G P + + +  D+    N   + N+P          TV+EAL   N   YPVI
Sbjct: 131 KYNVKVLGTPIKTLITSEDRDLFANALKEINIPIANSIA--CATVDEALAAANSIKYPVI 188

Query: 177 IKAAFXXXXXXXXXXXXXXXXADAFQRATSEAR-----TAFGNGTCFVERFLDKPKHIEV 231
           I++A+                   F     E +     +   +    VER +   K +E 
Sbjct: 189 IRSAY-----------ALGGLGSGFANNDQELKQLSSQSLSLSPQILVERSMKGWKEVEY 237

Query: 232 QLLADNHGNVVHLFERDCSVQR------RHQKVVEVAPAKTLPREVRDAILTDAVKLAKE 285
           +++ D  GN + +    C+++            +  AP++TL  E    + + A+K+ + 
Sbjct: 238 EVVRDRVGNCITV----CNMENFDPLGVHTGDSIVFAPSQTLSDEEYHMLRSAAIKIIRH 293

Query: 286 CGYRNAGTAEFLVDNQNRHY-FIEINPRIQVEHTITEEITXXXXXXXXXXXXXXXSLPQL 344
            G       ++ +      Y  IE+N R+     +  + T               +LP+L
Sbjct: 294 LGVIGECNVQYALQPDGLDYCVIEVNARLSRSSALASKATGYPLAYTAAKIALGYTLPEL 353

>KLLA0F05489g 541146..542471 highly similar to sp|Q12122
           Saccharomyces cerevisiae YDL131w LYS21 homocitrate
           synthase, start by similarity
          Length = 441

 Score = 37.7 bits (86), Expect = 0.046,   Method: Compositional matrix adjust.
 Identities = 21/75 (28%), Positives = 37/75 (49%), Gaps = 1/75 (1%)

Query: 717 LEIAEKIVQMGTHILGIKDMAGTMKPAAAKLLIGSLRAKYPDLPIHVHTHDSAGTAVASM 776
           L I + + ++G + +GI D  G   P     L+ +L++      I  H H+  G A+A+ 
Sbjct: 182 LNIYKTVDKIGVNRVGIADTVGCANPRQVYELVRTLKS-VVSCDIECHFHNDTGCAIANA 240

Query: 777 TACALAGADVVDVAI 791
                 GA ++DVA+
Sbjct: 241 YTALEGGARLIDVAV 255

>Scas_701.35
          Length = 430

 Score = 37.4 bits (85), Expect = 0.061,   Method: Compositional matrix adjust.
 Identities = 21/75 (28%), Positives = 36/75 (48%), Gaps = 1/75 (1%)

Query: 717 LEIAEKIVQMGTHILGIKDMAGTMKPAAAKLLIGSLRAKYPDLPIHVHTHDSAGTAVASM 776
           L I + +  +G + +GI D  G   P     L+ +LR+      I  H H+  G A+A+ 
Sbjct: 170 LNIYKTVNSIGVNRVGIADTVGCANPRQVYELVRTLRS-VVSCDIECHFHNDTGCAIANA 228

Query: 777 TACALAGADVVDVAI 791
                 GA ++DV++
Sbjct: 229 YTALEGGARLIDVSV 243

>YDL131W (LYS21) [738] chr4 (227393..228715) Homocitrate synthase
           isoenzyme, involved in lysine metabolism [1323 bp, 440
           aa]
          Length = 440

 Score = 37.0 bits (84), Expect = 0.083,   Method: Compositional matrix adjust.
 Identities = 21/75 (28%), Positives = 37/75 (49%), Gaps = 1/75 (1%)

Query: 717 LEIAEKIVQMGTHILGIKDMAGTMKPAAAKLLIGSLRAKYPDLPIHVHTHDSAGTAVASM 776
           L I + + ++G + +GI D  G   P     LI +L++      I  H H+  G A+A+ 
Sbjct: 180 LNIYKTVDKIGVNRVGIADTVGCANPRQVYELIRTLKS-VVSCDIECHFHNDTGCAIANA 238

Query: 777 TACALAGADVVDVAI 791
                 GA ++DV++
Sbjct: 239 YTALEGGARLIDVSV 253

>YJR109C (CPA2) [3001] chr10 complement(629500..632856)
           Carbamoylphosphate synthetase of arginine biosynthetic
           pathway, synthetase (large) subunit [3357 bp, 1118 aa]
          Length = 1118

 Score = 37.4 bits (85), Expect = 0.094,   Method: Compositional matrix adjust.
 Identities = 50/241 (20%), Positives = 93/241 (38%), Gaps = 27/241 (11%)

Query: 115 VVKAGITWIGPPAEVIDSVGDKVSARNLAAKA----NVPTVPGTPGPIETVEEALDFVNE 170
           + K  +  +G P + + +  D    R+L A A    N+P         ETV+EAL+    
Sbjct: 129 LAKYNVKVLGTPIKTLITSED----RDLFASALKDINIPIAESFA--CETVDEALEAAER 182

Query: 171 YGYPVIIKAAFXXXXXXXXXXXXXXXXADAFQRATSEARTAFGNGTCFVERFLDKPKHIE 230
             YPVI+++A+                 +   ++ S A          VE+ L   K +E
Sbjct: 183 VKYPVIVRSAYALGGLGSGFANNASEMKELAAQSLSLA------PQILVEKSLKGWKEVE 236

Query: 231 VQLLADNHGNVVHLFERDCSVQRRHQKVVEV------APAKTLPREVRDAILTDAVKLAK 284
            +++ D  GN + +    C+++      V        AP++TL  E    + + A+K+ +
Sbjct: 237 YEVVRDRVGNCITV----CNMENFDPLGVHTGDSMVFAPSQTLSDEEFHMLRSAAIKIIR 292

Query: 285 ECGYRNAGTAEFLVDNQNRHY-FIEINPRIQVEHTITEEITXXXXXXXXXXXXXXXSLPQ 343
             G       ++ +      Y  IE+N R+     +  + T               +LP+
Sbjct: 293 HLGVIGECNVQYALQPDGLDYRVIEVNARLSRSSALASKATGYPLAYTAAKIGLGYTLPE 352

Query: 344 L 344
           L
Sbjct: 353 L 353

>CAGL0J09240g 911669..912982 highly similar to sp|Q12122
           Saccharomyces cerevisiae YDL131w LYS21 or sp|P48570
           Saccharomyces cerevisiae YDL182w LYS20, start by
           similarity
          Length = 437

 Score = 37.0 bits (84), Expect = 0.095,   Method: Compositional matrix adjust.
 Identities = 22/94 (23%), Positives = 43/94 (45%), Gaps = 1/94 (1%)

Query: 717 LEIAEKIVQMGTHILGIKDMAGTMKPAAAKLLIGSLRAKYPDLPIHVHTHDSAGTAVASM 776
           L I + + ++G + +GI D  G   P     L+ +L++      I  H H+  G A+A+ 
Sbjct: 177 LNIYKTVDKIGVNRVGIADTVGCANPRQVYELVRTLKS-VVSCDIECHFHNDTGCAIANA 235

Query: 777 TACALAGADVVDVAINSMSGLTSQPSINALLASL 810
                 GA ++DV++  +        +  L+A +
Sbjct: 236 YTALEGGAKLIDVSVLGIGERNGITPLGGLMARM 269

>Scas_704.3
          Length = 438

 Score = 36.6 bits (83), Expect = 0.12,   Method: Compositional matrix adjust.
 Identities = 20/75 (26%), Positives = 37/75 (49%), Gaps = 1/75 (1%)

Query: 717 LEIAEKIVQMGTHILGIKDMAGTMKPAAAKLLIGSLRAKYPDLPIHVHTHDSAGTAVASM 776
           L I + + ++G + +GI D  G   P     L+ +L++      I  H H+  G A+A+ 
Sbjct: 179 LNIYKTVNKIGVNRVGIADTVGCANPRQVYELVRTLKS-VVSCDIECHFHNDTGCAIANA 237

Query: 777 TACALAGADVVDVAI 791
                 GA ++DV++
Sbjct: 238 YTALEGGARLIDVSV 252

>CAGL0J06402g complement(608851..610146) highly similar to sp|Q12122
           Saccharomyces cerevisiae YDL131w LYS21 or sp|P48570
           Saccharomyces cerevisiae YDL182w LYS20, hypothetical
           start
          Length = 431

 Score = 36.6 bits (83), Expect = 0.12,   Method: Compositional matrix adjust.
 Identities = 20/75 (26%), Positives = 37/75 (49%), Gaps = 1/75 (1%)

Query: 717 LEIAEKIVQMGTHILGIKDMAGTMKPAAAKLLIGSLRAKYPDLPIHVHTHDSAGTAVASM 776
           L I + + ++G + +GI D  G   P     L+ +L++      I  H H+  G A+A+ 
Sbjct: 165 LNIYKTVDKIGVNRVGIADTVGCANPRQVYELVRTLKS-VVSCDIECHFHNDTGCAIANA 223

Query: 777 TACALAGADVVDVAI 791
                 GA ++DV++
Sbjct: 224 YTALEGGAKLIDVSV 238

>YDL182W (LYS20) [690] chr4 (133438..134724) Homocitrate synthase
           isoenzyme, involved in lysine biosynthesis [1287 bp, 428
           aa]
          Length = 428

 Score = 36.6 bits (83), Expect = 0.13,   Method: Compositional matrix adjust.
 Identities = 21/75 (28%), Positives = 37/75 (49%), Gaps = 1/75 (1%)

Query: 717 LEIAEKIVQMGTHILGIKDMAGTMKPAAAKLLIGSLRAKYPDLPIHVHTHDSAGTAVASM 776
           L I + + ++G + +GI D  G   P     LI +L++      I  H H+  G A+A+ 
Sbjct: 166 LNIYKTVDKIGVNRVGIADTVGCANPRQVYELIRTLKS-VVSCDIECHFHNDTGCAIANA 224

Query: 777 TACALAGADVVDVAI 791
                 GA ++DV++
Sbjct: 225 YTALEGGARLIDVSV 239

>KLLA0E15444g 1370741..1377427 highly similar to sp|P07259
           Saccharomyces cerevisiae YJL130c URA2 multifunctional
           pyrimidine biosynthesis protein, start by similarity
          Length = 2228

 Score = 36.6 bits (83), Expect = 0.14,   Method: Compositional matrix adjust.
 Identities = 62/298 (20%), Positives = 116/298 (38%), Gaps = 29/298 (9%)

Query: 35  FRTAHELSMQTVAIYSHEDRLSTHKQKADEAYVIGEVGQYTPVGAYLAIDEIISIAQKHQ 94
            +   E  + T+ I  +   + T K  AD+ Y       + PV A   + ++I   +   
Sbjct: 463 IKALKEEGIYTILINPNIATIQTSKGLADKVY-------FLPVTAEF-VRKVILHERPDA 514

Query: 95  VDFIHPGYGFLSENSEFADKVVKAGITWIGPPAEVIDSVGDKVSARNLAAKANVPTVPGT 154
           +     G   LS   E  D+    G+  +G P + + +  D+    N   + N       
Sbjct: 515 IYVTFGGQTALSVGIEMKDEFETLGVKVLGTPIDTVITTEDRELFANAMDEINEKCAKSA 574

Query: 155 PGPIETVEEALDFVNEYGYPVIIKAAFXXXXXXXXXXXXXXXXADAFQRATSEARTAFGN 214
                TV EAL+ V + G+PVI++AA+                 D           AF +
Sbjct: 575 A--AATVAEALEAVKDIGFPVIVRAAYALGGLGSGFASNEKELVDL-------CNVAFAS 625

Query: 215 G-TCFVERFLDKPKHIEVQLLADNHGNVVHLFERDCSVQR------RHQKVVEVAPAKTL 267
                VER +   K IE +++ D   N + +    C+++            + +AP++TL
Sbjct: 626 SPQVLVERSMKGWKEIEYEVVRDAFDNCITV----CNMENFDPLGIHTGDSIVIAPSQTL 681

Query: 268 PREVRDAILTDAVKLAKECGYRNAGTAEFLVDNQNRHY-FIEINPRIQVEHTITEEIT 324
             E  + + T AV + +  G       ++ ++  ++ Y  IE+N R+     +  + T
Sbjct: 682 SDEDYNMLRTTAVNVIRHLGVVGECNIQYALNPTSKEYCIIEVNARLSRSSALASKAT 739

>Kwal_56.24401
          Length = 441

 Score = 35.4 bits (80), Expect = 0.27,   Method: Compositional matrix adjust.
 Identities = 20/75 (26%), Positives = 35/75 (46%), Gaps = 1/75 (1%)

Query: 717 LEIAEKIVQMGTHILGIKDMAGTMKPAAAKLLIGSLRAKYPDLPIHVHTHDSAGTAVASM 776
           L I + +  +G + +GI D  G   P     L+ +L+       +  H H+  G A+A+ 
Sbjct: 179 LNIYKTVDAIGVNRVGIADTVGCANPRQVYELMRTLKT-VVSCDVECHFHNDTGCAIANA 237

Query: 777 TACALAGADVVDVAI 791
                 GA ++DVA+
Sbjct: 238 YTALEGGAKLIDVAV 252

>CAGL0C04917g 457506..460847 highly similar to sp|P03965
           Saccharomyces cerevisiae YJR109c CPA2, hypothetical
           start
          Length = 1113

 Score = 35.4 bits (80), Expect = 0.34,   Method: Compositional matrix adjust.
 Identities = 70/365 (19%), Positives = 134/365 (36%), Gaps = 56/365 (15%)

Query: 9   LRDNFN--LLGEKNKILVANRGEIPI-----------RIFRTAHELSMQTVAIYSHEDRL 55
           L+D +N  L+   NK+L+   G + I           +  +   E  ++T+ I  +    
Sbjct: 15  LKDKYNPQLVQGVNKVLIVGSGGLSIGQAGEFDYSGSQAIKALKESKIETILINPNIATN 74

Query: 56  STHKQKADEAYVIGEVGQYTPVGAYLAIDEIISIAQKHQVDFIHPGYG---------FLS 106
            T    AD+ Y       Y PV      + I  I +K + D I   +G          L 
Sbjct: 75  QTSHSLADKIY-------YLPVTP----EYITYIIEKDRPDAILLTFGGQTALNCGIHLD 123

Query: 107 ENSEFADKVVKAGITWIGPPAEVIDSVGDKVSARNLAAKANVPTVPGTPGPIETVEEALD 166
           E    A    K  +  +G P + + +  D+    +   + ++P         E +++ L 
Sbjct: 124 ETGILA----KFNVKVLGTPIKTLITSEDRDLFASALKEIDIPIAESIA--CENIDDVLS 177

Query: 167 FVNEYGYPVIIKAAFXXXXXXXXXXXXXXXXADAFQRATSEARTAFGNGTCFVERFLDKP 226
             +  GYPVII++A+                 +   ++ S A          VE+ L   
Sbjct: 178 AASTIGYPVIIRSAYALGGLGSGFANNPEELKELASQSLSLAP------QVLVEKSLRGW 231

Query: 227 KHIEVQLLADNHGNVVHLFERDCSVQR------RHQKVVEVAPAKTLPREVRDAILTDAV 280
           K +E +++ D   N + +    C+++            +  AP++TL  E    + + A+
Sbjct: 232 KEVEYEVVRDRENNCITV----CNMENFDPLGVHTGDSIVFAPSQTLSDEEFHMLRSAAI 287

Query: 281 KLAKECGYRNAGTAEF-LVDNQNRHYFIEINPRIQVEHTITEEITXXXXXXXXXXXXXXX 339
           K+ +  G       ++ L  N   +  IE+N R+     +  + T               
Sbjct: 288 KIIRHLGVVGECNVQYALSPNSLDYRVIEVNARLSRSSALASKATGYPLAYTAAKIALGY 347

Query: 340 SLPQL 344
           +LP+L
Sbjct: 348 TLPEL 352

 Score = 33.1 bits (74), Expect = 1.7,   Method: Compositional matrix adjust.
 Identities = 33/156 (21%), Positives = 58/156 (37%), Gaps = 5/156 (3%)

Query: 158 IETVEEALDFVNEYGYPVIIKAAFXXXXXXXXXXXXXXXXADAFQRATSEARTAFGNGTC 217
           + +VEEA  F N+  YPV+I+ ++                 D    A+  +     +   
Sbjct: 714 LTSVEEAKTFANKVSYPVLIRPSYVLSGAAMSVVNNEHELEDKLTLASDVSP----DHPV 769

Query: 218 FVERFLDKPKHIEVQLLADNHGNVVHLFERDCSVQRRHQ-KVVEVAPAKTLPREVRDAIL 276
            + +F+   + I+V  +A N   +VH           H      + P + L   V+  + 
Sbjct: 770 VMSKFIQGAQEIDVDAVACNGELLVHAISEHVEDAGVHSGDATLILPPQHLSENVKSQLK 829

Query: 277 TDAVKLAKECGYRNAGTAEFLVDNQNRHYFIEINPR 312
           T A K+AK          + +   +N    IE N R
Sbjct: 830 TIAKKVAKAWNITGPFNMQVIKAGENDLKVIECNIR 865

>Kwal_47.19231
          Length = 795

 Score = 34.7 bits (78), Expect = 0.48,   Method: Compositional matrix adjust.
 Identities = 30/127 (23%), Positives = 52/127 (40%), Gaps = 3/127 (2%)

Query: 112 ADKVVKAGITWIGPPAEVIDSVGDKVSARNLAAKANVPTVPGTPGPIETVEEALDFVNEY 171
           AD   KAGI   GP A+     G K  +++  AK N+PT        +  E+A +++ + 
Sbjct: 87  ADVFTKAGIPVFGPSAKAAIFEGSKTFSKDFMAKHNIPTA--RYANFDDYEKAKEYLEKV 144

Query: 172 GYPVIIKAAFXXXXXXXXXXXXXXXXADAFQRATSEARTAFGNGTCFVERFLDKPKHIEV 231
            Y V++KA                   DA +    E +      +  +E FL+    I +
Sbjct: 145 DYQVVLKADGIAAGKGVLIPTTPQEAQDALKALMVERQFGAAGDSIVIEEFLEG-DEISI 203

Query: 232 QLLADNH 238
             ++D +
Sbjct: 204 LTISDGY 210

>KLLA0D03146g complement(263816..264970) similar to sp|P53164
           Saccharomyces cerevisiae YGL067w NPY1 NADH
           pyrophosphatase I of the Nudix family of hydrolases, has
           a peroxisomal targeting signal singleton, start by
           similarity
          Length = 384

 Score = 32.7 bits (73), Expect = 1.8,   Method: Compositional matrix adjust.
 Identities = 26/70 (37%), Positives = 35/70 (50%), Gaps = 10/70 (14%)

Query: 787 VDVAINSMSGLTSQP---SINALLASLEGNIDTG-----INVEHVREL-DAYWAEMRLLY 837
           + V +N +  L +QP     N ++  L G ID       IN+EH +EL DA W EM L+ 
Sbjct: 279 IKVELNDVDILFTQPWPYPCNLMIGCL-GLIDFNGDNEIINLEHDKELLDAQWFEMELVS 337

Query: 838 SCFEADLKGP 847
             FE   K P
Sbjct: 338 QAFERYGKAP 347

>YHR216W (IMD2) [2500] chr8 (554394..555965)
           Inosine-5'-monophosphate dehydrogenase, catalyzes the
           conversion of inosine 5'-phosphate and NAD(+) to
           xanthosine 5'-phosphate and NADH, the first reaction
           unique to GMP biosynthesis [1572 bp, 523 aa]
          Length = 523

 Score = 32.0 bits (71), Expect = 3.5,   Method: Compositional matrix adjust.
 Identities = 39/131 (29%), Positives = 59/131 (45%), Gaps = 12/131 (9%)

Query: 363 TTEDPAKNFQPDTGRIEVYRSAGG-NGVRLDG--GNAYAGTIISPHYDSMLVKCSCSGST 419
           TTE P + F  D  R++ YR  G  + ++  G  GNA      S   DS+LV    SG+ 
Sbjct: 397 TTESPGEYFYQDGKRLKAYRGMGSIDAMQKTGTKGNASTSRYFS-ESDSVLVAQGVSGA- 454

Query: 420 YEIVRRKMIRALIEFRIRGVKTNIPFL----LTLLTNPVFIEGTYWTTFIDDTPQLFQMV 475
             +V +  I+  I +   G++ +   +    LTLL N V   G     F   + QL   V
Sbjct: 455 --VVDKGSIKKFIPYLYNGLQHSCQDIGCRSLTLLKNNV-QRGKVRFEFRTASAQLEGGV 511

Query: 476 SSQNRAQKLLH 486
            + +  +K LH
Sbjct: 512 HNLHSYEKRLH 522

  Database: blastdb
    Posted date:  Apr 3, 2006  3:33 PM
  Number of letters in database: 16,596,109
  Number of sequences in database:  34,618
  
Lambda     K      H
   0.319    0.136    0.398 

Gapped
Lambda     K      H
   0.267   0.0410    0.140 

Matrix: BLOSUM62
Gap Penalties: Existence: 11, Extension: 1
Number of Sequences: 34618
Number of Hits to DB: 34,960,103
Number of extensions: 1454563
Number of successful extensions: 3852
Number of sequences better than 10.0: 59
Number of HSP's gapped: 3862
Number of HSP's successfully gapped: 88
Length of query: 1157
Length of database: 16,596,109
Length adjustment: 113
Effective length of query: 1044
Effective length of database: 12,684,275
Effective search space: 13242383100
Effective search space used: 13242383100
Neighboring words threshold: 11
Window for multiple hits: 40
X1: 16 ( 7.4 bits)
X2: 38 (14.6 bits)
X3: 64 (24.7 bits)
S1: 41 (21.8 bits)
S2: 67 (30.4 bits)